Identifiers and Description

Gene Model Identifier

TTHERM_00481300

Standard Name

EPI35 (EPIplasmic protein 35)

Aliases

PreTt06262 | 58.m00234 | 3719.m00090

Description

Epiplasmic protein; localizes to basal bodies

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00481300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14216.15.998305401373361e-129hypothetical protein (328 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000147

Sequences

>TTHERM_00481300(coding)
ATGTCCTCAAACGAAAACCAATCTGAACAAGAAAAAGCTTAAGTCTTACAAGGAACTAAG
CCTGTCTACTAATACCCTGCTTATACTAGCTAATACGTCTAATAATAGCCTTTGATTTAA
TCTTAATTGGTTACTCAACCCGTATAATATGTTTAGCAACCAGTTTAATATGTCTAATAA
ACTGTTTAAGGAGTTCATTAATCTGCCCTTTCTCAATCCCAAGCTGTTGCTTCTGGCCTT
GTTGCAACCTAAATTCAAAGAGAAGTTGTCAAGGGTGAATCCAGAATTGAATACATTCCT
TATGAAAAATCTGTGATCGAATATGAAGCCGTTCAAAGAGTTGATTACGTTCCCAAGGAA
AAGAAAATCACTGATTACTACGCCGTTGAATATTAAACTGAGTACCTTCCTCAAGTTTAC
TAAGACAGATATATTGAATACATTCCCACTGAAAGAATCTAAGAAAGAGTTGAATATCAA
GCAATTCAAAAGCAAATAGTTCACCAACCTGTTTAACAATAATAATAAGTTCTTTAAACC
GTTGTCCAACCTGCTACCACCTACCTCTAATCTTCTCAAGTCACTGTCCCTGTAGTATAA
TAACAATTCGTTCCTACTGCTTCTGTTGTCCACACTACTATCCCTGCCACTCAAGTCGTC
CAAGGTGCTACTCATGTTGTCCAAGGAGCTTCTACTGTTGTTTAAAACGTTCCAACTGCA
TAGTTTGTTTAAACTGTCCCCACTGCCTTCTCAACTCAAACCTTAGGTGTCCCCGTTGTT
CGTGCTGGTTTGACTACCTCTGGTGTTAGAACCTTAGGACCTGTTCCTTACTCAGTTGTA
GAAGAAGCTATTAAGAAAAGCTAAAAGAAGGACGAATGA


>TTHERM_00481300(protein)
MSSNENQSEQEKAQVLQGTKPVYQYPAYTSQYVQQQPLIQSQLVTQPVQYVQQPVQYVQQ
TVQGVHQSALSQSQAVASGLVATQIQREVVKGESRIEYIPYEKSVIEYEAVQRVDYVPKE
KKITDYYAVEYQTEYLPQVYQDRYIEYIPTERIQERVEYQAIQKQIVHQPVQQQQQVLQT
VVQPATTYLQSSQVTVPVVQQQFVPTASVVHTTIPATQVVQGATHVVQGASTVVQNVPTA
QFVQTVPTAFSTQTLGVPVVRAGLTTSGVRTLGPVPYSVVEEAIKKSQKKDE


>TTHERM_00481300(gene)
ATAATAAAAATTTATTAAAAACAAAACGTAATCATATAAAAAATATAAATTTTTCTTCTT
TTATTTTAAAAAAATAATAAAATGTCCTCAAACGAAAACCAATCTGAACAAGAAAAAGCT
TAAGTCTTACAAGGAACTAAGCCTGTCTACTAATACCCTGCTTATACTAGCTAATACGTC
TAATAATAGCCTTTGATTTAATCTTAATTGGTTACTCAACCCGTATAATATGTTTAGCAA
CCAGTTTAATATGTCTAATAAACTGTTTAAGGAGTTCATTAATCTGCCCTTTCTCAATCC
CAAGCTGTTGCTTCTGGCCTTGTTGCAACCTAAATTCAAAGAGAAGTTGTCAAGGGTGAA
TCCAGAATTGAATACATTCCTTATGAAAAATCTGTGATCGAATATGAAGCCGTTCAAAGA
GTTGATTACGTTCCCAAGGAAAAGAAAATCACTGATTACTACGCCGTTGAATATTAAACT
GAGTACCTTCCTCAAGTTTACTAAGACAGATATATTGAATACATTCCCACTGAAAGAATC
TAAGAAAGAGTTGAATATCAAGCAATTCAAAAGCAAATAGTTCACCAACCTGTTTAACAA
TAATAATAAGTTCTTTAAACCGTTGTCCAACCTGCTACCACCTACCTCTAATCTTCTCAA
GTCACTGTCCCTGTAGTATAATAACAATTCGTTCCTACTGCTTCTGTTGTCCACACTACT
ATCCCTGCCACTCAAGTCGTCCAAGGTGCTACTCATGTTGTCCAAGGAGCTTCTACTGTT
GTTTAAAACGTTCCAACTGCATAGTTTGTTTAAACTGTCCCCACTGCCTTCTCAACTCAA
ACCTTAGGTGTCCCCGTTGTTCGTGCTGGTTTGACTACCTCTGGTGTTAGAACCTTAGGA
CCTGTTCCTTACTCAGTTGTAGAAGAAGCTATTAAGAAAAGCTAAAAGAAGGACGAATGA