Identifiers and Description

Gene Model Identifier

TTHERM_00584700

Standard Name

EPK2 (Epiplasm Protein Kinase 2)

Aliases

PreTt04078 | 80.m00124 | 3675.m00022

Description

Protein kinase domain; protein kinase family unique to Tetrahymena

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00584700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15234.11.9994920269952867e-34hypothetical protein (1709 aa)
OxytrichaContig1214.1.g960.0000000000000030004923591262316Ring finger domain
WormBaseWBGene000121940.00000000002000577768187062locus:toe-4 status:Partially
_confirmed UniProt:Q9XUM8
protein_id:CAB04890.1
DictyBaseDDB_G02681620.0000008998839737394744DDB_G0268162 on chromosome: 1
position 1580521 to 1581951
SGDYLR247C0.00003998524687536623IRC20 Putative helicase; local
izes to the mitochondrion and
the nucleus; YLR247C is not an
essential gene; null mutant d
isplays increased levels of sp
ontaneous Rad52p foci

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00584700(coding)
ATGTTGAATCAAAATATAAACCTTGCTTAGTCCATTTCAAAGGAATAAATATCATAATAG
AATCAAGCATAAAAAAATTCTAAGATACCACTAATAATAAGAATAGCTAACAGTAGTAAT
AATTCAACTCCAGTTAAGCTAGGTTCCTTCTAGGATTTAAGTAATAATGAAGTTATTAAT
CTTTGTGAATAAGAAAATATAAAATAAGAAATCAATGATTTTAAGCCAAAAAAATAAATA
GATTGCATTGTCTTATAAAATGAATTAAATTATTTTGAAGATGAAAAAGAAGAATTTAAA
AATGACAAAAAACTACCTCAAAAACCTTAAAGAACAAGTTATATAAGCTAATAACATAAA
ACAATAGCTCAAGAATAGTATTATAATCCTATTATTCTAGCTGATAATACTAAACACAGA
GAAAGGTAGATATAAAATTAAAGAAATTAGTAAAGAAATAACTCATTAGAGAATAAATTC
ATAGAAAAATCCAATAATTAGCTAATATCAAATCGTAATCATATTAGATAGTAAAATTGT
AACAATGCTTCTTTTAATCTTATTAAAATTGACTCTTCCTAATAACTAGATATAGAAAAT
ATATAAAATTCTTCAAGTGATAGCTGTCCTGAAGTTTATTAAAAGAATAAACTAACTAAC
ATAAATTAACAATTAGATTTCAAATAAAAAAAAGATTTATTATAAATTTCAAATTTAAAT
ACTATATAAAAAGAATAATCTATAGTTTAAAGCTAGAATTTAAATAGAAATATAAAGATA
AAAAACTAGACTCCTTTACTTCCACCTATTCACCCTTAAAAATTAAAACAAGCACATTAA
TAAACTAATCATGATTTAAATAAAAATGAAATAAAAACAGATTTTATCCGTAAAAGCAGA
AGCAACTCTTTTACTGAAGAAAAAAATATTTTTAAAATGAACCTTGATAAAAGTTAAAGA
GTTTCTTCTAGTGAATTTAAGAATCTTCTTAATAATGTTAACTTTTAGTAAATACAAAAA
AATCTATCTAGAAACTAAAAATCTAAAACACAAACTAGTGAGTAAAATTATAATGTAATA
GATGATAACTCAACAAATGGAGTAATTAAAAAATATCACTAAAAACACTAAAATGATATA
AATTAATGTGCTTTTGATAGAGCTTAATACAATTAAAATATCAGATAAGAATAATAAAAT
AGTTTATTTATTTAAAGATACTAAATACCTTTAATAATTTCATAGCCTGAATTAGAATTT
ATCTAAGAAAGATCGAATAATATTAAAAATTACCCTAATCAAGTAAGATAGTAAGTTAAT
TCTCAAGAATAACCCATTAATAATGGAAACATGCAATAAAATTTAGAAAATATAAGAGAA
ATTAATGAAAGGTAAAAGTCCAAAGATGTTATAAGATTATAAAATCAAAATGTTAGAACT
TAATAACAATAACAGCAACGTAATAATAACAATAATGAATAGACATATAACGATATTATT
CAAAGAAGAAACTAAATAAATGCTTAGTAAGAAAATCTGAATGATTAATTTTAAAGTAGG
TAAAACACAATTAATTAAAATCCACCCCCAAGATTCATGATTGATAACATGTATAATTAG
TTTATAGAGTTTTAAAATCAGCTTAGATAGCATTAAGGAATTAAATCAGATAAATATGTA
AGCACAACTGTATATAAAAGTTCATAGTCTTAGAATCTTTCTTAAGATGCTAAATAGTGC
TCAATTTGTCTGTGCGAATTTGAGGATGAAGAGAAAATAAGTTTTTTGGCTTGCTTTCAT
CGTTTTCATAATGAATGCATTCACAAATGGTTTGAAACAAAATCAACTTGTCCTCTATGC
AAAAAAGATTAAAAAACATTAATAAAAGATGTTAATAAACTATTAGATGAATTTTGA


>TTHERM_00584700(protein)
MLNQNINLAQSISKEQISQQNQAQKNSKIPLIIRIANSSNNSTPVKLGSFQDLSNNEVIN
LCEQENIKQEINDFKPKKQIDCIVLQNELNYFEDEKEEFKNDKKLPQKPQRTSYISQQHK
TIAQEQYYNPIILADNTKHRERQIQNQRNQQRNNSLENKFIEKSNNQLISNRNHIRQQNC
NNASFNLIKIDSSQQLDIENIQNSSSDSCPEVYQKNKLTNINQQLDFKQKKDLLQISNLN
TIQKEQSIVQSQNLNRNIKIKNQTPLLPPIHPQKLKQAHQQTNHDLNKNEIKTDFIRKSR
SNSFTEEKNIFKMNLDKSQRVSSSEFKNLLNNVNFQQIQKNLSRNQKSKTQTSEQNYNVI
DDNSTNGVIKKYHQKHQNDINQCAFDRAQYNQNIRQEQQNSLFIQRYQIPLIISQPELEF
IQERSNNIKNYPNQVRQQVNSQEQPINNGNMQQNLENIREINERQKSKDVIRLQNQNVRT
QQQQQQRNNNNNEQTYNDIIQRRNQINAQQENLNDQFQSRQNTINQNPPPRFMIDNMYNQ
FIEFQNQLRQHQGIKSDKYVSTTVYKSSQSQNLSQDAKQCSICLCEFEDEEKISFLACFH
RFHNECIHKWFETKSTCPLCKKDQKTLIKDVNKLLDEF


>TTHERM_00584700(gene)
TTTACAGATAACAATCAAGGCTAAACAAAAACTAGAATATAAATTAATATTAATCTATCT
TTAAAGCTTAGCTGTATTTACAAATATCTTTATAATCAAATGTTGAATCAAAATATAAAC
CTTGCTTAGTCCATTTCAAAGGAATAAATATCATGTAAATGACATTCTATTTTTGTTTTT
CATAAATAACTTTTTAAAAATCTTATAAAAACTAGAATAGAATCAAGCATAAAAAAATTC
TAAGATACCACTAATAATAAGAATAGCTAACAGTAGTAATAATTCAACTCCAGTTAAGCT
AGGTTCCTTCTAGGATTTAAGTAATAATGAAGTTATTAATCTTTGTGAATAAGAAAATAT
AAAATAAGAAATCAATGATTTTAAGCCAAAAAAATAAATAGATTGCATTGTCTTATAAAA
TGAATTAAATTATTTTGAAGATGAAAAAGAAGAATTTAAAAATGACAAAAAACTACCTCA
AAAACCTTAAAGAACAAGTTATATAAGCTAATAACATAAAACAATAGCTCAAGAATAGTA
TTATAATCCTATTATTCTAGCTGATAATACTAAACACAGAGAAAGGTAGATATAAAATTA
AAGAAATTAGTAAAGAAATAACTCATTAGAGAATAAATTCATAGAAAAATCCAATAATTA
GCTAATATCAAATCGTAATCATATTAGATAGTAAAATTGTAACAATGCTTCTTTTAATCT
TATTAAAATTGACTCTTCCTAATAACTAGATATAGAAAATATATAAAATTCTTCAAGTGA
TAGCTGTCCTGAAGTTTATTAAAAGAATAAACTAACTAACATAAATTAACAATTAGATTT
CAAATAAAAAAAAGATTTATTATAAATTTCAAATTTAAATACTATATAAAAAGAATAATC
TATAGTTTAAAGCTAGAATTTAAATAGAAATATAAAGATAAAAAACTAGACTCCTTTACT
TCCACCTATTCACCCTTAAAAATTAAAACAAGCACATTAATAAACTAATCATGATTTAAA
TAAAAATGAAATAAAAACAGATTTTATCCGTAAAAGCAGAAGCAACTCTTTTACTGAAGA
AAAAAATATTTTTAAAATGAACCTTGATAAAAGTTAAAGAGTTTCTTCTAGTGAATTTAA
GAATCTTCTTAATAATGTTAACTTTTAGTAAATACAAAAAAATCTATCTAGAAACTAAAA
ATCTAAAACACAAACTAGTGAGTAAAATTATAATGTAATAGATGATAACTCAACAAATGG
AGTAATTAAAAAATATCACTAAAAACACTAAAATGATATAAATTAATGTGCTTTTGATAG
AGCTTAATACAATTAAAATATCAGATAAGAATAATAAAATAGTTTATTTATTTAAAGATA
CTAAATACCTTTAATAATTTCATAGCCTGAATTAGAATTTATCTAAGAAAGATCGAATAA
TATTAAAAATTACCCTAATCAAGTAAGATAGTAAGTTAATTCTCAAGAATAACCCATTAA
TAATGGAAACATGCAATAAAATTTAGAAAATATAAGAGAAATTAATGAAAGGTAAAAGTC
CAAAGATGTTATAAGATTATAAAATCAAAATGTTAGAACTTAATAACAATAACAGCAACG
TAATAATAACAATAATGAATAGACATATAACGATATTATTCAAAGAAGAAACTAAATAAA
TGCTTAGTAAGAAAATCTGAATGATTAATTTTAAAGTAGGTAAAACACAATTAATTAAAA
TCCACCCCCAAGATTCATGATTGATAACATGTATAATTAGTTTATAGAGTTTTAAAATCA
GCTTAGATAGCATTAAGGAATTAAATCAGATAAATATGTAAGCACAACTGTATATAAAAG
TTCATAGTCTTAGAATCTTTCTTAAGATGCTAAATAGTGCTCAATTTGTCTGTGCGAATT
TGAGGATGAAGAGAAAATAAGTTTTTTGGCTTGCTTTCATCGTTTTCATAATGAATGCAT
TCACAAATGGTTTGAAACAAAATCAACTTGTCCTCTATGCAAAAAAGATTAAAAAACATT
AATAAAAGATGTTAATAAACTATTAGATGAATTTTGA