Identifiers and Description

Gene Model Identifier

TTHERM_00947410

Standard Name

ERI6 (ERI1-exoribonuclease 6)

Aliases

PreTt19661 | 174.m00045 | 3678.m00010

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00947410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19802.19.997093137033517e-262exonuclease (1013 aa)
OxytrichaContig3963.0.g429.997975313387782e-28RNA 2-phosphotransferase, Tpt1
/ KptA family
WormBaseWBGene000013322.000620012690291e-23locus:eri-1 3-5 exonuclease
eri-1 status:Partially_confi
rmed UniProt:O44406 protei
n_id:CCD73975.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00947410(coding)
ATGGACAATTTAAATTTAGTCTCTTCTCCTTCACTTTCTTCGTCTCCAAGCACCAAGGAA
TAATCAACAGAGTAACCAAAGTCTAGTGAGCGAAAGAGTTTGAAGGAATAAGACAGAGTA
AATCAAACTCCTTCTAACATTTAGTCAACAACAAAGGTAAAAAAGTAGAAATAAAATAAT
GAAGAATCGGAAAATAATTCTGACATAAAAAATTTCAGCATTCACGGAGAAGAGCAAGAA
GAAATAGAAGGAGCAGAGGACTTAAGAACCCCAGACGCAAATGTTGCTAAAAATTAATTA
CCTCCTCCTCAAGCTGGTTCTGGATAACATTGCTAGGCAGAAATATTAGCTAAATAAAAT
GATAAAGAGGAAGACTAGAACGAAGATTACGATTTCTACGAAGAAGAAGAATATGAGGAG
GAAGATGATTTAGATGAAGATTTTTTAGACAGAGATGGCGATAATGGTTTTTATTCAACT
GAAGATGGTAATAAGAGTGTTAAATAAAAAAAAAATAAGTTTACAAAGGAGTTTATTAGT
GTGATTAAATCTAATTCGGAGGAATTACGCAATGAAAAGAGTGATGATCCTCTTGACTAC
TTATTTGTCATTGATTTTGAATGCAATCAACCAGGCAGCGAAATTATTGAGTTTCCTATT
ACTGTTGTCGATTTAAAGTAGAGAAAGGTTGTAGACACCTTCCATTCCTATGTTAGACCT
ACAAAGATAAAAAAGCTTAGCAATTTCATTAAAAAGCTTACTGGGATTAAGTAAGAAGAT
GTTGATGCATCAGAGAGTATTGAAACTATTATAACTCGAGTTGAAGCATTTTTGAGTAAA
TACCAACAATCTAAAGCAGCAATACTCTACGACTGCGCAAATGATGCTAAATTTTTAAGC
AATGAAATTAAGAACAAATAATTGAATATAACAAATAAATTCCTTCTTAGTTATATTAAT
TTGCGTAATGTTTTTCCTATTAATCTCACTGGCGGAATCAAAAATATTAGTCTCAGCCAT
GCTTTAGAAGTGCTGGATATGAGTTTTGAGGGATAAAAACATACAGGTAGGGACGATTCA
ATTAACATAGCAAGAGTATGCATGGAAATGATAAATCATTAGTTTACTTTCACTTAATTT
ATGAGATAGTCTTAGTTTTGCTTAGACAATCCAAAGAGGCTAGTTGAATCAACAATTAAT
GATCTTTTTAAAATGAATAAATACTTAATAGCAATAGACATCAAATTTTATGGAGATAAA
AAGGATTTAAACACTAAAAACAACATTATTCTATGCAAATCATTCAAATTTCATCTATTT
TAAATCAAGCAAACAGATTAAGACTCAGTATCTTCAACTTAAATCAATCAGAACATCCAA
ACTACTCCATAAAAATCTAGTTTTAAATTAAAGACATCTGCAGAGAAGTAGGCTGAATAG
CAATTACTATTACAATAAAAAACATTACAATAATAGCAAAAACAATAACAATAACAACAA
CAATAGCAATAATAAGAGGAGTCTGTGAAAAAGAATTTAGAAAATTTATAGATTGATACC
TAAACAGCTTAAAATCAATAGGTGCAGCAAAATTTGTAAAACTCATAGGCTTAACCTAAT
TCTAATGTGAACTAATAACAATAATAAAAAGAAGATACTCCTTAGTAAATACATTAGAAA
TAGACTACTGCTAAATAAAATTTGATAGATGAAATAGATTGTTATTCATAAGAATTTAAT
AATTTACAATATTAACTTTAAGATTACTTTGAGTTACTGTAGAATTTAATTGATTTGTAT
CATAAATATGGCATTAAATGTTAAAATTCTATGATAATTCTTAATAGTAGTACAAAGCAA
AAGTACTTTTCTAAATTCTTTAAGTTCATTACAACTATGTTCAAAACAAACAAAACAGCA
TTTATTTTCAAAAAAAAAATACTCAATTTGCAAGAAGTACTCGAGAAATAAATTATTATT
GATTAAAAGTCATCTGATGCGATAATGGCTGAAGAATTTCCTTAAAATATAATTAAGCTA
GTTGATTTCTTTTAATCTTAAAGTTTCGCTGTAAAAGAACTACCTTAATGCTTTCAAAAG
AAAACTATGCCCAATATTTCTGAAGGATAGTAAAATTAGTACAGAGAAACATCTTAATAT
CCTTATTCATTTTATGATTCTCCCTAGTACGGATAATACATAAATGGTTTTTATTCTTAA
AAACAACAATCTCCTTAAAAAGTTCTTTAATAGCAGCCATTTGGTCTATACTAACAATAA
AACTAATAAAATATTGATTACTTTAATCCAAACACAGCTAATTCAAATCTAAATTAACTG
TAGATGATGTATTAATTATAACAGTAAGCTCAGCATGTATATAATTAGTAAAATTAAGCC
CTAGCAAATTAGTAGAACTCACCATTTTATTTCTAGCAAGCAATCAATTAAATGAACAAT
AACTACATGTATTAATTGTAATTCTTTAATCCTGCAATTTTTTCTCTTCCACCAAATTGC
ATGGATAGCTAGCTCTAGTAATAAATAATGTTTCATTCGTAATAGTTTTTATAATAATTA
GAGTAGAATTAGAGTTAGTAATTTACCTTTCCTCCTTAAAGCCATCAACAAACATAATAG
CAACATTAGTAATCTTTAAATTAATCTTAGTAGCAGTAGTATCCATACAATTATAAATAA
CCTCCATACTCCTCACAATAATCATCTTCCACTACCTAGCACAACAAATCTAATTCTTCT
TTCTTTGGAAGTTATCCTTCTTAAAGCTTGAAAAATAATAATAATGCCTAATAGAATGAA
GGATAAAATATTTCTAGAAAGAAGAATTTCAGAAATAATAGCTAAATATATAATGGATTT
TAGAATAATGCCTTTTACTAAGATTCATATAATAATAGCAATATAAACAGTGGAAATCAA
AACTTTTAAAAAAATTCTTAAAGTAGCTCTAGCAATATCTCAGTTAATTCTAGTCCATTA
ATAAGTTTTCCTGCAGAGAATAAGCGTGGATAAAATTCTTAAATCAGCCAACCAACACTT
TATAGTAGTTATATACAAAATAGTGGTATAAACAAGCCTAATGCTTTCAACAATCAAAAT
AAAAACAAATTTTATAAAAAATGA


>TTHERM_00947410(protein)
MDNLNLVSSPSLSSSPSTKEQSTEQPKSSERKSLKEQDRVNQTPSNIQSTTKVKKQKQNN
EESENNSDIKNFSIHGEEQEEIEGAEDLRTPDANVAKNQLPPPQAGSGQHCQAEILAKQN
DKEEDQNEDYDFYEEEEYEEEDDLDEDFLDRDGDNGFYSTEDGNKSVKQKKNKFTKEFIS
VIKSNSEELRNEKSDDPLDYLFVIDFECNQPGSEIIEFPITVVDLKQRKVVDTFHSYVRP
TKIKKLSNFIKKLTGIKQEDVDASESIETIITRVEAFLSKYQQSKAAILYDCANDAKFLS
NEIKNKQLNITNKFLLSYINLRNVFPINLTGGIKNISLSHALEVLDMSFEGQKHTGRDDS
INIARVCMEMINHQFTFTQFMRQSQFCLDNPKRLVESTINDLFKMNKYLIAIDIKFYGDK
KDLNTKNNIILCKSFKFHLFQIKQTDQDSVSSTQINQNIQTTPQKSSFKLKTSAEKQAEQ
QLLLQQKTLQQQQKQQQQQQQQQQQEESVKKNLENLQIDTQTAQNQQVQQNLQNSQAQPN
SNVNQQQQQKEDTPQQIHQKQTTAKQNLIDEIDCYSQEFNNLQYQLQDYFELLQNLIDLY
HKYGIKCQNSMIILNSSTKQKYFSKFFKFITTMFKTNKTAFIFKKKILNLQEVLEKQIII
DQKSSDAIMAEEFPQNIIKLVDFFQSQSFAVKELPQCFQKKTMPNISEGQQNQYRETSQY
PYSFYDSPQYGQYINGFYSQKQQSPQKVLQQQPFGLYQQQNQQNIDYFNPNTANSNLNQL
QMMYQLQQQAQHVYNQQNQALANQQNSPFYFQQAINQMNNNYMYQLQFFNPAIFSLPPNC
MDSQLQQQIMFHSQQFLQQLEQNQSQQFTFPPQSHQQTQQQHQQSLNQSQQQQYPYNYKQ
PPYSSQQSSSTTQHNKSNSSFFGSYPSQSLKNNNNAQQNEGQNISRKKNFRNNSQIYNGF
QNNAFYQDSYNNSNINSGNQNFQKNSQSSSSNISVNSSPLISFPAENKRGQNSQISQPTL
YSSYIQNSGINKPNAFNNQNKNKFYKK


>TTHERM_00947410(gene)
ATGGACAATTTAAATTTAGTCTCTTCTCCTTCACTTTCTTCGTCTCCAAGCACCAAGGAA
TAATCAACAGAGTAACCAAAGTCTAGTGAGCGAAAGAGTTTGAAGGAATAAGACAGAGTA
AATCAAACTCCTTCTAACATTTAGTCAACAACAAAGGTAAAAAAGTAGAAATAAAATAAT
GAAGAATCGGAAAATAATTCTGACATAAAAAATTTCAGCATTCACGGAGAAGAGCAAGAA
GAAATAGAAGGAGCAGAGGACTTAAGAACCCCAGACGCAAATGTTGCTAAAAATTAATTA
CCTCCTCCTCAAGCTGGTTCTGGATAACATTGCTAGGCAGAAATATTAGCTAAATAAAAT
GATAAAGAGGAAGACTAGAACGAAGATTACGATTTCTACGAAGAAGAAGAATATGAGGAG
GAAGATGATTTAGATGAAGATTTTTTAGACAGAGATGGCGATAATGGTTTTTATTCAACT
GAAGATGGTAATAAGAGTGTTAAATAAAAAAAAAATAAGTTTACAAAGGAGTTTATTAGT
GTGATTAAATCTAATTCGGAGGAATTACGCAATGAAAAGAGTGATGATCCTCTTGACTAC
TTATTTGTCATTGATTTTGAATGCAATCAACCAGGCAGCGAAATTATTGAGTTTCCTATT
ACTGTTGTCGATTTAAAGTAGAGAAAGGTTGTAGACACCTTCCATTCCTATGTTAGACCT
ACAAAGATAAAAAAGCTTAGCAATTTCATTAAAAAGCTTACTGGGATTAAGTAAGAAGAT
GTTGATGCATCAGAGAGTATTGAAACTATTATAACTCGAGTTGAAGCATTTTTGAGTAAA
TACCAACAATCTAAAGCAGCAATACTCTACGACTGCGCAAATGATGCTAAATTTTTAAGC
AATGAAATTAAGAACAAATAATTGAATATAACAAATAAATTCCTTCTTAGTTATATTAAT
TTGCGTAATGTTTTTCCTATTAATCTCACTGGCGGAATCAAAAATATTAGTCTCAGCCAT
GCTTTAGAAGTGCTGGATATGAGTTTTGAGGGATAAAAACATACAGGTAGGGACGATTCA
ATTAACATAGCAAGAGTATGCATGGAAATGATAAATCATTAGTTTACTTTCACTTAATTT
ATGAGATAGTCTTAGTTTTGCTTAGACAATCCAAAGAGGCTAGTTGAATCAACAATTAAT
GATCTTTTTAAAATGAATAAATACTTAATAGCAATAGACATCAAATTTTATGGAGATAAA
AAGGATTTAAACACTAAAAACAACATTATTCTATGCAAATCATTCAAATTTCATCTATTT
TAAATCAAGCAAACAGATTAAGACTCAGTATCTTCAACTTAAATCAATCAGAACATCCAA
ACTACTCCATAAAAATCTAGTTTTAAATTAAAGACATCTGCAGAGAAGTAGGCTGAATAG
CAATTACTATTACAATAAAAAACATTACAATAATAGCAAAAACAATAACAATAACAACAA
CAATAGCAATAATAAGAGGAGTCTGTGAAAAAGAATTTAGAAAATTTATAGATTGATACC
TAAACAGCTTAAAATCAATAGGTGCAGCAAAATTTGTAAAACTCATAGGCTTAACCTAAT
TCTAATGTGAACTAATAACAATAATAAAAAGAAGATACTCCTTAGTAAATACATTAGAAA
TAGACTACTGCTAAATAAAATTTGATAGATGAAATAGATTGTTATTCATAAGAATTTAAT
AATTTACAATATTAACTTTAAGATTACTTTGAGTTACTGTAGAATTTAATTGATTTGTAT
CATAAATATGGCATTAAATGTTAAAATTCTATGATAATTCTTAATAGTAGTACAAAGCAA
AAGTACTTTTCTAAATTCTTTAAGTTCATTACAACTATGTTCAAAACAAACAAAACAGCA
TTTATTTTCAAAAAAAAAATACTCAATTTGCAAGAAGTACTCGAGAAATAAATTATTATT
GATTAAAAGTCATCTGATGCGATAATGGCTGAAGAATTTCCTTAAAATATAATTAAGCTA
GTTGATTTCTTTTAATCTTAAAGTTTCGCTGTAAAAGAACTACCTTAATGCTTTCAAAAG
AAAACTATGCCCAATATTTCTGAAGGATAGTAAAATTAGTACAGAGAAACATCTTAATAT
CCTTATTCATTTTATGATTCTCCCTAGTACGGATAATACATAAATGGTTTTTATTCTTAA
AAACAACAATCTCCTTAAAAAGTTCTTTAATAGCAGCCATTTGGTCTATACTAACAATAA
AACTAATAAAATATTGATTACTTTAATCCAAACACAGCTAATTCAAATCTAAATTAACTG
TAGATGATGTATTAATTATAACAGTAAGCTCAGCATGTATATAATTAGTAAAATTAAGCC
CTAGCAAATTAGTAGAACTCACCATTTTATTTCTAGCAAGCAATCAATTAAATGAACAAT
AACTACATGTATTAATTGTAATTCTTTAATCCTGCAATTTTTTCTCTTCCACCAAATTGC
ATGGATAGCTAGCTCTAGTAATAAATAATGTTTCATTCGTAATAGTTTTTATAATAATTA
GAGTAGAATTAGAGTTAGTAATTTACCTTTCCTCCTTAAAGCCATCAACAAACATAATAG
CAACATTAGTAATCTTTAAATTAATCTTAGTAGCAGTAGTATCCATACAATTATAAATAA
CCTCCATACTCCTCACAATAATCATCTTCCACTACCTAGCACAACAAATCTAATTCTTCT
TTCTTTGGAAGTTATCCTTCTTAAAGCTTGAAAAATAATAATAATGCCTAATAGAATGAA
GGATAAAATATTTCTAGAAAGAAGAATTTCAGAAATAATAGCTAAATATATAATGGATTT
TAGAATAATGCCTTTTACTAAGATTCATATAATAATAGCAATATAAACAGTGGAAATCAA
AACTTTTAAAAAAATTCTTAAAGTAGCTCTAGCAATATCTCAGTTAATTCTAGTCCATTA
ATAAGTTTTCCTGCAGAGAATAAGCGTGGATAAAATTCTTAAATCAGCCAACCAACACTT
TATAGTAGTTATATACAAAATAGTGGTATAAACAAGCCTAATGCTTTCAACAATCAAAAT
AAAAACAAATTTTATAAAAAATGA