Identifiers and Description

Gene Model Identifier

TTHERM_00543590

Standard Name

EPK1 (EpipPlasm associated Kinase 1)

Aliases

PreTt15007 | 71.m00134 | 3729.m00014

Description

Kinase family protein; localizes to epiplasm

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00543590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17017.19.997093137033517e-262hypothetical protein (718 aa)
WormBaseWBGene000121620.0000000000010000211161514907locus:sek-6 status:Partially
_confirmed UniProt:O01706
protein_id:CAB08354.1
OxytrichaContig15625.0.0.g550.00000000019994075865167896Protein kinase domain
SGDYDL159W0.0000000020002373268528243STE7 Signal transducing MAP ki
nase kinase involved in pherom
one response, where it phospho
rylates Fus3p, and in the pseu
dohyphal/invasive growth pathw
ay, through phosphorylation of
Kss1p; phosphorylated by Ste1
1p, degraded by ubiquitin path
way
DictyBaseDDB_G02708140.0000029996948234116693nek2 on chromosome: 1 position
4847143 to 4848761

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000133

Sequences

>TTHERM_00543590(coding)
ATGGGAGAGACAAATTCAAAACCACAACCTAATGTAGATTTCTTAAGAGTATTCTAAAGA
GAATACAAGGAAATCGGGGAAGAAATCGATACTCGTCTTGGTAATGTCAAGGTATATTAG
GGTCCTCAAAGTAATTTGGTAGCTGTCAAGAATAACTTCTTAATGAGCAAAGAGCTTATG
GAAGAATTTGTAGAAAACAATCTGCCAAAAGCACTAAATACTTAAAATCGTTACTTAATG
AAGGTACTTTCCTACAAGACTCACTCTGAAGATAGCATGTGTGGTTCTGTCAACGGTATC
ACTACCTACCATGAATATTACCAAAACACAGTTCAAGATGAGCTCGTCAGACGTTAACAA
GTCAGTCTCTACTACATAGAACAAGAGTTATGGGCTATTCTCTACTCTATTGTAAGTGCT
GCTTATTATCTTGAAAAGAACAATCTCATTCCTCTTACTGACGTCCGTCCTTCTACTGTT
TATTTCACTTTAAAGGGAGAAGTTAAGCTTATGCCTTTTGGTATTTTCCCTGAAGATATC
AGTGGTTATGCTAAATGCTTTAGCCAAAGCGAATAGAGCTACCTTTCTCCTGAATAGATT
GAAGAAATGAGAAAAAGAAAGCAAGTTCCTGATGTCAACCAAGTCAAGAGTGATGTCTAC
TCTATTGGTATGACCATGCTTGCTTGCGCTACTTTACAAACTAGCCCAAGCTGGTACAAT
TACGATGAATGCTCAATCAACTACAACTACGTTAACTACCTCCTTGACTTCTCTAAAAAC
TAATACTCAGACTTCTTCTGCAAGGTTGTTAAAATTATGCTCAGTGAAAACGCTGAAGAT
AGACCTACTCCTTCAATTATCTACAAAATTTTGCAACCCTATGAGAAGGACATCTTAGCA
TTGAAACCCTTCAATCCTGAAAAGGAAATCATCAAGAAATCTCTTGAATAAGAAAGCTCC
TAACTCAAGGTTTCAGAATAATAAGGAGAGAAACTTTTTGCAGACGACAACATTTTACAA
AATGGCCAATAAAGCAGTGTTCAATAATCTAACTCTCCTATTTTCGTTAAGGTTCCTTAT
CTTGGCGAAGATGGTAAAATCTACTACTAATAAGCTCCCTAACAATAATTTGAATATTTG
ATCTAATAATCTGATGGTTAACCCATTCCTCAATTAGAAAATCAATTCTTCTACCATGAT
CAATTCAACAACTAAACTAATCCTGTATATGTTAACGAGCCTACAAACCAAAGTGGAGTT
TACGTATCTTACTCCTAACCACCTGTTCAATAAGTTGAATACATTCAACCCAATACTGCT
ATCAGTGGAGTTTAATACGTCTAATCTGCTGCTCAACCTTAGGTTATCTTGAATGGAGCT
AGACAACACTACTCTTAAGTTTTAACTCAACCTGTATACTAGTAAGTTTCTTATGAAAAT
CAATCTGCTTCAATTCCCACAGCTTCATAACTCATCATGAATCCTGCTCCTTAATCTGGT
GTTTAATACGTATAAACTACCACTAGTCCTTACCACCCTGGCTAATCTCAAATTATTGCT
CAATATTCTTACAATATTGAAGAAAAGCCCTTTACTTCTATTCCTTTACAACAAAACTAA
GTAGCCTACCCTCAAACTGGAGCTGAAATTACTAATAGCCATGTCTAAATAAATCCTATG
GTTAACACTATTTAATACACTCCTATTAATAATTTAACTTCTAACTCTACTATTCAATAA
TAGTAGCCTGCTGAAGAAACTGTTAAGAAAGCTATGCGCCAAACTCAAAGCGACTAACAA
ATGGTTAACTAAGATATTTATGCTAACTAGATCTAATACAATAATGCTCCCACTTATGGT
ACTACATTTGCAGCTCATGAACCTGAAAGTCCTATTGGTATGGTTAGTGCAAACTAATAT
CCTTCTGAAATCAATAACACCGCTGCATTCTAAATTGGCTCCACAACTTATGGTGGTATT
AGATCAGATGCCGTCTAATCTAGTAATGCTAACTACCTTCCCAGTACCGTAGTTAACCAA
TAATACACATCCACTACTACTGGAAACAATGATATGATGAATGAAATAAACCGTCGTATC
AATTAAGTCCTATAAAGCAGTTAAAATGTCATAAGTAACTCTTAAGTCGGAAAATATTAA
TAATGA


>TTHERM_00543590(protein)
MGETNSKPQPNVDFLRVFQREYKEIGEEIDTRLGNVKVYQGPQSNLVAVKNNFLMSKELM
EEFVENNLPKALNTQNRYLMKVLSYKTHSEDSMCGSVNGITTYHEYYQNTVQDELVRRQQ
VSLYYIEQELWAILYSIVSAAYYLEKNNLIPLTDVRPSTVYFTLKGEVKLMPFGIFPEDI
SGYAKCFSQSEQSYLSPEQIEEMRKRKQVPDVNQVKSDVYSIGMTMLACATLQTSPSWYN
YDECSINYNYVNYLLDFSKNQYSDFFCKVVKIMLSENAEDRPTPSIIYKILQPYEKDILA
LKPFNPEKEIIKKSLEQESSQLKVSEQQGEKLFADDNILQNGQQSSVQQSNSPIFVKVPY
LGEDGKIYYQQAPQQQFEYLIQQSDGQPIPQLENQFFYHDQFNNQTNPVYVNEPTNQSGV
YVSYSQPPVQQVEYIQPNTAISGVQYVQSAAQPQVILNGARQHYSQVLTQPVYQQVSYEN
QSASIPTASQLIMNPAPQSGVQYVQTTTSPYHPGQSQIIAQYSYNIEEKPFTSIPLQQNQ
VAYPQTGAEITNSHVQINPMVNTIQYTPINNLTSNSTIQQQQPAEETVKKAMRQTQSDQQ
MVNQDIYANQIQYNNAPTYGTTFAAHEPESPIGMVSANQYPSEINNTAAFQIGSTTYGGI
RSDAVQSSNANYLPSTVVNQQYTSTTTGNNDMMNEINRRINQVLQSSQNVISNSQVGKYQ
Q


>TTHERM_00543590(gene)
ATGGGAGAGACAAATTCAAAACCACAACCTAATGTAGATTTCTTAAGAGTATTCTAAAGA
GAATACAAGGAAATCGGGGAAGAAATCGATACTCGTCTTGGTAATGTCAAGGTATATTAG
GGTCCTCAAAGTAATTTGGTAGCTGTCAAGAATAACTTCTTAATGAGCAAAGAGCTTATG
GAAGAATTTGTAGAAAACAATCTGCCAAAAGCACTAAATACTTAAAATCGTTACTTAATG
AAGGTACTTTCCTACAAGACTCACTCTGAAGATAGCATGTGTGGTTCTGTCAACGGTATC
ACTACCTACCATGAATATTACCAAAACACAGTTCAAGATGAGCTCGTCAGACGTTAACAA
GTCAGTCTCTACTACATAGAACAAGAGTTATGGGCTATTCTCTACTCTATTGTAAGTGCT
GCTTATTATCTTGAAAAGAACAATCTCATTCCTCTTACTGACGTCCGTCCTTCTACTGTT
TATTTCACTTTAAAGGGAGAAGTTAAGCTTATGCCTTTTGGGTAATTGATACATTTTATA
CTAATTCCTTAACAGTTTTTTATTTCTATCTCTAAAAATCAAACGTATTAGACATATGAG
CATTTCATTATTCTATGATTAGCTATATCCTATGTCTATGAAATAAAGATTATTCTGTTT
TTTCAATTTGAGTTGATAAGATTTCTTTGAAATACTTAAAAGGAATCTAATCTTGAGCTC
ATCAAATAAAAATGCCTCCCAAAATAATTTAAGGAGCAATCAAATGGTAGTTTATAGAGA
TAGGGCTTTCAAGAACATTATTTCAGTTTATAAAATAGCTCTTTATCTATCCATCATTTT
TACACATTTTTAGAGATTGAAATAAAATTATAAAATAAAAATAAATTAACTCAGCAAATG
TCTAAGCATTTTATTTATAAAATAGTATTTTCCCTGAAGATATCAGTGGTTATGCTAAAT
GCTTTAGCCAAAGCGAATAGAGCTACCTTTCTCCTGAATAGATTGAAGAAATGAGAAAAA
GAAAGCAAGTTCCTGATGTCAACCAAGTCAAGAGTGATGTCTACTCTATTGGTAATTTAT
TTAATAGGCATTAACTTAATCTACTTTTCACTTCAAAATGATAACATTTTAATTCATAGC
AAATAATGAATACAATAGCTTAAAAAAATAAAGAAAGAAAGAAAGAAAGAAATAAATTAA
TGAAGAAAGTTAGTAGCGGTTTATCAAAATAACTAATTTCAAAATTTAGGGTATTAAAGA
TACAATAAATTTTAGATGAAATAAATTTTTAATTTGCTTTTTGACTGAATCATAAATCAT
AAATTTATAAATTAATGAATGAATGAATGCGTGAGTGAGTGAGTGATTGGATGAATAAAT
GAACGCAAAAGAAAATTGTTTATTAACAGTCTAAAAGGGAAATTTACAACAAAGAAATTA
ATAAATTCAAAGAAAAGAAATTTAAAAAAAAGATAACTATCATTCATTCATTCATTCATT
CATTCACTCATTTTAATATTTTTTATTCACCCTTAAGATTCTTTAATTAAAAAAAATTAT
CTAAGTGTTATAATTCAGTAAAAAATTAAATGCAAAGCAAAAAGATATATTTTCAATAAT
CTATTCGAACATAGATACAATTACATACATACGTGCAAATACTTTTTTTTAATTTCTATT
TTCAGCAAGATATTAAGATAGAAATAAATTCGCAATATAAAATGAAAAAGCAACATAATT
AATTTAATAATTTGTTATAATTATTATGTAGGTATGACCATGCTTGCTTGCGCTACTTTA
CAAACTAGCCCAAGCTGGTACAATTACGATGAATGCTCAATCAACTACAACTACGTTAAC
TACCTCCTTGACTTCTCTAAAAACTAATACTCAGACTTCTTCTGCAAGGTTGTTAAAATT
ATGCTCAGTGAAAACGCTGAAGATAGACCTACTCCTTCAATTATCTACAAAATTTTGCAA
CCCTATGAGAAGGACATCTTAGCATTGAAACCCTTCAATCCTGAAAAGGAAATCATCAAG
AAATCTCTTGAATAAGAAAGCTCCTAACTCAAGGTTTCAGAATAATAAGGAGAGAAACTT
TTTGCAGACGACAACATTTTACAAAATGGCCAATAAAGCAGTGTTCAATAATCTAACTCT
CCTATTTTCGTTAAGGTTCCTTATCTTGGCGAAGATGGTAAAATCTACTACTAATAAGCT
CCCTAACAATAATTTGAATATTTGATCTAATAATCTGATGGTTAACCCATTCCTCAATTA
GAAAATCAATTCTTCTACCATGATCAATTCAACAACTAAACTAATCCTGTATATGTTAAC
GAGCCTACAAACCAAAGTGGAGTTTACGTATCTTACTCCTAACCACCTGTTCAATAAGTT
GAATACATTCAACCCAATACTGCTATCAGTGGAGTTTAATACGTCTAATCTGCTGCTCAA
CCTTAGGTTATCTTGAATGGAGCTAGACAACACTACTCTTAAGTTTTAACTCAACCTGTA
TACTAGTAAGTTTCTTATGAAAATCAATCTGCTTCAATTCCCACAGCTTCATAACTCATC
ATGAATCCTGCTCCTTAATCTGGTGTTTAATACGTATAAACTACCACTAGTCCTTACCAC
CCTGGCTAATCTCAAATTATTGCTCAATATTCTTACAATATTGAAGAAAAGCCCTTTACT
TCTATTCCTTTACAACAAAACTAAGTAGCCTACCCTCAAACTGGAGCTGAAATTACTAAT
AGCCATGTCTAAATAAATCCTATGGTTAACACTATTTAATACACTCCTATTAATAATTTA
ACTTCTAACTCTACTATTCAATAATAGTAGCCTGCTGAAGAAACTGTTAAGAAAGCTATG
CGCCAAACTCAAAGCGACTAACAAATGGTTAACTAAGATATTTATGCTAACTAGATCTAA
TACAATAATGCTCCCACTTATGGTACTACATTTGCAGCTCATGAACCTGAAAGTCCTATT
GGTATGGTTAGTGCAAACTAATATCCTTCTGAAATCAATAACACCGCTGCATTCTAAATT
GGCTCCACAACTTATGGTGGTATTAGATCAGATGCCGTCTAATCTAGTAATGCTAACTAC
CTTCCCAGTACCGTAGTTAACCAATAATACACATCCACTACTACTGGAAACAATGATATG
ATGAATGAAATAAACCGTCGTATCAATTAAGTCCTATAAAGCAGTTAAAATGTCATAAGT
AACTCTTAAGTCGGAAAATATTAATAATGA