Identifiers and Description

Gene Model Identifier

TTHERM_00585450

Standard Name

ERI2 (ERI1-exoribonuclease 2)

Aliases

PreTt04151 | 80.m00197 | 3675.m00095

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.4%

TetraMine Data

TTHERM_00585450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15156.12.0004683842646898e-122exonuclease (216 aa)
OxytrichaContig3963.0.g421.9999167998962255e-60RNA 2-phosphotransferase, Tpt1
/ KptA family
WormBaseWBGene000198256.998837695286184e-44status:Confirmed UniProt:Q9T
ZZ9 protein_id:CCD73172.1
DictyBaseDDB_G02831131.000159011384939e-43eriA on chromosome: 4 position
263707 to 264369
Stentor CoeruleusSteCoe_237252.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00585450(coding)
ATGGACTAAAAAAATTAAATTAACAATGATTTTGACTATTTACTGATATTAGATTTCGAA
GCTACTTGCGAAAAAAATGTTAAATTAGAATGTTAAGAAATAATAGAATTTCCTGTTGTT
GTTTTAGATGTTAAAAACTAATAAATATTAGATGTCTTTTTCCATCATTATATAAAGCCT
TCTGTAAATCCTAAACTCACAGCTTTTTGCACAGAATTAACTGGAATCAAACAAGAATAA
GTTGATAATGGAATTTCTTTATAAGAGGCTTTAGCTTAATTAACCTTGTTTTTGGAATAA
AATAAGTTGATAGGATCATCATTCACTTTTATAACTTGCGGAGACTTTGATTTAGGAAAC
TGTTTGAGAAGAGAAGCTCTTTATAAAAAAATAGAAATTCCTTAATACTTAAAAAATTAT
ATAAATATTAAAAAAGTCTTCCCAAAATAATATTATCCTAAACAAAAGAAAGAAGGTGAT
AATAGATTACCTGACATGGTAGGAATGTTGCAAGGATTAAATCTCAAATTAGATGGACAC
CACCATTCAGGAATAGATGATTCAAAAAATATTGCGAAAATCGCTCTCACTTTATTACAA
AAAGGATTTAAATTTAATAAAAATATGAGAGCATTTTCAAATTACTGA


>TTHERM_00585450(protein)
MDQKNQINNDFDYLLILDFEATCEKNVKLECQEIIEFPVVVLDVKNQQILDVFFHHYIKP
SVNPKLTAFCTELTGIKQEQVDNGISLQEALAQLTLFLEQNKLIGSSFTFITCGDFDLGN
CLRREALYKKIEIPQYLKNYINIKKVFPKQYYPKQKKEGDNRLPDMVGMLQGLNLKLDGH
HHSGIDDSKNIAKIALTLLQKGFKFNKNMRAFSNY


>TTHERM_00585450(gene)
ATGGACTAAAAAAATTAAATTAACAATGATTTTGACTATTTACTGATATTAGATTTCGAA
GCTACTTGCGAAAAAAATGTTAAATTAGAATGTTAAGAAATAATAGAATTTCCTGTTGTT
GTTTTAGATGTTAAAAACTAATAAATATTAGATGTCTTTTTCCATCATTATATAAAGCCT
TCTGTAAATCCTAAACTCACAGCTTTTTGCACAGAATTAACTGGAATCAAACAAGAATAA
GTTGATAATGGAATTTCTTTATAAGAGGCTTTAGCTTAATTAACCTTGTTTTTGGAATAA
AATAAGTTGATAGGATCATCATTCACTTTTATAACTTGCGGAGACTTTGATTTAGGAAAC
TGTTTGAGAAGAGAAGCTCTTTATAAAAAAATAGAAATTCCTTAATACTTAAAAAATTAT
ATAAATATTAAAAAAGTCTTCCCAAAATAATATTATCCTAAACAAAAGAAAGAAGGTGAT
AATAGATTACCTGACATGGTAGGAATGTTGCAAGGATTAAATCTCAAATTAGATGGACAC
CACCATTCAGGAATAGATGATTCAAAAAATATTGCGAAAATCGCTCTCACTTTATTACAA
AAAGGATTTAAATTTAATAAAAATATGAGAGCATTTTCAAATTACTGA