Identifiers and Description

Gene Model Identifier

TTHERM_01227760

Standard Name

EPN1 (Epiplasmin 1)

Aliases

PreTt14831 | 282.m00029

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01227760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07294.11.0004883026569571e-88hypothetical protein (171 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000139

Sequences

>TTHERM_01227760(coding)
ATGGCCAAATACGTTCCCCCTATTTCCTAATCAAATGTTCAAGTTGTTCCATAGGTATAA
CCTGTGATCTATCAATCAGTTGTACCCGTTTAAGTTTAGCCCCTTTACTAATCCTACGTC
AGTTATCCTACTTACTCCTACGTTAAGCAATAGCCATAAGTCTAAACCGCTCAAATTCCT
GCTTAATAGTAACAATATTAATCAGTTGGATCTACTTAACCTTCCGTCGCTTATCAAGCA
GCTGAAAGCTAAATAAAGGCTCCTCTTAGAGGTTCTTCCAGAATTGAATATATTCCTTAT
TAAAGAAAGGTCATTGACTATGAATAATAGGTATAAACTCAAATTGTTCCTAAGGAAAGA
TATGTAACTGATTATTATGCTGTTGAACATACTACTAACTACGTTCCTTAAACTTACTAC
GACTCTTACGTTGATTACGTTCCTGTAACAAGATACAAAGAAAGAACTGAATATTATCCA
GTTGAAAGTAGCAGAACTGTCATTAACCGTCTTTGA


>TTHERM_01227760(protein)
MAKYVPPISQSNVQVVPQVQPVIYQSVVPVQVQPLYQSYVSYPTYSYVKQQPQVQTAQIP
AQQQQYQSVGSTQPSVAYQAAESQIKAPLRGSSRIEYIPYQRKVIDYEQQVQTQIVPKER
YVTDYYAVEHTTNYVPQTYYDSYVDYVPVTRYKERTEYYPVESSRTVINRL


>TTHERM_01227760(gene)
ATGGCCAAATACGTTCCCCCTATTTCCTAATCAAATGTTCAAGTTGTTCCATAGGTATAA
CCTGTGATCTATCAATCAGTTGTACCCGTTTAAGTTTAGCCCCTTTACTAATCCTACGTC
AGTTATCCTACTTACTCCTACGTTAAGCAATAGCCATAAGTCTAAACCGCTCAAATTCCT
GCTGTAATTAAAAATATTTTTTTGAATTTCAATTTCTAATATAAAAATAAATGGAAATTA
ATGATATTATTTAACTAATTATGCAGTAATAGTAACAATATTAATCAGTTGGATCTACTT
AACCTTCCGTCGCTTATCAAGCAGCTGAAAGCTAAATAAAGGCTCCTCTTAGAGGTTCTT
CCAGAATTGAATATATTCCTTATTAAAGAAAGGTCATTGACTATGAATAATAGGTATAAA
CTCAAATTGTTCCTAAGGAAAGATATGGTAATTATACTTTTTATTGCTAACTTAGATATT
TTCATGCATTTTTCTACTCTTTCACATGGCTTAATGTGCTTAAAAAAAAGAATCATGCAA
AAGTTTATCAAAAGCAACATTTTATGGAAATTAAATAAGATGAACAAAAATATATTTTAA
AAGTAGGAAACTACTAACAATCCAATTACTATGGAAAACATCTGTTAATATTCTACAAAT
AAATATTATATTTTTTTCATTTGTGTTTAAATTATTGAAAAAATTTCAACCCATTTGCTA
TTTAATAGCTAATATTTATTAAAATTAATTAGTAACTGATTATTATGCTGTTGAACATAC
TACTAACTACGTTCCTTAAACTTACTACGACTCTTACGTTGATTACGTTCCTGTAACAAG
ATACAAAGAAAGAACTGAGTAATTTAATATTATTTTTTTGCATAATTAAATAAATTTATA
TTAATAAATATAGATATTATCCAGTTGAAAGTAGCAGAACTGTCATTAACCGTCTTTGA