Identifiers and Description

Gene Model Identifier

TTHERM_00684720

Standard Name

ERI5 (ERI1-exoribonuclease 5)

Aliases

PreTt18185 | 104.m00117 | 3732.m00031

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00929 ) exonuclease
  • ( PF06975 ) Protein of unknown function (DUF1299)
  • ( PF00641 ) Zn-finger in Ran binding protein
  • ( TIGR00573 ) exonuclease, DNA polymerase III, epsilon

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00684720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15493.15.001102406662288e-90hypothetical protein (1194 aa)
OxytrichaContig3963.0.g421.9999391735788327e-19RNA 2-phosphotransferase, Tpt1
/ KptA family
WormBaseWBGene000013329.995317835403734e-19locus:eri-1 3-5 exonuclease
eri-1 status:Partially_confi
rmed UniProt:O44406 protei
n_id:CCD73976.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00684720(coding)
ATGAAGAATAACAATTATGAAAAATTTTAAAACAAGCAGCAAAACCACATTTAATATGTG
AGAAAAAATCAACAAGCAACTGATTAATTACCAAGTAAACAAAATCAATAGGTTTTTTAT
GTAAGAAAATAATAAAATGGAAATGAATATTTTAATCAGCTAGAAAATAATTAAAATTAT
AATATGAGCTTATAATAAAGCAACTAGTTGAGTTATTCAAACAAAAATGAGGAAGACATT
ATCAGAAATTTATAGGAACTAAATAATTTAATCAATAACAAAAATGTTTAGAACTAAAAT
TAAGATTCTGATTAAAAAAACTAAAATTTCAACTAATAATGTTAATAAAATGATTAGGTA
AATAGAAATAGTTAATAATAAAGCAAAAATTAGGAAGATATTATCAAAAATTTATAGGAA
CTAGATAATTTAATCAATAACAAAAGTTTTTTGAACTATGATTAAGTTTCTTAAGGTTAA
AAAAGCTTCAACTTCACCTAATAATATCAATAAAATTATTAGGTAAATACAAATATCTAA
TATTAAAGTAAAAATGACCAAGATATTATCAGAAATTTATAGGAACTAGATAATTTAATC
AATAACAAAGGTTTTTAGAAATAATATTAAGTTTCTTAAGCTTAAAAAAGCTTCAACTTC
AACTAATAATAATATCAATAAAATTACTAGGTAAATAGATATGACTAATAAAAAATAGTA
AATGTTCCTAAAAAATAATAGTACTTTAAAGTAAATAACCAAATCTTAGATAAATAGGTT
TATAATAATAATAATTAAATAATATAATAATCAGGTAGTAATCACAATTTTTAAAGTCAG
CAAAACAATCAAAATAAATAAATAAACAATTAATTTAACCCAATAAAAGTTCAAGAAGAT
TAAATTTTTTTAAAAATGGAAGAGTAGAATAAGAGAGATAAAATTATTGTTTAAGAAATG
CAACAAAAAGATCAGTAAAAAAATATGGATAAATAAATGAAAAATGGGTAAAAAAATTGT
ATTCAAAGCAATAATTAATAAGAAAATAACTAAAACTTATAAAATCAAAATTAAAAAAAG
AAGAAAAATAATAATTAAAATAACTTTAAAGATGTATATTGGATTTGTAAAGGCTGTAAA
GTAAAAATTCAATGGGATATGTAAAATTGTTAAGCTTGTGGAGCATAGAAATTTCCAGGA
ATTAGCAGAATGAAAAAAAATGTTGGGTAGAATGATTTCTAGTATTTATTTTTCATTGAT
TTTGAGTGCAATTTCTTTAATAAAAAATTTGAAATAATTGAATTTCCATTACATGTTATT
GATGTAAATAGTAAAGAAATTGTAGATTCTTTTGTTTCCTATGTTAAACCAAGCAATAAT
ATAACAAAATTTATAACTAGATTAACAAAAATTACTGATACTTAAGTTAAAAATGCCCCT
ATTCTTTAATAAGTACTAGTAAATGTATAAAACTTCTTAGAAAAATATCTAAAAGTAGGT
ATAGATAAATGTGCTGTAATTTATGACTGTGATAGTGATTCAACATTTCTGTTTAATGAA
ACCTCTTTTAAGAAAATAAAAGTTCCACCTATTTTTGAGAAATACATTTGTCTTAAATCT
GTTTTCCCTGTTGAAATAGCTAATAAAGCTCCTTCATCTTTATCCCAAATGCTTTAAATT
CTAGATATGAAATTTGAAGGTTAAAAGCACTGTGGAGCTGATGATTCTATGAACTAAGCA
AAAGTTGGCTAGAAACTGTTACAACTAGGTTATAATTTCTCAAAAGACTAATAAATAAAA
TTAGGAAAACCAAGCACAATTAGCAGAAAAGAAAAATTGAAATTAATAGACATATATATT
AAAGAATACGAGCTTGATAAATAGAAAAATAATGAAAACTAAAATGATTAAAATAAATGA


>TTHERM_00684720(protein)
MKNNNYEKFQNKQQNHIQYVRKNQQATDQLPSKQNQQVFYVRKQQNGNEYFNQLENNQNY
NMSLQQSNQLSYSNKNEEDIIRNLQELNNLINNKNVQNQNQDSDQKNQNFNQQCQQNDQV
NRNSQQQSKNQEDIIKNLQELDNLINNKSFLNYDQVSQGQKSFNFTQQYQQNYQVNTNIQ
YQSKNDQDIIRNLQELDNLINNKGFQKQYQVSQAQKSFNFNQQQYQQNYQVNRYDQQKIV
NVPKKQQYFKVNNQILDKQVYNNNNQIIQQSGSNHNFQSQQNNQNKQINNQFNPIKVQED
QIFLKMEEQNKRDKIIVQEMQQKDQQKNMDKQMKNGQKNCIQSNNQQENNQNLQNQNQKK
KKNNNQNNFKDVYWICKGCKVKIQWDMQNCQACGAQKFPGISRMKKNVGQNDFQYLFFID
FECNFFNKKFEIIEFPLHVIDVNSKEIVDSFVSYVKPSNNITKFITRLTKITDTQVKNAP
ILQQVLVNVQNFLEKYLKVGIDKCAVIYDCDSDSTFLFNETSFKKIKVPPIFEKYICLKS
VFPVEIANKAPSSLSQMLQILDMKFEGQKHCGADDSMNQAKVGQKLLQLGYNFSKDQQIK
LGKPSTISRKEKLKLIDIYIKEYELDKQKNNENQNDQNK


>TTHERM_00684720(gene)
ATGAAGAATAACAATTATGAAAAATTTTAAAACAAGCAGCAAAACCACATTTAATATGTG
AGAAAAAATCAACAAGCAACTGATTAATTACCAAGTAAACAAAATCAATAGGTTTTTTAT
GTAAGAAAATAATAAAATGGAAATGAATATTTTAATCAGCTAGAAAATAATTAAAATTAT
AATATGAGCTTATAATAAAGCAACTAGTTGAGTTATTCAAACAAAAATGAGGAAGACATT
ATCAGAAATTTATAGGAACTAAATAATTTAATCAATAACAAAAATGTTTAGAACTAAAAT
TAAGATTCTGATTAAAAAAACTAAAATTTCAACTAATAATGTTAATAAAATGATTAGGTA
AATAGAAATAGTTAATAATAAAGCAAAAATTAGGAAGATATTATCAAAAATTTATAGGAA
CTAGATAATTTAATCAATAACAAAAGTTTTTTGAACTATGATTAAGTTTCTTAAGGTTAA
AAAAGCTTCAACTTCACCTAATAATATCAATAAAATTATTAGGTAAATACAAATATCTAA
TATTAAAGTAAAAATGACCAAGATATTATCAGAAATTTATAGGAACTAGATAATTTAATC
AATAACAAAGGTTTTTAGAAATAATATTAAGTTTCTTAAGCTTAAAAAAGCTTCAACTTC
AACTAATAATAATATCAATAAAATTACTAGGTAAATAGATATGACTAATAAAAAATAGTA
AATGTTCCTAAAAAATAATAGTACTTTAAAGTAAATAACCAAATCTTAGATAAATAGGTT
TATAATAATAATAATTAAATAATATAATAATCAGGTAGTAATCACAATTTTTAAAGTCAG
CAAAACAATCAAAATAAATAAATAAACAATTAATTTAACCCAATAAAAGTTCAAGAAGAT
TAAATTTTTTTAAAAATGGAAGAGTAGAATAAGAGAGATAAAATTATTGTTTAAGAAATG
CAACAAAAAGATCAGTAAAAAAATATGGATAAATAAATGAAAAATGGGTAAAAAAATTGT
ATTCAAAGCAATAATTAATAAGAAAATAACTAAAACTTATAAAATCAAAATTAAAAAAAG
AAGAAAAATAATAATTAAAATAACTTTAAAGATGTATATTGGATTTGTAAAGGCTGTAAA
GTAAAAATTCAATGGGATATGTAAAATTGTTAAGCTTGTGGAGCATAGAAATTTCCAGGA
ATTAGCAGAATGAAAAAAAATGTTGGGTAGAATGATTTCTAGTATTTATTTTTCATTGAT
TTTGAGTGCAATTTCTTTAATAAAAAATTTGAAATAATTGAATTTCCATTACATGTTATT
GATGTAAATAGTAAAGAAATTGTAGATTCTTTTGTTTCCTATGTTAAACCAAGCAATAAT
ATAACAAAATTTATAACTAGATTAACAAAAATTACTGATACTTAAGTTAAAAATGCCCCT
ATTCTTTAATAAGTACTAGTAAATGTATAAAACTTCTTAGAAAAATATCTAAAAGTAGGT
ATAGATAAATGTGCTGTAATTTATGACTGTGATAGTGATTCAACATTTCTGTTTAATGAA
ACCTCTTTTAAGAAAATAAAAGTTCCACCTATTTTTGAGAAATACATTTGTCTTAAATCT
GTTTTCCCTGTTGAAATAGCTAATAAAGCTCCTTCATCTTTATCCCAAATGCTTTAAATT
CTAGATATGAAATTTGAAGGTTAAAAGCACTGTGGAGCTGATGATTCTATGAACTAAGCA
AAAGTTGGCTAGAAACTGTTACAACTAGGTTATAATTTCTCAAAAGACTAATAAATAAAA
TTAGGAAAACCAAGCACAATTAGCAGAAAAGAAAAATTGAAATTAATAGACATATATATT
AAAGAATACGAGCTTGATAAATAGAAAAATAATGAAAACTAAAATGATTAAAATAAATGA