Identifiers and Description

Gene Model Identifier

TTHERM_00127080

Standard Name

ERI4 (ERI1-exoribonuclease 4)

Aliases

PreTt09371 | 9.m00392 | 3699.m00101

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 26.5%

TetraMine Data

TTHERM_00127080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09125.19.997093137033517e-262exonuclease (564 aa)
OxytrichaContig3963.0.g426.000802209040518e-34RNA 2-phosphotransferase, Tpt1
/ KptA family
WormBaseWBGene000198252.998577119979921e-31status:Confirmed UniProt:Q9T
ZZ9 protein_id:CCD73172.1
DictyBaseDDB_G02831131.0000422327488734e-24eriA on chromosome: 4 position
263707 to 264369
Stentor CoeruleusSteCoe_237250.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00127080(coding)
ATGCATCAACACATTCTTCCCATGTTCTTGATGCCTGACATGCCTATGTTCTGCGTCAGA
AATTGTGGCTGTCGTCATCCTGATCGTGCTCATTGCTTCTCATGCCACAAAACAAGTGAA
AAATATAAGATTAAGCACAAGGATGACATGTGCTGTGAAAGCGAAGTTTCTCTCGAATAC
CTTTTTGTAATCGATTTTGAATGCACTTGCGATGAAGAAAAGCGTCTTAAAATACAAGAA
ATCATTGAATTTCCTATTGTTGTTATCGACCTTCGTAAAAAGGAAATCATAGATCGTTTC
CATTCATTTGTTCGTCCTACTCAGTACCCTATTCTAACTCCTTTCTGCACTAAGCTTACT
GGAATCACACAAGAATAAGTTGACTCAGCTCCTACTCTCCCTGAAGTATTGAAAGAAGTC
GATCGCTTCTTGGAAAAGTACATCAAGGATGGATTACAAAAAGTTTCAGTCTTAAACGAC
TGCGACTCTGATATTCGTAATTTCCTTCGTAAAGAAACCACATTCAAAGGTATTCCAGTC
AAACCTGTTTTTAAAGAATTCATCGATCTTCGTCGTATATTTCCTGTTAAGATATCAGAA
AAACCTACAAACATCGACCACATGCTTTCTTGTGTGGGGTTAACCTTTGAAGGAGTGAAA
CATTGTGGTTTAGATGATGCAACAAATATTGCCAGAGTTGCTTTAGAAATTGCTAAAAGA
GATTACATCTACACTGAACATCTTAAGGAACACATGTATCCCTATGATAACCCTCACTAC
TATGAGCATTTGGTAATCATAGCAACCTAACCTAAAATGAAAAATAACGTAGAAATTGCT
ATGATAGCCCATGATTTAAGAAAGGGAAAGACTCTTTGGAATAATCTAGGAAATAAGAGT
GTCAAGAAATAAGAAATGAAAAAGGAGCTCTTCGAATTCTTAGATAAAGTTGGAATTGAC
ATCAATAACTCTATTTTGTGTGTTCAAGGTAAGCTTGAAAACGAAGTTCGTGCATTCTTC
CAAACTTCTGAAAATCAACCAATGAAGAATGAAGGTAACACTAACTTGTTTATGAGTGGA
AACTTAACAGATAGTACATCTTCTACTTGTTCTTCTTCTTCATCATCACCTTCTTAATAA
TGTTAAAGCACTTCTACAAATTGCCTCACAAGCTCTAACATCTCCTCCATAAACAACTCT
GCATCTTCTAACTAGCAACAGCCCCAATCACCATACTAATCATCTTCATTTAACAATTTC
TTTACTACCTACTTCTCCCTTAACAAAATAAGCAAAATTGCAGGCATACCACTCGCTGGA
AATTAATTCATTTAACACCCTACCTACTCATAAAGATACTAGCGCAACAGAAATGTGTAC
TAGCCTTACCCATTCTAAATGAATGGATAATACTATCCAATTGACTAGTCATTCATGAGT
GGATGCAATAATCCATTTTAAACTTAATTTGCAAAAAACTAATAAAATTTTGCAGATTTA
AATTAAGCAAACAATGAAAACTTGACTAAATGGTGGAATGGTATTAAAGATACTACCTCC
CCTGTTACTAGAATTACTACCATGTGTAACACAGTAGAGACAGCTCTTCAAAATGGTTTT
ATCTTCACCAAGGACTTCGCCTCCACAATCCAATTCAAGAGAGCCTTATCTAAAATGTGA


>TTHERM_00127080(protein)
MHQHILPMFLMPDMPMFCVRNCGCRHPDRAHCFSCHKTSEKYKIKHKDDMCCESEVSLEY
LFVIDFECTCDEEKRLKIQEIIEFPIVVIDLRKKEIIDRFHSFVRPTQYPILTPFCTKLT
GITQEQVDSAPTLPEVLKEVDRFLEKYIKDGLQKVSVLNDCDSDIRNFLRKETTFKGIPV
KPVFKEFIDLRRIFPVKISEKPTNIDHMLSCVGLTFEGVKHCGLDDATNIARVALEIAKR
DYIYTEHLKEHMYPYDNPHYYEHLVIIATQPKMKNNVEIAMIAHDLRKGKTLWNNLGNKS
VKKQEMKKELFEFLDKVGIDINNSILCVQGKLENEVRAFFQTSENQPMKNEGNTNLFMSG
NLTDSTSSTCSSSSSSPSQQCQSTSTNCLTSSNISSINNSASSNQQQPQSPYQSSSFNNF
FTTYFSLNKISKIAGIPLAGNQFIQHPTYSQRYQRNRNVYQPYPFQMNGQYYPIDQSFMS
GCNNPFQTQFAKNQQNFADLNQANNENLTKWWNGIKDTTSPVTRITTMCNTVETALQNGF
IFTKDFASTIQFKRALSKM


>TTHERM_00127080(gene)
ATGCATCAACACATTCTTCCCATGTTCTTGATGCCTGACATGCCTATGTTCTGCGTCAGA
AATTGTGGCTGTCGTCATCCTGATCGTGCTCATTGCTTCTCATGCCACAAAACAAGTGAA
AAATATAAGATTAAGCACAAGGATGACATGTGCTGTGAAAGCGAAGTTTCTCTCGAATAC
CTTTTTGTAATCGATTTTGAATGCACTTGCGATGAAGAAAAGCGTCTTAAAATACAAGAA
ATCATTGAATTTCCTATTGTTGTTATCGACCTTCGTAAAAAGGAAATCATAGATCGTTTC
CATTCATTTGTTCGTCCTACTCAGTACCCTATTCTAACTCCTTTCTGCACTAAGCTTACT
GGAATCACACAAGAATAAGTTGACTCAGCTCCTACTCTCCCTGAAGTATTGAAAGAAGTC
GATCGCTTCTTGGAAAAGTACATCAAGGATGGATTACAAAAAGTTTCAGTCTTAAACGAC
TGCGACTCTGATATTCGTAATTTCCTTCGTAAAGAAACCACATTCAAAGGTATTCCAGTC
AAACCTGTTTTTAAAGAATTCATCGATCTTCGTCGTATATTTCCTGTTAAGATATCAGAA
AAACCTACAAACATCGACCACATGCTTTCTTGTGTGGGGTTAACCTTTGAAGGAGTGAAA
CATTGTGGTTTAGATGATGCAACAAATATTGCCAGAGTTGCTTTAGAAATTGCTAAAAGA
GATTACATCTACACTGAACATCTTAAGGAACACATGTATCCCTATGATAACCCTCACTAC
TATGAGCATTTGGTAATCATAGCAACCTAACCTAAAATGAAAAATAACGTAGAAATTGCT
ATGATAGCCCATGATTTAAGAAAGGGAAAGACTCTTTGGAATAATCTAGGAAATAAGAGT
GTCAAGAAATAAGAAATGAAAAAGGAGCTCTTCGAATTCTTAGATAAAGTTGGAATTGAC
ATCAATAACTCTATTTTGTGTGTTCAAGGTAAGCTTGAAAACGAAGTTCGTGCATTCTTC
CAAACTTCTGAAAATCAACCAATGAAGAATGAAGGTAACACTAACTTGTTTATGAGTGGA
AACTTAACAGATAGTACATCTTCTACTTGTTCTTCTTCTTCATCATCACCTTCTTAATAA
TGTTAAAGCACTTCTACAAATTGCCTCACAAGCTCTAACATCTCCTCCATAAACAACTCT
GCATCTTCTAACTAGCAACAGCCCCAATCACCATACTAATCATCTTCATTTAACAATTTC
TTTACTACCTACTTCTCCCTTAACAAAATAAGCAAAATTGCAGGCATACCACTCGCTGGA
AATTAATTCATTTAACACCCTACCTACTCATAAAGATACTAGCGCAACAGAAATGTGTAC
TAGCCTTACCCATTCTAAATGAATGGATAATACTATCCAATTGACTAGTCATTCATGAGT
GGATGCAATAATCCATTTTAAACTTAATTTGCAAAAAACTAATAAAATTTTGCAGATTTA
AATTAAGCAAACAATGAAAACTTGACTAAATGGTGGAATGGTATTAAAGATACTACCTCC
CCTGTTACTAGAATTACTACCATGTGTAACACAGTAGAGACAGCTCTTCAAAATGGTTTT
ATCTTCACCAAGGACTTCGCCTCCACAATCCAATTCAAGAGAGCCTTATCTAAAATGTGA