Identifiers and Description

Gene Model Identifier

TTHERM_00283550

Standard Name

ERF2 (Eukaryotic Release Factor)

Aliases

PreTt04894 | 25.m00358 | 3694.m00141

Description

eRF1 domain 1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00283550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09000.19.997093137033517e-262eRF1 domain 1 family protein (
488 aa)
SGDYBR143C3.0005221502158484e-68SUP45 Polypeptide release fact
or (eRF1) in translation termi
nation; mutant form acts as a
recessive omnipotent suppresso
r; methylated by Mtq2p-Trm112p
in ternary complex eRF1-eRF3-
GTP; mutation of methylation s
ite confers resistance to zymo
cin
OxytrichaContig21968.0.g129.000460706442912e-62eRF1 domain 2
WormBaseWBGene000202694.998338612125368e-60locus:erfa-1 status:Confirme
d UniProt:S6EZT6 protein_i
d:CDG24149.1
DictyBaseDDB_G02886132.000065869309806e-55erf1 on chromosome: 5 position
1753244 to 1754781
Stentor CoeruleusSteCoe_85167.984904245686979e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00283550(coding)
ATGGAGTAGAAGCCACCGTTTTAAAATCCGCTTTAGAAACTGTAAGATCGAGGGACTAAA
ATGGATTAAAGCAGCGGCTCCTGCATGAGCAAATAAGCTGAGGAGTAGAAGCGATTGTAA
ATTTCTTAATACTAATTAAGAAAACAATTGTAAATGCTCCGAAACATGCGAGGAGAGTAA
ACAAGCTGTGTTTCATTATATATTCCTGAGAGAAAGAAATTATATGAAGTTGTCAATTAT
TTACAGTAAGAAGAAAGTGGTGCAGCCTCTATTAAAAATACCCAAAATCGTAAATCTGTG
CAGAGTGCTTTATCAATGCTCCGTGAACGTTTGAAGAATTTCAACCTTCACAAAAAGTAT
CCTAAAGGTATGATTTTCTTTTGTGCTGATTCTCTAGATTCTAAGCGTCTTTTGATCGAA
ATTCTAGATCCTCCAAAGGCAGTTCAGTCTTTCCGCTATTCTTGCAATACCATATTTTAT
CTAGATGACCTTGAATATATGCTTAAGGACTAACCAACATATGGTTTTGTTGTCGCAGAC
GGACATGGATATCTGATAGCTACAGTCTGCGGCTTTGATATTTAAATCCTCTAAAGTAAA
TAAGAGGATCTTCCTAATAAACATAACAAAGGTGGTTAGTCGTCTTTAAGATTTTCTAGG
CTTTGCGATGCTGCGAGAGAAAGATTAGTTAAGAATATAGCTGACGCTATGAGAAGATGC
TATGCTAATGAGAATGGAACATAAACTAATCTTAGTGGAATAGTGCTTTGTGGAATGAGT
GATATCAAAGATAAAGTGCAAAAAGAGCTTTAGCAGTTATGTCCTTGCATAGAGAACAAA
ATAGTTGCTAGCTATGATGTAAGTTATAGTGGTTAAGCAGGACTAAAGTAGGCTCTTTAA
ATGAGTACCGAGATGTTAAAGTTAGACTAACTCTTTTAAGAGATGAATCTCCTCAGTGAC
TTTTTCGCTAATTTCAGTCTTGAAACAAGCAAAGTTGTTTATGGAGGAGAGCTAACTGTT
CGAGCTTTAGAAGAAGGAAATGTTAAAAAGCTAATTCTCTGCTAGGATTCAGAACTTCAA
AGAGTTACAGTTTATAACTCTAAAACTCAAGAAGAAACTATCTAATACTTAATGCCATCA
CAAGTGAAAGCACTCTAAGACTCTATTTCAAAGACTAGTGACTAAGAAGCCAACAATAAG
AAAAACTAATTACAAGTATACTCACAATAAAACATCAACGAATGGATTGTTGAAAATATT
TCTTCATTTAGTTAAGATTTAGAAATTGTTTTTGTAAGTGATAAGACTTAGTAAGGCGTT
TAGTTTTCTAAAAGCTTTTAAGGAGTTGGTGCTTATCTCAAATACTCTCTTGATTACTCA
TCACTTCATGCTCAAGAAAAAGAGAATGACCAACTTGAACAAGAATATTGCTATGATGAC
GAGGAAGGTTTTATTTGA


>TTHERM_00283550(protein)
MEQKPPFQNPLQKLQDRGTKMDQSSGSCMSKQAEEQKRLQISQYQLRKQLQMLRNMRGEQ
TSCVSLYIPERKKLYEVVNYLQQEESGAASIKNTQNRKSVQSALSMLRERLKNFNLHKKY
PKGMIFFCADSLDSKRLLIEILDPPKAVQSFRYSCNTIFYLDDLEYMLKDQPTYGFVVAD
GHGYLIATVCGFDIQILQSKQEDLPNKHNKGGQSSLRFSRLCDAARERLVKNIADAMRRC
YANENGTQTNLSGIVLCGMSDIKDKVQKELQQLCPCIENKIVASYDVSYSGQAGLKQALQ
MSTEMLKLDQLFQEMNLLSDFFANFSLETSKVVYGGELTVRALEEGNVKKLILCQDSELQ
RVTVYNSKTQEETIQYLMPSQVKALQDSISKTSDQEANNKKNQLQVYSQQNINEWIVENI
SSFSQDLEIVFVSDKTQQGVQFSKSFQGVGAYLKYSLDYSSLHAQEKENDQLEQEYCYDD
EEGFI


>TTHERM_00283550(gene)
ATAAATTAAATAAATAAATAAATCATTAAATAAAAACTAAGTAGAAGGAAACTTTTACCT
AAAAATACAAAATTCAAAATACCGAAAGGTCGAAATCTTAAGGATCAACAAATAATATTT
GAATATTCTCTTAGAATTTTCAGCAAGGAAATGGAGTAGAAGCCACCGTTTTAAAATCCG
CTTTAGAAACTGTAAGATCGAGGGACTAAAATGGATTAAAGCAGCGGCTCCTGCATGAGC
AAATAAGCTGAGGAGTAGAAGCGATTGTAAATTTCTTAATACTAATTAAGAAAACAATTG
TAAATGCTCCGAAACATGCGAGGAGAGTAAACAAGCTGTGTTTCATTATATATTCCTGAG
AGAAAGAAATTATATGAAGTTGTCAATTATTTACAGTAAGAAGAAAGTGGTGCAGCCTCT
ATTAAAAATACCCAAAATCGTAAATCTGTGCAGAGTGCTTTATCAATGCTCCGTGAACGT
TTGAAGAATTTCAACCTTCACAAAAAGTATCCTAAAGGTATGATTTTCTTTTGTGCTGAT
TCTCTAGATTCTAAGCGTCTTTTGATCGAAATTCTAGATCCTCCAAAGGCAGTTCAGTCT
TTCCGCTATTCTTGCAATACCATATTTTATCTAGATGACCTTGAATATATGCTTAAGGAC
TAACCAACATATGGTTTTGTTGTCGCAGACGGACATGGATATCTGATAGCTACAGTCTGC
GGCTTTGATATTTAAATCCTCTAAAGTAAATAAGAGGATCTTCCTAATAAACATAACAAA
GGTGGTTAGTCGTCTTTAAGATTTTCTAGGCTTTGCGATGCTGCGAGAGAAAGATTAGTT
AAGAATATAGCTGACGCTATGAGAAGATGCTATGCTAATGAGAATGGAACATAAACTAAT
CTTAGTGGAATAGTGCTTTGTGGAATGAGTGATATCAAAGATAAAGTGCAAAAAGAGCTT
TAGCAGTTATGTCCTTGCATAGAGAACAAAATAGTTGCTAGCTATGATGTAAGTTATAGT
GGTTAAGCAGGACTAAAGTAGGCTCTTTAAATGAGTACCGAGATGTTAAAGTTAGACTAA
CTCTTTTAAGAGATGAATCTCCTCAGTGACTTTTTCGCTAATTTCAGTCTTGAAACAAGC
AAAGTTGTTTATGGAGGAGAGCTAACTGTTCGAGCTTTAGAAGAAGGAAATGTTAAAAAG
CTAATTCTCTGCTAGGATTCAGAACTTCAAAGAGTTACAGTTTATAACTCTAAAACTCAA
GAAGAAACTATCTAATACTTAATGCCATCACAAGTGAAAGCACTCTAAGACTCTATTTCA
AAGACTAGTGACTAAGAAGCCAACAATAAGAAAAACTAATTACAAGTATACTCACAATAA
AACATCAACGAATGGATTGTTGAAAATATTTCTTCATTTAGTTAAGATTTAGAAATTGTT
TTTGTAAGTGATAAGACTTAGTAAGGCGTTTAGTTTTCTAAAAGCTTTTAAGGAGTTGGT
GCTTATCTCAAATACTCTCTTGATTACTCATCACTTCATGCTCAAGAAAAAGAGAATGAC
CAACTTGAACAAGAATATTGCTATGATGACGAGGAAGGTTTTATTTGA