Identifiers and Description

Gene Model Identifier

TTHERM_00501020

Standard Name

ERI1 (ERI1-exoribonuclease1)

Aliases

PreTt08046 | 63.m00224 | 3716.m00077

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00501020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09623.11.0000732791548452e-89exonuclease (200 aa)
OxytrichaContig3963.0.g425.999781043483669e-32RNA 2-phosphotransferase, Tpt1
/ KptA family
WormBaseWBGene000197248.99768837233868e-29status:Partially_confirmed U
niProt:Q94285 protein_id:CCD
70202.1
DictyBaseDDB_G02831131.0002869940498747e-21eriA on chromosome: 4 position
263707 to 264369

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00501020(coding)
ATGGACAAGTTAAATTGCATAGATTACTTGGTTATATCTGACTTTGAATGTAATAGTGGA
ATGAAAGGCTTTGTCTTGCATGAAATAATTGAATTTCCAATAGTAATAGTTGATGTTAAG
AATAAAAAGATAATCAAAGAGTTCACAACTTTTGTAAAGCCTACTTATCATCCAAAGTTG
ACTAATTTTATAAAGAATTTGACGTATATTGAATAAAAAGATGTTGATTAAGCTCCAACT
ATTTCAGAAGTATTTGAGATAATCACTTAAGAGATAAAATAAAACACCAATGACAGTGAT
TCTACTTTTTTTATATTTGATTGTGATTCTGATGCAACATACTTGAGAGCCGAAATTAAT
TTAAAAAATCTAAAGCATTCTCCATATTTCAACTAATATTTTAACCTTAAAGAGCTGTTT
GATAGATTCTTCAATGTAAAAGCTAAGTCTTTAGAAAATATGCTTAAAATATTAAATTTA
ACTTAGACAGGACATCCCCATATAGCTTTGCATGATGCTAGAAATATTTGCTAAGTAGTG
ATGTGTATGCTAGAAAAAGGATATATTTTTGATTAAACATAATTAAAGCAAGTAATACTT
TGA


>TTHERM_00501020(protein)
MDKLNCIDYLVISDFECNSGMKGFVLHEIIEFPIVIVDVKNKKIIKEFTTFVKPTYHPKL
TNFIKNLTYIEQKDVDQAPTISEVFEIITQEIKQNTNDSDSTFFIFDCDSDATYLRAEIN
LKNLKHSPYFNQYFNLKELFDRFFNVKAKSLENMLKILNLTQTGHPHIALHDARNICQVV
MCMLEKGYIFDQTQLKQVIL


>TTHERM_00501020(gene)
ATGGACAAGTTAAGTAAACAAAATTATTTGATAATTCATCAATTCAACAATTTTTTTTTT
ATAGATTGCATAGATTACTTGGTTATATCTGACTTTGAATGTAATAGTGGAATGAAAGGC
TTTGTCTTGCATGAAATAATTGAATTTCCAATAGTAATAGTTGATGTTAAGAATAAAAAG
ATAATCAAAGAGTTCACAACTTTTGTAAAGCCTACTTATCATCCAAAGTTGACTAATTTT
ATAAAGAATTTGACGTATATTGAATAAAAAGATGTTGATTAAGCTCCAACTATTTCAGAA
GTATTTGAGATAATCACTTAAGAGATAAAATAAAACACCAATGACAGTGATTCTACTTTT
TTTATATTTGATTGTGATTCTGATGCAACATACTTGAGAGCCGAAATTAATTTAAAAAAT
CTAAAGCATTCTCCATATTTCAACTAATATTTTAACCTTAAAGAGCTGTTTGATAGATTC
TTCAATGTAAAAGCTAAGTCTTTAGAAAATATGCTTAAAATATTAAATTTAACTTAGACA
GGACATCCCCATATAGCTTTGCATGATGCTAGAAATATTTGCTAAGTAGTGATGTGTATG
CTAGAAAAAGGATATATTTTTGATTAAACATAATTAAAGCAAGTAATACTTTGA