Identifiers and Description

Gene Model Identifier

TTHERM_00037140

Standard Name

ERI3 (ERI1-exoribonuclease 3)

Aliases

PreTt14449 | 2.m02417 | 3825.m02820

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00037140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00970.19.997093137033517e-262exonuclease (2586 aa)
OxytrichaContig3963.0.g421.999790113608142e-24RNA 2-phosphotransferase, Tpt1
/ KptA family
WormBaseWBGene000013321.9999391735788327e-19locus:eri-1 3-5 exonuclease
eri-1 status:Partially_confi
rmed UniProt:O44406 protei
n_id:CCD73975.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037140(coding)
ATGGAAATACAATATAATGGAGCATCGGCAGCAATGAAGACAAAGCAAGGAAAGAGATCA
AATAGTAATAGCAAAGCGAATAGTTGTAATTAACAAACCCAAAACAATAATTTACATACT
CAAAATATTAGCGCAGAAACAAAAAATGAGTTTTCTAACCATGAAATTCTACTTTTAATT
GATATCAGAATTAATGAATTAAATTAGCTCTCTAACATTTATGCGATGACTTTTGATTAA
ACTGTCAAGAAAGTTATTGAATTTTCCAACATCGAAATCAGTGATGATAATAGATGTGTT
AAATTGGCTTAAGCTGTAGCTCAAATTAATAATATCAGGAAAAAATACTCTTCTTGCTAG
TCCTTTTTCATAGTTTATCCAAAGAAATCCATAGCGAGTGCTCTTTTCAAAATATTTCGC
CAAAATAAAATCTAAGTAAATGAATTAAGTTTCACTAATACATTCATATCCTTAGGATAG
CTAATGCCAAGCTAATTTCTTGCTGATGAAGTGATTCTATTCAACTAGCTTTCATACTTT
TTAGATTTCCAACCTGATGAAGAATTTGCTCAAGAGATTCTTCCAGTTTACTAGACAATA
TAAGAAAGCATTAGCAAAGATTAAGTGAATACTTTGCCTAAATAAATAACAAGAACTTTT
AGCTAATCAATTGATTTGCATGGCCTTTCATCATCAGAGATAAAGCAATAACTGAATGGT
TAATTACCAAATGATAGTAGGAGTTAAATGTTAATCAGCACATGCAATTAGCCAATAATA
AAAGATGAAATAAAGTAAGAGAGAAAGCAAGATGAATTTAATGAACAGTAGAATGAAATT
ATTTTATCTTCTTCTTCTATTACTAATCAGCATTATTAAATGTAACCATAAGCACTTTCA
AAATCTTCTTCCCTTCTCTCTTCGAATCAAAACACTCCTACTCTTTCTTAAAATCTAGCT
GTAAATGTAGATAATACTACACCATCTTCAACTTTGACTGCATTTTTGAGAAAAGGCGAC
TAACAAAGTGAATAATCCTAACAAAATACAAGTAAAAATATATCATCTCTTTTCTCCTTA
AGCAACAACATGCAATTTCAGTCAAATACTACTTAAACTCCCTTTACATCAAGTAGCTCA
TACTAAATGCAACCAGAAAAAACAATATTTTCTTAATTAACAGTCAAAAGGCAAACATCA
TTTTCAGTTGATTCTGGTTCTTTTCTTGGAGGCCAAACCTCCCTATTTTCAAGCATACTA
ACTAACAACCAAACAAAATCAAACTAGCTTACATAAAATAGCTACAATAACAACACTAGC
AATAATTTATTTAAGAGTTCGTTAAATTTATTTAATAGTGTTAACTCCTCACCTTTAGCA
ACCATTTAAGAGTAAAAAGAAAAAACAGAAATGAGTTTAGAAAGAAACTCAAATGAAAAA
AATACATCTACTTAAAGAACAGTACATTAAAAAGATAATGAATAAAACAATAACAACAAC
AACAACAACAATAATAATAATAATGGATGCATCAGTTCTTCATCTTCAATTTGCTCAAAT
TCAACTTACTCTAGTAACAAATTCATGAATGATTAGCAATTAAATAACAAAGGAACAAAA
TTTTCTTCATAGTTTAATTTTTTTATCTTAGTGACTAAATTGGTTAAATAAGGATTTTAA
TTCAAAAAAGATTGCATAATTAGCTTCAGAAATAACTTAACAATCGAAGTTAAACTCAAA
TATGGTTAATAAATATTTGAAATAACTTAAGAAGCTAACAAGAAAACTCCTTTGTCTACA
AATCTTGAATGTGATTAAACTGCTAACATTAAAAATGATAAAATAATAAAAGAAAATAAA
GAATTATCTTAGTAGCAATTAACCTAAGAATTAATAAAAAGCGGATATAATTTACCTAAT
TAAAATCAATAGAATTTATCAAGAAAACAAATACATCTCTAATCTCAATGGGCAAAATAA
AATCTTGGATTGGATAAATTACAACCAACATAGCTAATCATGGCAGATTAGAAGCAAAAA
ATACAAGAAAATCTCATTTAAAGAAGCATGGAAATACAGTAAAAGCTTTCTAAGAACGAA
GAGAATAAAAAACTAGATATGCTATTTGTTATTGACTTTGAATGTAATTAGCCAGGTTAT
GAAATCATAGAATTCCCTGTTCTTGTAATTGATTTAAAAAAAGAACGTATCATAGATACA
TTCCATACTTACGTTAAGCCTACTACTTTTCCTAAGATAAATCCTTATATCTCTAAAATA
ACGGGCATTCAACAAAAAGATGTTGCCAATGCTCCTTCGTTTGTTCAAGTTATTCAAAAG
GTTGAAGCCTTTTTATAAAAATATAAAGACTATGAAGGGTGCATTTTGTATGATTGTGAC
AGTGATTGCAACTATATGAAAAGCGAATTTATCAATAAAAACTACATTCCAACCAGTGAT
GTCTTCTTTTCATATATAAATTTAAGAAATGTTTTCCCTCTGGAAATTAGTGGTGGAGTC
ATCAACAAGTCTCTTTCTCATGCATAACAAGTATTATAAATGGAATTCTAAGGATGCAAA
CATAAAGGAATAGATGATGCTCGTAACTAGGCTTTAGTGTGCATCGAGCTTGTTAAGAGA
GGATACAGTTTCACATAATTTATGATCTAACCTTAATTTTTAAAACAAGATCCTAAATGC
TGTGTGAAAAATAATTTATTTAATTTATATGAATACAACACAAAATTCCTCTTGATTAAA
CTTGATATGGCAGTATAAGAATAAGAAAAAAGTGATACTTAAGTTCCATAAAAAACTTAG
CCTGCATGTATGCCAAATCAACCAAATAAATACTTGAAATTTACTTGCTTTTTAACAGAA
AAAAACCCAGAGTTAAATTAAGTCTATAGAATTAAAGATAGTACTTTCTATTTTGATTTT
ATAACCTGCTAAGCTTCTGGATCAAGATGTGCAAATTTGGCTTTAAGCACTCACCCAAGA
AATTTATATTATAGCTAATTGACTTATTATGGATTTGTAGGGTCTAGTACAAGCTCCAAT
ACTAGCAGCATTTAAAACTTTTAAGCCCCTAGCAATGTTGGTAAACATTAAAATTATGGT
AAATAGGAAAACCAAAAAGGTAACAAATAAATTGATGAACACACTAAACAAGTTGAAAAA
TCTTTTTACCATCACTTTTCAAATTATTTAAAAAAATACAACATCTAAAGAAATTAAACT
GCTTTTGTCTTACTTGGCTTTGATAAAAATGAATTCTCTAACTTTTAGAAAGTGTTCAAT
TTATAACAATATGAAAAAGAGCTTTTCTATAACGAAAAAATTATATATATTGATGACAGT
TTGATTTAGTTTACAGGTTTTTTAGATGTTTATAAGTAAAAAGATCATTATAGCTAAAGA
AAAAATTCAGCATGTTCAACTCCATATAAAAGAAAGAGATCTATGAGTGATGATCTACTT
TCTTCATAGATTAAAGTAAATTTAAATCATCATGTGCAGTTTTAGGATAATATGACAAGT
TAAAACTCTACAACTATTCCATAAAGAAAGAATAGTACCAAATTAACTAACTAATCGCCT
ATGATTAAGCCAGCTAGCACTACTCTTCTAACAGACCACCTCAACTTAAACGGAAAAGAA
GAATACACAATTATACACAAAGGAGATCTATAAATAAATGAGAATGAGAAAAATATTTCT
AAATCTCAAAGAAAAAGAAGTGGAAAGGACTTTGTAAATATTCCAGAACCTAAAACTATT
CAAAATAAAATAGAGAAATAATAATAATAATTATAATAACCTCAATCCTAATTAAATTAA
ATAAATATGTAATAAACTATCACAGAATCTTAGAATGCACCGAACTAACAACAATAAAAC
TAAAATAACCTCTCAAATGCTTAAAATTAGAGCACAACTAGTAGTTTTAGTAAAGACCAG
GTTTGCCAATTAATCAGAAACGATGAATTTAGTATTAATTTTGTGAATTTTATTTTAGTT
AATAGAAAAAAGCTTTAAGAATATTAAGATTTAGCATACCATTGGTAATATATAAATAAC
AAGCCAAAATGA


>TTHERM_00037140(protein)
MEIQYNGASAAMKTKQGKRSNSNSKANSCNQQTQNNNLHTQNISAETKNEFSNHEILLLI
DIRINELNQLSNIYAMTFDQTVKKVIEFSNIEISDDNRCVKLAQAVAQINNIRKKYSSCQ
SFFIVYPKKSIASALFKIFRQNKIQVNELSFTNTFISLGQLMPSQFLADEVILFNQLSYF
LDFQPDEEFAQEILPVYQTIQESISKDQVNTLPKQITRTFSQSIDLHGLSSSEIKQQLNG
QLPNDSRSQMLISTCNQPIIKDEIKQERKQDEFNEQQNEIILSSSSITNQHYQMQPQALS
KSSSLLSSNQNTPTLSQNLAVNVDNTTPSSTLTAFLRKGDQQSEQSQQNTSKNISSLFSL
SNNMQFQSNTTQTPFTSSSSYQMQPEKTIFSQLTVKRQTSFSVDSGSFLGGQTSLFSSIL
TNNQTKSNQLTQNSYNNNTSNNLFKSSLNLFNSVNSSPLATIQEQKEKTEMSLERNSNEK
NTSTQRTVHQKDNEQNNNNNNNNNNNNNGCISSSSSICSNSTYSSNKFMNDQQLNNKGTK
FSSQFNFFILVTKLVKQGFQFKKDCIISFRNNLTIEVKLKYGQQIFEITQEANKKTPLST
NLECDQTANIKNDKIIKENKELSQQQLTQELIKSGYNLPNQNQQNLSRKQIHLQSQWAKQ
NLGLDKLQPTQLIMADQKQKIQENLIQRSMEIQQKLSKNEENKKLDMLFVIDFECNQPGY
EIIEFPVLVIDLKKERIIDTFHTYVKPTTFPKINPYISKITGIQQKDVANAPSFVQVIQK
VEAFLQKYKDYEGCILYDCDSDCNYMKSEFINKNYIPTSDVFFSYINLRNVFPLEISGGV
INKSLSHAQQVLQMEFQGCKHKGIDDARNQALVCIELVKRGYSFTQFMIQPQFLKQDPKC
CVKNNLFNLYEYNTKFLLIKLDMAVQEQEKSDTQVPQKTQPACMPNQPNKYLKFTCFLTE
KNPELNQVYRIKDSTFYFDFITCQASGSRCANLALSTHPRNLYYSQLTYYGFVGSSTSSN
TSSIQNFQAPSNVGKHQNYGKQENQKGNKQIDEHTKQVEKSFYHHFSNYLKKYNIQRNQT
AFVLLGFDKNEFSNFQKVFNLQQYEKELFYNEKIIYIDDSLIQFTGFLDVYKQKDHYSQR
KNSACSTPYKRKRSMSDDLLSSQIKVNLNHHVQFQDNMTSQNSTTIPQRKNSTKLTNQSP
MIKPASTTLLTDHLNLNGKEEYTIIHKGDLQINENEKNISKSQRKRSGKDFVNIPEPKTI
QNKIEKQQQQLQQPQSQLNQINMQQTITESQNAPNQQQQNQNNLSNAQNQSTTSSFSKDQ
VCQLIRNDEFSINFVNFILVNRKKLQEYQDLAYHWQYINNKPK


>TTHERM_00037140(gene)
ATGGAAATACAATATAATGGAGCATCGGCAGCAATGAAGACAAAGCAAGGAAAGAGATCA
AATAGTAATAGCAAAGCGAATAGTTGTAATTAACAAACCCAAAACAATAATTTACATACT
CAAAATATTAGCGCAGAAACAAAAAATGAGTTTTCTAACCATGAAATTCTACTTTTAATT
GATATCAGAATTAATGAATTAAATTAGCTCTCTAACATTTATGCGATGACTTTTGATTAA
ACTGTCAAGAAAGTTATTGAATTTTCCAACATCGAAATCAGTGATGATAATAGATGTGTT
AAATTGGCTTAAGCTGTAGCTCAAATTAATAATATCAGGAAAAAATACTCTTCTTGCTAG
TCCTTTTTCATAGTTTATCCAAAGAAATCCATAGCGAGTGCTCTTTTCAAAATATTTCGC
CAAAATAAAATCTAAGTAAATGAATTAAGTTTCACTAATACATTCATATCCTTAGGATAG
CTAATGCCAAGCTAATTTCTTGCTGATGAAGTGATTCTATTCAACTAGCTTTCATACTTT
TTAGATTTCCAACCTGATGAAGAATTTGCTCAAGAGATTCTTCCAGTTTACTAGACAATA
TAAGAAAGCATTAGCAAAGATTAAGTGAATACTTTGCCTAAATAAATAACAAGAACTTTT
AGCTAATCAATTGATTTGCATGGCCTTTCATCATCAGAGATAAAGCAATAACTGAATGGT
TAATTACCAAATGATAGTAGGAGTTAAATGTTAATCAGCACATGCAATTAGCCAATAATA
AAAGATGAAATAAAGTAAGAGAGAAAGCAAGATGAATTTAATGAACAGTAGAATGAAATT
ATTTTATCTTCTTCTTCTATTACTAATCAGCATTATTAAATGTAACCATAAGCACTTTCA
AAATCTTCTTCCCTTCTCTCTTCGAATCAAAACACTCCTACTCTTTCTTAAAATCTAGCT
GTAAATGTAGATAATACTACACCATCTTCAACTTTGACTGCATTTTTGAGAAAAGGCGAC
TAACAAAGTGAATAATCCTAACAAAATACAAGTAAAAATATATCATCTCTTTTCTCCTTA
AGCAACAACATGCAATTTCAGTCAAATACTACTTAAACTCCCTTTACATCAAGTAGCTCA
TACTAAATGCAACCAGAAAAAACAATATTTTCTTAATTAACAGTCAAAAGGCAAACATCA
TTTTCAGTTGATTCTGGTTCTTTTCTTGGAGGCCAAACCTCCCTATTTTCAAGCATACTA
ACTAACAACCAAACAAAATCAAACTAGCTTACATAAAATAGCTACAATAACAACACTAGC
AATAATTTATTTAAGAGTTCGTTAAATTTATTTAATAGTGTTAACTCCTCACCTTTAGCA
ACCATTTAAGAGTAAAAAGAAAAAACAGAAATGAGTTTAGAAAGAAACTCAAATGAAAAA
AATACATCTACTTAAAGAACAGTACATTAAAAAGATAATGAATAAAACAATAACAACAAC
AACAACAACAATAATAATAATAATGGATGCATCAGTTCTTCATCTTCAATTTGCTCAAAT
TCAACTTACTCTAGTAACAAATTCATGAATGATTAGCAATTAAATAACAAAGGAACAAAA
TTTTCTTCATAGTTTAATTTTTTTATCTTAGTGACTAAATTGGTTAAATAAGGATTTTAA
TTCAAAAAAGATTGCATAATTAGCTTCAGAAATAACTTAACAATCGAAGTTAAACTCAAA
TATGGTTAATAAATATTTGAAATAACTTAAGAAGCTAACAAGAAAACTCCTTTGTCTACA
AATCTTGAATGTGATTAAACTGCTAACATTAAAAATGATAAAATAATAAAAGAAAATAAA
GAATTATCTTAGTAGCAATTAACCTAAGAATTAATAAAAAGCGGATATAATTTACCTAAT
TAAAATCAATAGAATTTATCAAGAAAACAAATACATCTCTAATCTCAATGGGCAAAATAA
AATCTTGGATTGGATAAATTACAACCAACATAGCTAATCATGGCAGATTAGAAGCAAAAA
ATACAAGAAAATCTCATTTAAAGAAGCATGGAAATACAGTAAAAGCTTTCTAAGAACGAA
GAGAATAAAAAACTAGATATGCTATTTGTTATTGACTTTGAATGTAATTAGCCAGGTTAT
GAAATCATAGAATTCCCTGTTCTTGTAATTGATTTAAAAAAAGAACGTATCATAGATACA
TTCCATACTTACGTTAAGCCTACTACTTTTCCTAAGATAAATCCTTATATCTCTAAAATA
ACGGGCATTCAACAAAAAGATGTTGCCAATGCTCCTTCGTTTGTTCAAGTTATTCAAAAG
GTTGAAGCCTTTTTATAAAAATATAAAGACTATGAAGGGTGCATTTTGTATGATTGTGAC
AGTGATTGCAACTATATGAAAAGCGAATTTATCAATAAAAACTACATTCCAACCAGTGAT
GTCTTCTTTTCATATATAAATTTAAGAAATGTTTTCCCTCTGGAAATTAGTGGTGGAGTC
ATCAACAAGTCTCTTTCTCATGCATAACAAGTATTATAAATGGAATTCTAAGGATGCAAA
CATAAAGGAATAGATGATGCTCGTAACTAGGCTTTAGTGTGCATCGAGCTTGTTAAGAGA
GGATACAGTTTCACATAATTTATGATCTAACCTTAATTTTTAAAACAAGATCCTAAATGC
TGTGTGAAAAATAATTTATTTAATTTATATGAATACAACACAAAATTCCTCTTGATTAAA
CTTGATATGGCAGTATAAGAATAAGAAAAAAGTGATACTTAAGTTCCATAAAAAACTTAG
CCTGCATGTATGCCAAATCAACCAAATAAATACTTGAAATTTACTTGCTTTTTAACAGAA
AAAAACCCAGAGTTAAATTAAGTCTATAGAATTAAAGATAGTACTTTCTATTTTGATTTT
ATAACCTGCTAAGCTTCTGGATCAAGATGTGCAAATTTGGCTTTAAGCACTCACCCAAGA
AATTTATATTATAGCTAATTGACTTATTATGGATTTGTAGGGTCTAGTACAAGCTCCAAT
ACTAGCAGCATTTAAAACTTTTAAGCCCCTAGCAATGTTGGTAAACATTAAAATTATGGT
AAATAGGAAAACCAAAAAGGTAACAAATAAATTGATGAACACACTAAACAAGTTGAAAAA
TCTTTTTACCATCACTTTTCAAATTATTTAAAAAAATACAACATCTAAAGAAATTAAACT
GCTTTTGTCTTACTTGGCTTTGATAAAAATGAATTCTCTAACTTTTAGAAAGTGTTCAAT
TTATAACAATATGAAAAAGAGCTTTTCTATAACGAAAAAATTATATATATTGATGACAGT
TTGATTTAGTTTACAGGTTTTTTAGATGTTTATAAGTAAAAAGATCATTATAGCTAAAGA
AAAAATTCAGCATGTTCAACTCCATATAAAAGAAAGAGATCTATGAGTGATGATCTACTT
TCTTCATAGATTAAAGTAAATTTAAATCATCATGTGCAGTTTTAGGATAATATGACAAGT
TAAAACTCTACAACTATTCCATAAAGAAAGAATAGTACCAAATTAACTAACTAATCGCCT
ATGATTAAGCCAGCTAGCACTACTCTTCTAACAGACCACCTCAACTTAAACGGAAAAGAA
GAATACACAATTATACACAAAGGAGATCTATAAATAAATGAGAATGAGAAAAATATTTCT
AAATCTCAAAGAAAAAGAAGTGGAAAGGACTTTGTAAATATTCCAGAACCTAAAACTATT
CAAAATAAAATAGAGAAATAATAATAATAATTATAATAACCTCAATCCTAATTAAATTAA
ATAAATATGTAATAAACTATCACAGAATCTTAGAATGCACCGAACTAACAACAATAAAAC
TAAAATAACCTCTCAAATGCTTAAAATTAGAGCACAACTAGTAGTTTTAGTAAAGACCAG
GTTTGCCAATTAATCAGAAACGATGAATTTAGTATTAATTTTGTGAATTTTATTTTAGTT
AATAGAAAAAAGCTTTAAGAATATTAAGATTTAGCATACCATTGGTAATATATAAATAAC
AAGCCAAAATGA