Identifiers and Description

Gene Model Identifier

TTHERM_01227760

Standard Name

EPN1 (EpiPlasmiN 1)

Aliases

PreTt14831 | 282.m00029

Description

Epiplasmin protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_01227760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07294.11.0004883026569571e-88hypothetical protein (171 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000139

Sequences

>TTHERM_01227760(coding)
ATGGCCAAATACGTTCCCCCTATTTCCTAATCAAATGTTCAAGTTGTTCCATAGGTATAA
CCTGTGATCTATCAATCAGTTGTACCCGTTTAAGTTTAGCCCCTTTACTAATCCTACGTC
AGTTATCCTACTTACTCCTACGTTAAGCAATAGCCATAAGTCTAAACCGCTCAAATTCCT
GCTTAATAGTAACAATATTAATCAGTTGGATCTACTTAACCTTCCGTCGCTTATCAAGCA
GCTGAAAGCTAAATAAAGGCTCCTCTTAGAGGTTCTTCCAGAATTGAATATATTCCTTAT
TAAAGAAAGGTCATTGACTATGAATAATAGGTATAAACTCAAATTGTTCCTAAGGAAAGA
TATGTAACTGATTATTATGCTGTTGAACATACTACTAACTACGTTCCTTAAACTTACTAC
GACTCTTACGTTGATTACGTTCCTGTAACAAGATACAAAGAAAGAACTGAATATTATCCA
GTTGAAAGTAGCAGAACTGTCATTAACCGTCTTTGA


>TTHERM_01227760(protein)
MAKYVPPISQSNVQVVPQVQPVIYQSVVPVQVQPLYQSYVSYPTYSYVKQQPQVQTAQIP
AQQQQYQSVGSTQPSVAYQAAESQIKAPLRGSSRIEYIPYQRKVIDYEQQVQTQIVPKER
YVTDYYAVEHTTNYVPQTYYDSYVDYVPVTRYKERTEYYPVESSRTVINRL


>TTHERM_01227760(gene)
ATGGCCAAATACGTTCCCCCTATTTCCTAATCAAATGTTCAAGTTGTTCCATAGGTATAA
CCTGTGATCTATCAATCAGTTGTACCCGTTTAAGTTTAGCCCCTTTACTAATCCTACGTC
AGTTATCCTACTTACTCCTACGTTAAGCAATAGCCATAAGTCTAAACCGCTCAAATTCCT
GCTGTAATTAAAAATATTTTTTTGAATTTCAATTTCTAATATAAAAATAAATGGAAATTA
ATGATATTATTTAACTAATTATGCAGTAATAGTAACAATATTAATCAGTTGGATCTACTT
AACCTTCCGTCGCTTATCAAGCAGCTGAAAGCTAAATAAAGGCTCCTCTTAGAGGTTCTT
CCAGAATTGAATATATTCCTTATTAAAGAAAGGTCATTGACTATGAATAATAGGTATAAA
CTCAAATTGTTCCTAAGGAAAGATATGGTAATTATACTTTTTATTGCTAACTTAGATATT
TTCATGCATTTTTCTACTCTTTCACATGGCTTAATGTGCTTAAAAAAAAGAATCATGCAA
AAGTTTATCAAAAGCAACATTTTATGGAAATTAAATAAGATGAACAAAAATATATTTTAA
AAGTAGGAAACTACTAACAATCCAATTACTATGGAAAACATCTGTTAATATTCTACAAAT
AAATATTATATTTTTTTCATTTGTGTTTAAATTATTGAAAAAATTTCAACCCATTTGCTA
TTTAATAGCTAATATTTATTAAAATTAATTAGTAACTGATTATTATGCTGTTGAACATAC
TACTAACTACGTTCCTTAAACTTACTACGACTCTTACGTTGATTACGTTCCTGTAACAAG
ATACAAAGAAAGAACTGAGTAATTTAATATTATTTTTTTGCATAATTAAATAAATTTATA
TTAATAAATATAGATATTATCCAGTTGAAAGTAGCAGAACTGTCATTAACCGTCTTTGA