Identifiers and Description

Gene Model Identifier

TTHERM_00292170

Standard Name

ERF1 (Eukaryotic Release Factor )

Aliases

PreTt26050 | 26.m00402 | 3688.m00193

Description

Eukaryotic release factor 1; believed to recognize the stop codon of mRNA and terminate translation; gene has 4 introns; deduced protein sequence 57% similar to human eRF1; domain 1 proposed to be the codon recognition site

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00292170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09405.19.997093137033517e-262eukaryotic peptide chain relea
se factor subunit 1 (436 aa)
SGDYBR143C7.000463540624081e-176SUP45 Polypeptide release fact
or (eRF1) in translation termi
nation; mutant form acts as a
recessive omnipotent suppresso
r; methylated by Mtq2p-Trm112p
in ternary complex eRF1-eRF3-
GTP; mutation of methylation s
ite confers resistance to zymo
cin
WormBaseWBGene000202692.998539800509618e-166locus:erfa-1 status:Confirme
d UniProt:S6EZT6 protein_i
d:CDG24149.1
OxytrichaContig21968.0.g121.0001999920370885e-161eRF1 domain 2
DictyBaseDDB_G02886132.0004037638327014e-151erf1 on chromosome: 5 position
1753244 to 1754781
Stentor CoeruleusSteCoe_85165.96629836401057e-72

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16382136: Salas-Marco J, Fan-Minogue H, Kallmeyer AK, Klobutcher LA, Farabaugh PJ, Bedwell DM (2006) Distinct paths to stop codon reassignment by the variant-code organisms Tetrahymena and Euplotes. Molecular and cellular biology 26(2):438-47
  2. Ref:11788716: Inagaki Y, et al. (2002) Convergence and constraint in eukaryotic release factor 1 (eRF1) domain 1: the evolution of stop codon specificity. Nucleic Acids Res 30(2):532-44
  3. Ref:12084909: Ito K, Frolova L, Seit-Nebi A, Karamyshev A, Kisselev L, Nakamura Y (2002) Omnipotent decoding potential resides in eukaryotic translation termination factor eRF1 of variant-code organisms and is modulated by the interactions of amino acid sequences within domain 1. Proceedings of the National Academy of Sciences of the United States of America 99(13):8494-9
  4. Ref:11163755: Muramatsu T, Heckmann K, Kitanaka C, Kuchino Y (2001) Molecular mechanism of stop codon recognition by eRF1: a wobble hypothesis for peptide anticodons. FEBS letters 488(3):105-9
  5. Ref:11762076: Muramatsu T (2001) [Molecular mechanism of stop codon recognition by eRF1: a wobble hypothesis for peptide anticodons]. Tanpakushitsu kakusan koso. Protein, nucleic acid, enzyme 46(15):2163-70
  6. Ref:11231122: Lozupone CA, Knight RD, Landweber LF (2001) The molecular basis of nuclear genetic code change in ciliates. Current biology : CB 11(2):65-74
  7. Ref:11179680: Liang A, Brünen-Nieweler C, Muramatsu T, Kuchino Y, Beier H, Heckmann K (2001) The ciliate Euplotes octocarinatus expresses two polypeptide release factors of the type eRF1. Gene 262(1-2):161-8
  8. Ref:11160924: Inagaki Y, Doolittle WF (2001) Class I release factors in ciliates with variant genetic codes. Nucleic acids research 29(4):921-7
  9. Ref:10648963: Karamyshev AL, Karamysheva ZN, Ito K, Matsufuji S, Nakamura Y (1999) Overexpression and purification of recombinant eRF1 proteins of rabbit and Tetrahymena thermophila. Biochemistry. Biokhimiia 64(12):1391-400
  10. Ref:10471834: Karamyshev AL, Ito K, Nakamura Y (1999) Polypeptide release factor eRF1 from Tetrahymena thermophila: cDNA cloning, purification and complex formation with yeast eRF3. FEBS letters 457(3):483-8
  11. Ref:1160924: Urbanek R, et al. (1975) [Hypophosphataemia as early sign of septicaemia in childhood (author's transl)] Monatsschr Kinderheilkd 123(8):593-7

Sequences

>TTHERM_00292170(coding)
ATGGAAGAGAAAGATCAACGTTAAAGAAATATTGAACATTTTAAGATCAAGAAATTGATG
ACAAGACTTAGAAACACTAGAGGTTCTGGTACTTCTATGGTTTCTTTGATTATTCCTCCT
AAGAAGTAAATTAACGATTCCACAAAGTTAATCAGTGATGAATTCAGTAAGGCCACTAAT
ATTAAAGACAGAGTCAACCGTTAATCTGTACAAGATGCAATGGTTTCCGCCTTACAAAGA
TTAAAATTATATCAAAGAACTCCCAATAATGGTTTGATTCTTTATTGCGGTAAGGTTCTT
AACGAAGAAGGAAAAGAAATTAAGCTTTTGATCGATTTCGAACCCTACAAGCCCATCAAC
ACCTCTCTTTATTTCTGTGACAGTAAGTTCCACGTTGATGAATTGGGTTCACTTCTTGAA
ACCGACCCTCCTTTTGGTTTCATCGTTATGGATGGTCAAGGTGCTCTCTATGCCAATCTC
CAAGGAAATACAAAGACAGTTTTAAATAAATTCTCAGTCGAATTGCCCAAGAAGCACGGT
AGAGGTGGTCAATCATCAGTTCGTTTTGCACGTCTTAGAGTTGAAAAGAGACACAACTAT
CTTAGAAAGGTTTGTGAAGTCGCCACTTAAACTTTCATTTCCCAAGATAAAATTAATGTT
TAAGGTTTAGTCTTAGCTGGTTCTGGTGATTTCAAGAATGAATTGAGTACTACATAGATG
TTCGACCCTCGTCTTGCTTGCAAGATTATCAAGATTGTTGATGTTTCTTATGGTGGTGAA
AATGGTCTTAACCAAGCTATTGAACTCGCTTAAGAATCTTTAACTAACGTCAAGTTCGTT
TAAGAAAAGAACGTTATCTCCAAATTCTTCGATTGCATCGCTATTGACTCCGGTACCGTT
GTCTATGGTGTTCAAGATACTATGTAACTCTTATTAGATGGTGTTATTGAAAACATTCTT
TGTTTCGAAGAACTCACTACCTTGAGAGTCACTCGTAAAAATAAAGTCACAGAATAAATC
ACTCATATATTCATTCCTCCTAATGAATTAAATAATCCTAAGCATTTCAAGGATGGTGAA
CATGAACTTGAAAAGATTGAAGTTGAAAACTTAACTGAATGGTTAGCTGAACACTACAGT
GAATTCGGTGCTGAACTTTACTTTATTACTGATAAATCTGCTGAAGGTTGCCAATTTGTC
AAAGGTTTCTCTGGTATTGGTGGTTTCTTAAGATATAAGGTCGATTTAGAACATATTGTT
AACCCTAATGACGAATACAACTACGAAGAAGAAGAAGGCTTCATATGA


>TTHERM_00292170(protein)
MEEKDQRQRNIEHFKIKKLMTRLRNTRGSGTSMVSLIIPPKKQINDSTKLISDEFSKATN
IKDRVNRQSVQDAMVSALQRLKLYQRTPNNGLILYCGKVLNEEGKEIKLLIDFEPYKPIN
TSLYFCDSKFHVDELGSLLETDPPFGFIVMDGQGALYANLQGNTKTVLNKFSVELPKKHG
RGGQSSVRFARLRVEKRHNYLRKVCEVATQTFISQDKINVQGLVLAGSGDFKNELSTTQM
FDPRLACKIIKIVDVSYGGENGLNQAIELAQESLTNVKFVQEKNVISKFFDCIAIDSGTV
VYGVQDTMQLLLDGVIENILCFEELTTLRVTRKNKVTEQITHIFIPPNELNNPKHFKDGE
HELEKIEVENLTEWLAEHYSEFGAELYFITDKSAEGCQFVKGFSGIGGFLRYKVDLEHIV
NPNDEYNYEEEEGFI


>TTHERM_00292170(gene)
ATGGAAGAGAAAGATCAACGTTAAAGAAATATTGAACATTTTAAGATCAAGAAATTGATG
ACAAGACTTAGAAACACTAGAGGGTAATCAATCTATTTAATATAAAAAATTATTTTCTCT
CTTTTCACTAACTTTCCATTTGCACCCACTGATTCAATATGTTATTTTTGTTTTGCTTGA
ATAATAATAAAACTATATATAGCCTAGTTATCATTCATTTAATTTTAATATCTTATGGAA
TTGCAATTCTATATTTTGCTTAAGGATAAATACCTTAAAAATATGTGACATCAGTGGAGA
TTTTGCATAATTTGGAAGATTTAGGGATTGAAATTTTAGAAAATTTTAAGTAAATAACCT
TTATAACTTTTAAAAACATAGTTCTGGTACTTCTATGGTTTCTTTGATTATTCCTCCTAA
GAAGTAAATTAACGATTCCACAAAGTTAATCAGTGATGAATTCAGTAAGGCCACTAATAT
TAAAGACAGAGTCAACCGTTAATCTGTACAAGATGCAATGGTTTCCGCCTTACAAAGTAA
AATTATTATATTATTGGTTAAATATGTATATATGCTTGGCATTTCTTCAAACAACATCCA
CAAAAACTATTGAATGATGAAGATATTTTAAGCAAAATTTAAAAAATGAAAATAAATTTG
CTGACTGGTCTTAAATGTTTAATTTATAAAACAAAGGATTAAAATTATATCAAAGAACTC
CCAATAATGGTTTGATTCTTTATTGCGGTAAGGTTCTTAACGAAGAAGGAAAAGAAATTA
AGCTTTTGATCGATTTCGAACCCTACAAGCCCATCAACACCTCTCTTTATTTCTGTGACA
GTAAGTTCCACGTTGATGAATTGGGTTCACTTCTTGAAACCGACCCTCCTTTTGGTTTCA
TCGTTATGGATGGTCAAGGTGCTCTCTATGCCAATCTCCAAGGAAATACAAAGACAGTAA
GCTATATAAAATAAATTAACTATCAAAATTTTTTATTAGATGCATGCAAAACAAATAAAC
AAGGAAAGATTTAATAAGGGTCAATTAAAAATACGCTTAAAATTATTAAAAAATATTAAC
GAAAGTCATATTTTTTAGGGATTAATTAACAAATAAATATTTTGGCTTTTAAGAAAATCT
TATTATATACTTTCTTTAATTAATAAGCATTTAATCCTATTTTCAATCAAAGCATATTCT
CAAAAAAAAAAAATACAAGCAAGCAAGCAAATATCTCTTTGAATATTTTTAAATAAAATC
AAATTGAGTAAATATATTTCTTCTATGTAGCAGAGTTTACTAAATTAGTAATATTACTAC
CAGTTTTTTAGTAAAAAATAAAACGAACTATCTTTCAAATGAATATATAAAAAAACATTA
TTCTTTTTAACATATAATCATTTCTCATTAATTAAAAAAGGTTTTAAATAAATTCTCAGT
CGAATTGCCCAAGAAGCACGGTAGAGGTGGTCAATCATCAGTTCGTTTTGCACGTCTTAG
AGTTGAAAAGAGACACAACTATCTTAGAAAGGTTTGTGAAGTCGCCACTTAAACTTTCAT
TTCCCAAGATAAAATTAATGTTTAAGGTTTAGTCTTAGCTGGTTCTGGTGATTTCAAGAA
TGAATTGAGTACTACATAGATGTTCGACCCTCGTCTTGCTTGCAAGATTATCAAGATTGT
TGATGTTTCTTATGGTGGTGAAAATGGTCTTAACCAAGCTATTGAACTCGCTTAAGAATC
TTTAACTAACGTCAAGTTCGTTTAAGAAAAGAACGTTATCTCCAAATTCTTCGATTGCAT
CGCTATTGACTCCGGTACCGTTGTCTATGGTGTTCAAGATACTATGTAACTCTTATTAGA
TGGTGTTATTGAAAACATTCTTTGTTTCGAAGAACTCACTACCTTGAGAGTCACTCGTAA
AAATAAAGTCACAGAATGTAATTATTTAGCATTTATTTCAATTTTCAGATTAGGTATTTG
AACTCAAAAAGCAAGCAATCAAGCAAAAAAGCAAACAAACAAACAAACAAAAAATAAATT
AAATAGCAAGAAAGAAAGAAAGAAAGAAATAAATAAATAAGGCTTTAATAGATGATACCA
ATAGAATCTAATAATAAAATCTTTTTCTACAAATAAATTTAATTAATTAAATGATTAAAA
ATATCTTTTATAAAATTAGAAATCACTCATATATTCATTCCTCCTAATGAATTAAATAAT
CCTAAGCATTTCAAGGATGGTGAACATGAACTTGAAAAGATTGAAGTTGAAAACTTAACT
GAATGGTTAGCTGAACACTACAGTGAATTCGGTGCTGAACTTTACTTTATTACTGATAAA
TCTGCTGAAGGTTGCCAATTTGTCAAAGGTTTCTCTGGTATTGGTGGTTTCTTAAGATAT
AAGGTCGATTTAGAACATATTGTTAACCCTAATGACGAATACAACTACGAAGAAGAAGAA
GGCTTCATATGA