Identifiers and Description

Gene Model Identifier

TTHERM_00379000

Standard Name

EPC1 (EPilasmin C )

Aliases

PreTt10354 | 40.m00239 | EpiC

Description

Epiplasmin C; the major protein component of the membrane skeleton (epiplasm); influences cell shape and the fidelity of cortical development

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02524 ) KID repeat
  • ( PF06994 ) Involucrin
  • ( PF00261 ) Tropomyosin
  • ( PF01576 ) Myosin tail
  • ( PF04899 ) MbeD/MobD like
  • ( PF01920 ) Prefoldin subunit
  • ( PF02996 ) Prefoldin subunit
  • ( PF04044 ) Nup133 nucleoporin
  • ( TIGR00158 ) ribosomal protein L9
  • ( PF02344 ) Myc leucine zipper domain
  • ( PF00769 ) Ezrin/radixin/moesin family
  • ( PF08614 ) Autophagy protein 16 (ATG16)
  • ( PF00038 ) Intermediate filament protein
  • ( TIGR00020 ) peptide chain release factor 2
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF04576 ) Protein of unknown function, DUF593
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( TIGR02681 ) phage regulatory protein, Rha family
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF07544 ) RNA polymerase II transcription mediator
  • ( PF05911 ) Plant protein of unknown function
  • ( PF01239 ) Protein prenyltransferase alpha subunit repeat
  • ( PF09006 ) Lung surfactant protein D coiled-coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00379000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00075.19.997093137033517e-262hypothetical protein (808 aa)
OxytrichaContig16911.0.1.g920.0005997485943342685hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15134256: Williams NE (2004) The epiplasm gene EPC1 influences cell shape and cortical pattern in Tetrahymena thermophila. The Journal of eukaryotic microbiology 51(2):201-6
  2. Ref:12674475: Huttenlauch I, Stick R (2003) Occurrence of articulins and epiplasmins in protists. The Journal of eukaryotic microbiology 50(1):15-8
  3. Ref:12674474: Honts JE, Williams NE (2003) Novel cytoskeletal proteins in the cortex of Tetrahymena. The Journal of eukaryotic microbiology 50(1):9-14
  4. Ref:11112694: Bouchard P, Chomilier J, Ravet V, Mornon JP, Viguès B (2001) Molecular characterization of the major membrane skeletal protein in the ciliate Tetrahymena pyriformis suggests n-plication of an early evolutionary intermediate filament protein subdomain. Journal of cell science 114(Pt 1):101-110
  5. Ref:10571109: Bouchard P, Ravet V, Meiniel R, Creveaux I, Meiniel A, Vellet A, Vigues B (1999) Use of a heterologous monoclonal antibody for cloning and detection of glial fibrillary acidic protein in the bovine ventricular ependyma. Cell and tissue research 298(2):207-16
  6. Ref:9788878: Huttenlauch I, Peck RK, Stick R (1998) Articulins and epiplasmins: two distinct classes of cytoskeletal proteins of the membrane skeleton in protists. Journal of cell science 111 ( Pt 22)( ):3367-78
  7. Ref:7620468: Williams NE, Honts JE, Dress VM, Nelsen EM, Frankel J (1995) Monoclonal antibodies reveal complex structure in the membrane skeleton of Tetrahymena. The Journal of eukaryotic microbiology 42(4):422-7

Sequences

>TTHERM_00379000(coding)
ATGTCTTATCAATACAGTCAAAACCTCGTTCAAAGCACCAACGTCCCACCTGGTAGCATT
CAATACTCCTAAAACAATATCCAAACTGCTGGACGTACCTTGATTGACTCTAGCTCCCCG
GAACATCCCATTCAATTGGCATCCAGCAACTAAGTCGTCAGCTAGATCCTCACCACCACT
TAAGGTTCTCCCACCAGACAATCCAAGACCTTCGTCTACAGATCTGAATCTCCTATTAGA
TCTTCTCAATACGGTAAGCACGTAGTCAATGTTTCTCACATTGAAAAGGGTCAAGCTCCC
ATTTACGTCTCCCAATCTACTGTCTAAAACCCTATCTACGTTGAAAAGATTGTTAAGGTC
GAAAGCAGTAACACTTCTGAACTCAACCTTCTCAGATAACGTATTTCAGCTTTGGAACTC
TAAAACAAGACCTTGACTGAAGAACTCATCACCTTAAGAAACAACACTCCTCAAGAAGTT
GAATAGATTGTTTACATTGAAAACAACGAAGAAATCAACAAATTGAGATATGAATTGAAC
AACATCAAGGCTCTCTCTGACGCTGAAAATGAAAACGTCAAGAGATCAAAGAAGAACTTG
GAAGACTAATTCAACTCAGTCTTACAAGAAAGAGACAGAATGATCATCTAACTTAAGGAA
TTAACTGTTAAGATCACTGAATTCTAATCCTTGATTGCCTCTAGAGATATCCAAATCAAC
AACTTAAAGATCTAAAACGAAAACCTTGCCACCAGACTCGTCCTCACTACTGCTGAATTA
GAAAAGATCACTCAAGTTAAGGTTGAAGCTGAACCTTTGAGAAGAAAGGTTACTGAACTC
GAATAATACTTGATTCAATAAGAAAAGATTATCGAGGACTTGAGAAATAGACTTGGCCAA
CAAGATCAAGTTATTTCTCAATTAAGAATGTTCGAAATCAGATGTTCCTAATACGAATAA
GAAATCAATGCTTTGAGAGCCAAGTTACAAGAATCTGAAAACAACTCTCTCCTCCTTATC
AAGAAGATTGAAGAATTACAAAACTTACTCAATGATGAAAACGTCAAGAGATCTAAGAAG
GATGGTGAACTCGCCATTTCTCTCAGAGACAAGCAAGCTCTTGAAGAAAAGCTTGTTCAC
TTGACTCAACAAGTCGAATTCTTAACAAGAAAGGTTGCTGCTCAAGAACAAGATATCAAT
GCCCAAAGAACTAGAATCATTGAGTTAGAAGGTATTGCTGCTAAGGTAGGATCTTACGAA
CAACAAATCTAATACCTCAGCCAACAAATCGAAAGATTGAACTAGGTTATTAGAGAAAAG
GACCAAACCATCACTCAACTTAACATTGAACTCAACCAACTCAGATTATCTAACTCTCAA
ATCGCTTAACTCTAAGAATAAGTCGTTACCTTATAACAAAACCTTGTTACTAGAACTGCT
GAAGTTGAATCTCTTAGAAAGAGAGTCTCTGAATAAGAACTCCTCATTAACTAACTCAGA
ATGTTTGAATAAAGAGTTGGTGAATATGAACAAATCATTAATGCTCTCAGATAGAGAATT
GCTGAACTTGAAGCTCAACTCAACGACGAAAACGTCAAGAGAAGCAAGAAGGACGGTGAA
CTCGCCATCTCCCTCAGAGACAAGCAAGCTCTTGAAGAAAAGCTCGTCCACATGACCCAA
CAAATTGAATTCTTATCTCAAAAGGTTAACTAATTAACTGGTCAAGTTGCTGAAAGAGAC
TAAATCATCAGCTAACTCAGAGTTTACGAAATCAGAGTTAAGGAATACGAAAATGTCATC
AACGCTCTTAGATAGAGAGTTGCTGAACTTGAAGCTCAACTCAACGACGAAAACGTCAAG
AGAAGCAAGAAGGACGGTGAACTCGCCATCTCCCTCAGAGACAAGCAAGCTCTTGAAGAA
AAGCTCGTTCACATGACCCAACAAATTGAATTCTTAAGCCAAAAGGTTGCTCAATACGAA
AAGATTCTTGGTGAACAATAATAATAACTCGCTGAAAGAGATAACATTATTAACTAACTC
AGAGTCTTCGAAATTAGAGTTAAGGAATACGAAAACGTCATCAACGCTCTTAGATAGAGA
GTTGCTGAACTTGAAGCTCAACTCAACGACGAAAACGTCAAGAGAAGCAAGAAGGACGGT
GAACTCGCCATCTCCCTCAGAGACAAGCAAGCTCTTGAAGAAAAGCTCGTTCACATGACC
TAGTAGATCGAATTCTTAAGCCAAAAGGTTGCCCAATACGAAAAGATCCTTGGTGAATAA
TAATAATAACTCGCTGAAAGAGACAACATCATTAACTAACTCAGAGTTTATGAAATCAGA
GTTAAGGAATACGAAAATGTCATCAACGCTCTTAGATAGAGAGTTTCTGAACTTGAAGCT
CAACTCAACGACGAAAACGTCAAGAGAAGCAAGAAGGACGGTGAACTCGCCATCTCCCTC
AGAGACAAGCAAGCCCTCGAAGAAAAGCTCGTCCACATGACCCAACAAATTGAATTCTTA
TCTCAAAAGGTTAACTAATTAACTGGTCAAGTTGCTGAAAGAGACAACATCATTAACTAA
CTCAGAGTTTATGAAATCAGAGTTAAGGAATACGAAAATGTTATCAACGCTCTTAGATAG
AGAGTTGCTGAACTTGAAGCTCAACTCAACGACGAAAACGTCAAGAGAAGCAAGAAGGAC
GGTGAACTCGCCATCTCCCTCAGAGACAAGCAAGCCCTCGAAGAAAAGCTCGTCCACATG
ACCTAATAGATTGAATTCTTGAACATGAAGGTCACTTCTTACGAAAAGTAAATCTAAGAA
AAGGATGGTCAAATTAACTAACTCAGAATCGAAATCTCTCAACTCCAAATCAACCTTCAA
TAATTGTAGAACGCTTCTGAAGAAGTCAGAAGACTCACTGAACTCCTCGTCGTTAAGACC
ACTGAAATCGACTAACTCAGAAAGAGATTAGCCGAATTAGAAATCGCCCTCTAGGAATTC
AACCTCGTCCAAGCTAAGCTCCAAGAATGTGAAAAGAATAACTAATTACTCAGATAGAGA
ATTGCTGAATTAGAAGCTCTCCTCAATGATGAAGCTGTTAAGAGATCTAGAAACCAAGGA
GATTTGGAAATTTCTTTGAGAGACAAGTAAGCCTTAGAAGAAAAGCTCGTCCACATGACT
CAACAAATCGAATTCTTAAGCAGAAAGGTTACCTAACTCACCGAAGAAAACTCCAACCTC
AGAGTTATCGTTTCTTCTTACTAACAAATCATCGATGAATGGTAATCCATCAGTGTCAGA
CACGCCAGCTTCTCCTAATTATTAGAAAACCTCAAGGTTAGAGTCCAACAAATCTCTTTC
TCTTCCTCTTCATCTTCCTAAGTTATTTCCCAATCTTCTTACGTCAGAAGCTCTGGTGTT
GCTCACAAGTGA


>TTHERM_00379000(protein)
MSYQYSQNLVQSTNVPPGSIQYSQNNIQTAGRTLIDSSSPEHPIQLASSNQVVSQILTTT
QGSPTRQSKTFVYRSESPIRSSQYGKHVVNVSHIEKGQAPIYVSQSTVQNPIYVEKIVKV
ESSNTSELNLLRQRISALELQNKTLTEELITLRNNTPQEVEQIVYIENNEEINKLRYELN
NIKALSDAENENVKRSKKNLEDQFNSVLQERDRMIIQLKELTVKITEFQSLIASRDIQIN
NLKIQNENLATRLVLTTAELEKITQVKVEAEPLRRKVTELEQYLIQQEKIIEDLRNRLGQ
QDQVISQLRMFEIRCSQYEQEINALRAKLQESENNSLLLIKKIEELQNLLNDENVKRSKK
DGELAISLRDKQALEEKLVHLTQQVEFLTRKVAAQEQDINAQRTRIIELEGIAAKVGSYE
QQIQYLSQQIERLNQVIREKDQTITQLNIELNQLRLSNSQIAQLQEQVVTLQQNLVTRTA
EVESLRKRVSEQELLINQLRMFEQRVGEYEQIINALRQRIAELEAQLNDENVKRSKKDGE
LAISLRDKQALEEKLVHMTQQIEFLSQKVNQLTGQVAERDQIISQLRVYEIRVKEYENVI
NALRQRVAELEAQLNDENVKRSKKDGELAISLRDKQALEEKLVHMTQQIEFLSQKVAQYE
KILGEQQQQLAERDNIINQLRVFEIRVKEYENVINALRQRVAELEAQLNDENVKRSKKDG
ELAISLRDKQALEEKLVHMTQQIEFLSQKVAQYEKILGEQQQQLAERDNIINQLRVYEIR
VKEYENVINALRQRVSELEAQLNDENVKRSKKDGELAISLRDKQALEEKLVHMTQQIEFL
SQKVNQLTGQVAERDNIINQLRVYEIRVKEYENVINALRQRVAELEAQLNDENVKRSKKD
GELAISLRDKQALEEKLVHMTQQIEFLNMKVTSYEKQIQEKDGQINQLRIEISQLQINLQ
QLQNASEEVRRLTELLVVKTTEIDQLRKRLAELEIALQEFNLVQAKLQECEKNNQLLRQR
IAELEALLNDEAVKRSRNQGDLEISLRDKQALEEKLVHMTQQIEFLSRKVTQLTEENSNL
RVIVSSYQQIIDEWQSISVRHASFSQLLENLKVRVQQISFSSSSSSQVISQSSYVRSSGV
AHK


>TTHERM_00379000(gene)
ATGTCTTATCAATACAGTCAAAACCTCGTTCAAAGCACCAACGTCCCACCTGGTAGCATT
CAATACTCCTAAAACAATATCCAAACTGCTGGACGTACCTTGATTGACTCTAGCTCCCCG
GAACATCCCATTCAATTGGCATCCAGCAACTAAGTCGTCAGCTAGATCCTCACCACCACT
TAAGGTTCTCCCACCAGACAATCCAAGACCTTCGTCTACAGATCTGAATCTCCTATTAGA
TCTTCTCAATACGGTAAGCACGTAGTCAATGTTTCTCACATTGAAAAGGGTCAAGCTCCC
ATTTACGTCTCCCAATCTACTGTCTAAAACCCTATCTACGTTGAAAAGATTGTTAAGGTC
GAAAGCAGTAACACTTCTGAACTCAACCTTCTCAGATAACGTATTTCAGCGTAATATTTT
ACATCTTTTTACAGTATTTAGTCTCAATCTCTTCTTACTTCTATCTCCCTTTTCAGCATT
TTCTTTTTGATTTTTCTTTCCACACCCTATCATACCAAATCTGCTCTTTTCATACTCCAA
TCACTTTTTAAAACTCCTTAAATTGACTCTTCAGTAGCTCTTTAGCAGCTAGCTTTATGG
TTCTTATTAAGCAAAAAGGACTCAGTACTCAAAGGTGTAGAAAAGAGATAGATAAATACA
TATCAAAGAAAATAACAGCCTTCTAGTTAGTATTTTTAACAAAAATGCTACTTTTAGGTT
AAATTTTCTAAGAAATTGTAGTGTTTTTCTATCTTAATTCTATAGTCATTGATTGATCTA
AAGAGTGAAGGAAGTAGTCGTTTACTCAAACTTTTCTACCCTCAAGCAAATAGTAGGTAA
AAGGTATGAAAAGTTTTGAGTAACAGTCATTCAAAAGCTTCTCTTTTAAAGTACAAAGCC
AAAAAATGAATGAATATAATCTGATCGTACATACCTTCATTTACTGAAGCAGTCGACTAT
TGGGAGAAAAAGGATAAGGAGAAGTAGCAGTGTTAAAATAAAAGATTTAAACTAATATTA
CCCTACTGATAAAACTAATAAAAATAAAAAATTTAATTCATCTAATGATGTAATAGAATT
ACAAATTGGTTGACTGATTAATTGATTGATTCATTCATTCTTTTATTCATTCATTAATTC
GCCATTACATTTATACATACAAAAAAAGAAAGATTGATAGGAAAAAGTAAAATCAATAGG
TGGTAGACCAGAAGATATAAAATAATAAAAAAAATAAATAAAGAAAATAAAAATTAATTA
AAATTTTAATTAGTTGACCAGTAGCAATTTATTTAATTAATTTATAAAGAGAAGAAAGTG
GAAAGAAATAAAAACCATAGAAAAAATTAAAAAGAAGGATAGAAAAAGACAATAGAAAAT
AATTAATAAATAAATCCTACTTTTTAGAGACTAACTAATTAACTATTCATCATATCTAAA
TAAATAAATTTTAACTAACTAATTATTTTATTAACTTATAGTTTGGAACTCTAAAACAAG
ACCTTGACTGAAGAACTCATCACCTTAAGAAACAACACTCCTCAAGAAGTTGAATAGATT
GTTTACATTGAAAACAACGAAGAAATCAACAAATTGAGATATGAATTGAACAACATCAAG
GCTCTCTCTGACGCTGAAAATGAAAACGTCAAGAGATCAAAGAAGAACTTGGAAGACTAA
TTCAACTCAGTCTTACAAGAAAGAGACAGAATGATCATCTAACTTAAGGAATTAACTGTT
AAGATCACTGAATTCTAATCCTTGATTGCCTCTAGAGATATCCAAATCAACAACTTAAAG
ATCTAAAACGAAAACCTTGCCACCAGACTCGTCCTCACTACTGCTGAATTAGAAAAGATC
ACTCAAGTTAAGGTTGAAGCTGAACCTTTGAGAAGAAAGGTTACTGAACTCGAATAATAC
TTGATTCAATAAGAAAAGATTATCGAGGACTTGAGAAATAGACTTGGCCAACAAGATCAA
GTTATTTCTCAATTAAGAATGTTCGAAATCAGATGTTCCTAATACGAATAAGAAATCAAT
GCTTTGAGAGCCAAGTTACAAGAATCTGAAAACAACTCTCTCCTCCTTATCAAGAAGATT
GAAGAATTACAAAACTTACTCAATGATGAAAACGTCAAGAGATCTAAGAAGGATGGTGAA
CTCGCCATTTCTCTCAGAGACAAGCAAGCTCTTGAAGAAAAGCTTGTTCACTTGACTCAA
CAAGTCGAATTCTTAACAAGAAAGGTTGCTGCTCAAGAACAAGATATCAATGCCCAAAGA
ACTAGAATCATTGAGTTAGAAGGTATTGCTGCTAAGGTAGGATCTTACGAACAACAAATC
TAATACCTCAGCCAACAAATCGAAAGATTGAACTAGGTTATTAGAGAAAAGGACCAAACC
ATCACTCAACTTAACATTGAACTCAACCAACTCAGATTATCTAACTCTCAAATCGCTTAA
CTCTAAGAATAAGTCGTTACCTTATAACAAAACCTTGTTACTAGAACTGCTGAAGTTGAA
TCTCTTAGAAAGAGAGTCTCTGAATAAGAACTCCTCATTAACTAACTCAGAATGTTTGAA
TAAAGAGTTGGTGAATATGAACAAATCATTAATGCTCTCAGATAGAGAATTGCTGAACTT
GAAGCTCAACTCAACGACGAAAACGTCAAGAGAAGCAAGAAGGACGGTGAACTCGCCATC
TCCCTCAGAGACAAGCAAGCTCTTGAAGAAAAGCTCGTCCACATGACCCAACAAATTGAA
TTCTTATCTCAAAAGGTTAACTAATTAACTGGTCAAGTTGCTGAAAGAGACTAAATCATC
AGCTAACTCAGAGTTTACGAAATCAGAGTTAAGGAATACGAAAATGTCATCAACGCTCTT
AGATAGAGAGTTGCTGAACTTGAAGCTCAACTCAACGACGAAAACGTCAAGAGAAGCAAG
AAGGACGGTGAACTCGCCATCTCCCTCAGAGACAAGCAAGCTCTTGAAGAAAAGCTCGTT
CACATGACCCAACAAATTGAATTCTTAAGCCAAAAGGTTGCTCAATACGAAAAGATTCTT
GGTGAACAATAATAATAACTCGCTGAAAGAGATAACATTATTAACTAACTCAGAGTCTTC
GAAATTAGAGTTAAGGAATACGAAAACGTCATCAACGCTCTTAGATAGAGAGTTGCTGAA
CTTGAAGCTCAACTCAACGACGAAAACGTCAAGAGAAGCAAGAAGGACGGTGAACTCGCC
ATCTCCCTCAGAGACAAGCAAGCTCTTGAAGAAAAGCTCGTTCACATGACCTAGTAGATC
GAATTCTTAAGCCAAAAGGTTGCCCAATACGAAAAGATCCTTGGTGAATAATAATAATAA
CTCGCTGAAAGAGACAACATCATTAACTAACTCAGAGTTTATGAAATCAGAGTTAAGGAA
TACGAAAATGTCATCAACGCTCTTAGATAGAGAGTTTCTGAACTTGAAGCTCAACTCAAC
GACGAAAACGTCAAGAGAAGCAAGAAGGACGGTGAACTCGCCATCTCCCTCAGAGACAAG
CAAGCCCTCGAAGAAAAGCTCGTCCACATGACCCAACAAATTGAATTCTTATCTCAAAAG
GTTAACTAATTAACTGGTCAAGTTGCTGAAAGAGACAACATCATTAACTAACTCAGAGTT
TATGAAATCAGAGTTAAGGAATACGAAAATGTTATCAACGCTCTTAGATAGAGAGTTGCT
GAACTTGAAGCTCAACTCAACGACGAAAACGTCAAGAGAAGCAAGAAGGACGGTGAACTC
GCCATCTCCCTCAGAGACAAGCAAGCCCTCGAAGAAAAGCTCGTCCACATGACCTAATAG
ATTGAATTCTTGAACATGAAGGTCACTTCTTACGAAAAGTAAATCTAAGAAAAGGATGGT
CAAATTAACTAACTCAGAATCGAAATCTCTCAACTCCAAATCAACCTTCAATAATTGTAG
AACGCTTCTGAAGAAGTCAGAAGACTCACTGAACTCCTCGTCGTTAAGACCACTGAAATC
GACTAACTCAGAAAGAGATTAGCCGAATTAGAAATCGCCCTCTAGGAATTCAACCTCGTC
CAAGCTAAGCTCCAAGAATGTGAAAAGAATAACTAATTACTCAGATAGAGAATTGCTGAA
TTAGAAGCTCTCCTCAATGATGAAGCTGTTAAGAGATCTAGAAACCAAGGAGATTTGGAA
ATTTCTTTGAGAGACAAGTAAGCCTTAGAAGAAAAGCTCGTCCACATGACTCAACAAATC
GAATTCTTAAGCAGAAAGGTTACCTAACTCACCGAAGAAAACTCCAACCTCAGAGTTATC
GTTTCTTCTTACTAACAAATCATCGATGAATGGTAATCCATCAGTGTCAGACACGCCAGC
TTCTCCTAATTATTAGAAAACCTCAAGGTTAGAGTCCAACAAATCTCTTTCTCTTCCTCT
TCATCTTCCTAAGTTATTTCCCAATCTTCTTACGTCAGAAGCTCTGGTGTTGCTCACAAG
TGA