Identifiers and Description

Gene Model Identifier

TTHERM_00637010

Standard Name

EPB1 (EPB1 - EPiplasmin B1)

Aliases

PreTt19704 | 91.m00119

Description

Viral A-type inclusion protein repeat containing protein. Epiplasmin B; A major protein component of the membrane skeleton (epiplasm); influences cell shape and the fidelity of cortical development

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF08287 ) Spc19
  • ( PF00261 ) Tropomyosin
  • ( PF01576 ) Myosin tail
  • ( PF02755 ) RPEL repeat
  • ( PF08912 ) Rho Binding
  • ( PF00435 ) Spectrin repeat
  • ( PF02370 ) M protein repeat
  • ( PF04012 ) PspA/IM30 family
  • ( PF06008 ) Laminin Domain I
  • ( PF00904 ) Involucrin repeat
  • ( PF01920 ) Prefoldin subunit
  • ( TIGR00012 ) ribosomal protein L29
  • ( TIGR02977 ) phage shock protein A
  • ( PF00170 ) bZIP transcription factor
  • ( PF06705 ) SF-assemblin/beta giardin
  • ( PF07926 ) TPR/MLP1/MLP2-like protein
  • ( TIGR00293 ) prefoldin, alpha subunit
  • ( PF07716 ) Basic region leucine zipper
  • ( PF08614 ) Autophagy protein 16 (ATG16)
  • ( PF00038 ) Intermediate filament protein
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF06698 ) Protein of unknown function (DUF1192)
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( PF02403 ) Seryl-tRNA synthetase N-terminal domain
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF05911 ) Plant protein of unknown function
  • ( PF07106 ) Tat binding protein 1(TBP-1)-interacting protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 25.5%

TetraMine Data

TTHERM_00637010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03526.19.997093137033517e-262hypothetical protein (1656 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00637010(coding)
ATGTGTATGTTTATGTTTATGAATGGCACTTTTATTAAGTAATTAACTAGATTCTTTTTA
TTTAATGGAAGAGCGGAGAAAAGGCTTAGAAACCCAAGCATTAAAATAAAATAAAAATAA
ATAAGAAAAAAATCTTTACTGAAAAAAAAGTAAAAAAAACTTGAATTTAGTTTCAGAGAA
GAATAAAAAAATATAAAGATGCAACAAACTCCTCAAATAATCAGTAACTCATAAGTCTTT
AACAAGAATGAGTTTTACCAAAAAGGATTTTTAACTCAATCTTAAATTAGTTAAACTCCC
CATGGTATTCATTAGGTTACTACCACTGAATATCCTAAGGATTCCACCATTGTTAAATTG
ATTTCATCCAATGCTCCTGGTGCAGTCACCCAAGTTAGTCCTAGCTTCCAAGTTTAAAGC
AGAGTCCGTGCTAGCAACAGACACTCAACTCCTCCTGGACATTCTAGAACCATCATTCGT
CATAGCGAATCCCCTCTTAGATATGTCACTGAATCCATTTCTCCTGGTCGTACCACCACT
TATCAAGATAGATAGATTCCTGTTGCTGCCGTCGTCAAAGAATAGATTCCTCTCTATATC
ATCGAATAACAAAGATAGCCAGTTCAAATCCAAGAAAGAGTTGTTGAAGTTGAAAAGCCT
ATCTATATTGAGAAGATAGTCGAAATAGCTACTGACTAAACCCTCTAAGTCCAATAATTG
AGTGAAAGAATCCAATTATTAGAATAAACTAACTAGTAACTCGCTTAAGAACTTGAACTT
TATAAAAACCAAACACCACAATAACCTCAAGTTATCCAAGTAGAAAATAACGAAAGAATT
ATTTTATTAGAAAGAGAAATCGAACGTTTACAAGAAGAAGGCGAAAAAAGAAAGAAGGCT
GGCAGATAGAATGAGAGTGAAATGTTAAAAGCTAACAATGACCGTGAAGAAAAGATTAGA
GAACTCATAGCTCAAATTGAATAATTACACGCTCTCTTGAACGAAAAGTAAGAATAAATT
AATAGCCTCAACATCAGAATCACCCAAATCCAAAACAATGAAGTTCGTCAAAGCGATGCT
CGTTCTAACGATTACATGTCAAAGATTAACACTCTTACTTTAGAAATCGAAAGACTCACC
AAGCAAATGAAATTAAGCCGTGAGTAATACGATGAAGATATGTAAGCCAAGCAAGCTTAG
ATTCTCGGTCTTAATAGCAAGCTTTCGGAATACGAAAATAGATTTGTCTTCCTTAATGCC
GAGTTAGAAAGACTTAGAAACAATCAAAGCGACAACGTCAGAATTAACTAATTGGAAACC
AGAATTAGAGAATTAGAAATTATCATCTAACAAAAGGATGGCTAACTCAATGATTGGAGA
TCCAAGTTCGCTGAAATGGAAAAGGCATTGACCATTTATAAGCAATACGAAAGCAAGCTT
TATGAATGTGAAAACGTCAATAACTAACTCAGAAAAAAGATTGAAGAACTCATGTTTGAA
ATCGATAGATTAAATAACTTAGTCAACCAAAAGGAAAGCGAACTCCAACGTTTGAGACTT
GAAGTCAACAGCTTGACTGTCAACATCAGATAATCTGGAGTTAACTAATAAGAAGAAATT
AACAGATTAAATGCCCTCGTCTAAGAGCGTAACTAATAAATCCAATTCTTAAACCAAAAG
GTTTCTGCTTTTGAAGATAGAATTCGTGAACAAGAAGGTCTCATCCTTTAATTATAAAAA
ACCATTCAAGATTTACAAGGTCAACTTGAAAATAACGAAAGAGTAAAGAGATCTGCAAAG
AATGACAATTAATAATTAGAAGACAAGATTAACTAATTGACTCAAGAAAATGCTCGTTTA
ATTGATTAAATTCGTCTTAGAGATGAAGAAATTTCCAAGCTTAGAGTATAATACACTCAA
TTCTCTCAATATGAAATTAAGCTTTAAGAATGTGAAATTAACAATGCTCAACTCAGAAAG
AGAATTGAAGACCTTTACCAAGAAGGAGTAAAGAAGTCATAAAGAATCACTGAACTTGAA
TAAGCTCTTCGCGAAAGTGGAAGCTTATAAGAAAAGCTTCTTGCTGCCAATCAAGCCATC
GAAGCCCTCTAACGTAGAAATAGCTAACTTGAAAACGAATTAAATTAAGCTCGTTTGAGA
ATTAACGAATTAGAAAACTCCAGCAGAACTATTTAAGAACTCCAAATTCGTATTCAATCA
TTAATTGAATCTAACGAACGTCTCAACCAACTCGTCAATCAAAAGGAAGCTGAACTCCAA
AAATTAAGACTTGAAGTCAATCAATTAAATATCCGTATCACCTAAGTCGGTGCTAGCAGC
GAAGAACTTAACTTAAGAATTCGTGAAATTGAATAACTTAAATAGAGAATCAGAGAGCTT
GAACAACAACTTATCAATTTACGTACTTTTGAAAGCAGATATGCTGAATTAGAGTAAGTA
AACATTTAACTTCGTTAACAAATTGAAGTACTCTAAAGAGCTCTTTAAGACTTACAAAAC
TAAGTCAATGATGAAAAGGTCAAGAAATCAAGACAACAAAACAATCTTGATGATGCCATC
CGTGATAGAAAGTCTCTTGAAGAAAAGTTGGTACACTTGACTACTTAAGTTGACTTCATG
AACAGAAAGATCCAAGGCTTAGAATAAGAAAACGCTAATCTCCGTCAACGTAACTCTTAA
TTAGAATCTGCCAGTATCACTATCACTACATTGGAAGGAAGAATCGGTCAACTCACCCAA
ACCATTGAAAACCTTAACAGAATCATTGTTGAAAAGGACTAACAACTCAACAATATCCGT
TAAGAAAACAGCCAACTCCAAATCAACATCCGTCAATCTGGTGTTAACCAAGAAGAAGTT
CTCCGTCTCCGTCGTGAAATCGATGAATTAAAGAGACTCCTCCAAGAAAAGGAAACCATA
ATTATTCAACTCCGTCCTTACTAAGAAAAGCTTATTGAATGCGAAAAGAATAATGCTGAA
TTACGTATCCGCATTGAATAGGTAATCAACCAATACAATGATGAAAACGTTAAGAGATCT
CGTGTTAATGCTTCTGCTGAATAAGCTTAACGTGAAAAGGCTCTCCTTGAAAGCTAAATC
TCATAATTGAAAATCACCATTGAAAACTTAAGCAAAAACCAAATCTTGCAAGATTAGGAA
TTACAAAAGTTACGTTTAAGAAACTCTGAATTAGAAAATGTTACTAGATCTTCTGGTACT
TATGAAATTAAGATCACTGCTCTCTCTGAAGAAGTTAGCAAGCTCAGAGCCCTCTTAGCT
TAAAAGGACAATGAAATCAATCAACTCAGACTTGAAAATCAAAACCTTGCCCTTAGCACT
CGTCAATCTCAAGTCTTCTAACAAGAAGTTAATCGTTTACAAGAATCTGTTAACAGATTG
AGCAGAGAAAACGAAGAACTCAGATCTCGTATCCGTGAAATGGAAATCGTTATCTTATAA
CTTAAGTAGAGAGAATAAAGAATCAATGATCTTGAAAACGAAAATGCTCAACTCCGTAGA
AGAATCGAAGATTTACTCGGCTAAGTCAATGACGAAAAGGTTAAGAAGTCTGCTAAAGAT
AACAGATCTGAATAAGAATTAGCTGAACTCAGAGCCAAGCTTGCTGAATCTCAAAACAAC
AACCAAAAGCTCGTTTTTGAAAACACTCGTTTGAGCGAATAACTCTAACTCATTGCTAAG
GACAATGAAAAGCTTCGTCAAACCATTATTCAACTTGAATAAACTCTTGCTTCATACAAG
ACATTTGAACTTAAGGTACAACAATACGAAAGAACAATTGCTGAATTGAACTAGAGAGTC
TAAGAACTTATCACCTAAGTCACTGAAATTAATGATGACAGACTTAAGAAACAAAGAATT
ATTGCTGAAAATGAAGCCAAATTGAAATAATTCGACTTATTATAAGAAAGAAACAACCAA
CTCAATCAATAGATTGATCAACTCAACATTAGAATCAGACAATTGGAAAGCTAACTTGCT
CAATATGCCCAATTCAGCAACCTCGCTCAATAGAACGAATAACTTATTGCTAGAGTTAAA
ATATTGGAATAAGAAAACACTACATTAGTTCTTAAAATCAAGGAAATAAGCAGCTTATTC
TTGGAATGGAGTTCTACTTATTCTAAGATCCAAGGCTACAACCAATTAGTAGAACGTCTC
AATCAATCTATTTCTCAAATCTAAATTAGCTCTTCTTAAAGCATCGTTAGATACTCCACT
CAAGTTCCTAGAAACTGA


>TTHERM_00637010(protein)
MCMFMFMNGTFIKQLTRFFLFNGRAEKRLRNPSIKIKQKQIRKKSLLKKKQKKLEFSFRE
EQKNIKMQQTPQIISNSQVFNKNEFYQKGFLTQSQISQTPHGIHQVTTTEYPKDSTIVKL
ISSNAPGAVTQVSPSFQVQSRVRASNRHSTPPGHSRTIIRHSESPLRYVTESISPGRTTT
YQDRQIPVAAVVKEQIPLYIIEQQRQPVQIQERVVEVEKPIYIEKIVEIATDQTLQVQQL
SERIQLLEQTNQQLAQELELYKNQTPQQPQVIQVENNERIILLEREIERLQEEGEKRKKA
GRQNESEMLKANNDREEKIRELIAQIEQLHALLNEKQEQINSLNIRITQIQNNEVRQSDA
RSNDYMSKINTLTLEIERLTKQMKLSREQYDEDMQAKQAQILGLNSKLSEYENRFVFLNA
ELERLRNNQSDNVRINQLETRIRELEIIIQQKDGQLNDWRSKFAEMEKALTIYKQYESKL
YECENVNNQLRKKIEELMFEIDRLNNLVNQKESELQRLRLEVNSLTVNIRQSGVNQQEEI
NRLNALVQERNQQIQFLNQKVSAFEDRIREQEGLILQLQKTIQDLQGQLENNERVKRSAK
NDNQQLEDKINQLTQENARLIDQIRLRDEEISKLRVQYTQFSQYEIKLQECEINNAQLRK
RIEDLYQEGVKKSQRITELEQALRESGSLQEKLLAANQAIEALQRRNSQLENELNQARLR
INELENSSRTIQELQIRIQSLIESNERLNQLVNQKEAELQKLRLEVNQLNIRITQVGASS
EELNLRIREIEQLKQRIRELEQQLINLRTFESRYAELEQVNIQLRQQIEVLQRALQDLQN
QVNDEKVKKSRQQNNLDDAIRDRKSLEEKLVHLTTQVDFMNRKIQGLEQENANLRQRNSQ
LESASITITTLEGRIGQLTQTIENLNRIIVEKDQQLNNIRQENSQLQINIRQSGVNQEEV
LRLRREIDELKRLLQEKETIIIQLRPYQEKLIECEKNNAELRIRIEQVINQYNDENVKRS
RVNASAEQAQREKALLESQISQLKITIENLSKNQILQDQELQKLRLRNSELENVTRSSGT
YEIKITALSEEVSKLRALLAQKDNEINQLRLENQNLALSTRQSQVFQQEVNRLQESVNRL
SRENEELRSRIREMEIVILQLKQREQRINDLENENAQLRRRIEDLLGQVNDEKVKKSAKD
NRSEQELAELRAKLAESQNNNQKLVFENTRLSEQLQLIAKDNEKLRQTIIQLEQTLASYK
TFELKVQQYERTIAELNQRVQELITQVTEINDDRLKKQRIIAENEAKLKQFDLLQERNNQ
LNQQIDQLNIRIRQLESQLAQYAQFSNLAQQNEQLIARVKILEQENTTLVLKIKEISSLF
LEWSSTYSKIQGYNQLVERLNQSISQIQISSSQSIVRYSTQVPRN


>TTHERM_00637010(gene)
ATGTGTATGTTTATGTTTATGAATGGCACTTTTATTAAGTAATTAACTAGATTCTTTTTA
TTTAATGGAAGAGCGGAGAAAAGGCTTAGAAACCCAAGCATTAAAATAAAATAAAAATAA
ATAAGAAAAAAATCTTTACTGAAAAAAAAGTAAAAAAAACTTGAATTTAGTTTCAGAGAA
GAATAAAAAAATATAAAGATGCAACAAACTCCTCAAATAATCAGTAACTCATAAGTCTTT
AACAAGAATGAGTTTTACCAAAAAGGATTTTTAACTCAATCTTAAATTAGTTAAACTCCC
CATGGTATTCATTAGGTTACTACCACTGAATATCCTAAGGATTCCACCATTGTTAAATTG
ATTTCATCCAATGCTCCTGGTGCAGTCACCCAAGTTAGTCCTAGCTTCCAAGTTTAAAGC
AGAGTCCGTGCTAGCAACAGACACTCAACTCCTCCTGGACATTCTAGAACCATCATTCGT
CATAGCGAATCCCCTCTTAGATATGTCACTGAATCCATTTCTCCTGGTCGTACCACCACT
TATCAAGATAGATAGATTCCTGTTGCTGCCGTCGTCAAAGAATAGATTCCTCTCTATATC
ATCGAATAACAAAGATAGCCAGTTCAAATCCAAGAAAGAGTTGTTGAAGTTGAAAAGCCT
ATCTATATTGAGAAGATAGTCGAAATAGCTACTGACTAAACCCTCTAAGTCCAATAATTG
AGTGAAAGAATCCAATTGTAAATATTTCTTATTTATTCTAGTTTTTTATATTTTCTATTG
CTTTTATATCAATTAACAAATGAGAGGTGACTGGTTCATCAATCCAAGATTGATTAAATT
TTATTTTTGCAATAAAAACGGTGAATTAATCTAATATTAATCACTTTATTGTTATCCCAT
CAAAAATTTATTTTAAGCTGCAAGTATGTATGTATTAATGACTTAACTTGCTTAATAACA
AATAGCATATAGAGGAGTCAGTCCATCCATCAATAATTTTATTTTCTTTTAATAAACTTT
AATTGATCATTTTCTTTATTAATGCAAATTAGATTAGAATAAACTAACTAGTAACTCGCT
TAAGAACTTGAACTTTATAAAAACCAAACACCACAATAACCTCAAGTTATCCAAGTAGAA
AATAACGAAAGAATTATTTTATTAGAAAGAGAAATCGAACGTTTACAAGAAGAAGGCGAA
AAAAGAAAGAAGGCTGGCAGATAGAATGAGAGTGAAATGTTAAAAGCTAACAATGACCGT
GAAGAAAAGATTAGAGAACTCATAGCTCAAATTGAATAATTACACGCTCTCTTGAACGAA
AAGTAAGAATAAATTAATAGCCTCAACATCAGAATCACCCAAATCCAAAACAATGAAGTT
CGTCAAAGCGATGCTCGTTCTAACGATTACATGTCAAAGATTAACACTCTTACTTTAGAA
ATCGAAAGACTCACCAAGCAAATGAAGTAAATTATTAAGCAAACTATATTATAACAAACT
TATACTTCTTGTCTCTCTCACTCACTATTTTCTACTCTCCTTCTTTATAGAATAATAATA
GCCAAAGTAGAAAAAGTGATGATAGAAAATAAGTTTAATTAAATTTGACAAAGCAAATAA
AAAAATAAATGCTTGAATATTTAATTTATTAAGTATATTACAAATAAATAAACTAACTGA
CTTGCTTTTATTATCAATTAATAGATTAAGCCGTGAGTAATACGATGAAGATATGTAAGC
CAAGCAAGCTTAGATTCTCGGTCTTAATAGCAAGCTTTCGGAATACGAAAATAGATTTGT
CTTCCTTAATGCCGAGTTAGAAAGACTTAGAAACAATCAAAGCGACAACGTCAGAATTAA
CTAATTGGAAACCAGAATTAGAGAATTAGAAATTATCATCTAACAAAAGGATGGCTAACT
CAATGATTGGAGATCCAAGTTCGCTGAAATGGAAAAGGCATTGACCATTTATAAGCAATA
CGAAAGCAAGCTTTATGAATGTGAAAACGTCAATAACTAACTCAGAAAAAAGATTGAAGA
ACTCATGTTTGAAATCGATAGATTAAATAACTTAGTCAACCAAAAGGAAAGCGAACTCCA
ACGTTTGAGACTTGAAGTCAACAGCTTGACTGTCAACATCAGATAATCTGGAGTTAACTA
ATAAGAAGAAATTAACAGATTAAATGCCCTCGTCTAAGAGCGTAACTAATAAATCCAATT
CTTAAACCAAAAGGTTTCTGCTTTTGAAGATAGAATTCGTGAACAAGAAGGTCTCATCCT
TTAATTATAAAAAACCATTCAAGATTTACAAGGTCAACTTGAAAATAACGAAAGAGTAAA
GAGATCTGCAAAGAATGACAATTAATAATTAGAAGACAAGATTAACTAATTGACTCAAGA
AAATGCTCGTTTAATTGATTAAATTCGTCTTAGAGATGAAGAAATTTCCAAGCTTAGAGT
ATAATACACTCAATTCTCTCAATATGAAATTAAGCTTTAAGAATGTGAAATTAACAATGC
TCAACTCAGAAAGAGAATTGAAGACCTTTACCAAGAAGGAGTAAAGAAGTCATAAAGAAT
CACTGAACTTGAATAAGCTCTTCGCGAAAGTGGAAGCTTATAAGAAAAGCTTCTTGCTGC
CAATCAAGCCATCGAAGCCCTCTAACGTAGAAATAGCTAACTTGAAAACGAATTAAATTA
AGCTCGTTTGAGAATTAACGAATTAGAAAACTCCAGCAGAACTATTTAAGAACTCCAAAT
TCGTATTCAATCATTAATTGAATCTAACGAACGTCTCAACCAACTCGTCAATCAAAAGGA
AGCTGAACTCCAAAAATTAAGACTTGAAGTCAATCAATTAAATATCCGTATCACCTAAGT
CGGTGCTAGCAGCGAAGAACTTAACTTAAGAATTCGTGAAATTGAATAACTTAAATAGAG
AATCAGAGAGCTTGAACAACAACTTATCAATTTACGTACTTTTGAAAGCAGATATGCTGA
ATTAGAGTAAGTAAACATTTAACTTCGTTAACAAATTGAAGTACTCTAAAGAGCTCTTTA
AGACTTACAAAACTAAGTCAATGATGAAAAGGTCAAGAAATCAAGACAACAAAACAATCT
TGATGATGCCATCCGTGATAGAAAGTCTCTTGAAGAAAAGTTGGTACACTTGACTACTTA
AGTTGACTTCATGAACAGAAAGATCCAAGGCTTAGAATAAGAAAACGCTAATCTCCGTCA
ACGTAACTCTTAATTAGAATCTGCCAGTATCACTATCACTACATTGGAAGGAAGAATCGG
TCAACTCACCCAAACCATTGAAAACCTTAACAGAATCATTGTTGAAAAGGACTAACAACT
CAACAATATCCGTTAAGAAAACAGCCAACTCCAAATCAACATCCGTCAATCTGGTGTTAA
CCAAGAAGAAGTTCTCCGTCTCCGTCGTGAAATCGATGAATTAAAGAGACTCCTCCAAGA
AAAGGAAACCATAATTATTCAACTCCGTCCTTACTAAGAAAAGCTTATTGAATGCGAAAA
GAATAATGCTGAATTACGTATCCGCATTGAATAGGTAATCAACCAATACAATGATGAAAA
CGTTAAGAGATCTCGTGTTAATGCTTCTGCTGAATAAGCTTAACGTGAAAAGGCTCTCCT
TGAAAGCTAAATCTCATAATTGAAAATCACCATTGAAAACTTAAGCAAAAACCAAATCTT
GCAAGATTAGGAATTACAAAAGTTACGTTTAAGAAACTCTGAATTAGAAAATGTTACTAG
ATCTTCTGGTACTTATGAAATTAAGATCACTGCTCTCTCTGAAGAAGTTAGCAAGCTCAG
AGCCCTCTTAGCTTAAAAGGACAATGAAATCAATCAACTCAGACTTGAAAATCAAAACCT
TGCCCTTAGCACTCGTCAATCTCAAGTCTTCTAACAAGAAGTTAATCGTTTACAAGAATC
TGTTAACAGATTGAGCAGAGAAAACGAAGAACTCAGATCTCGTATCCGTGAAATGGAAAT
CGTTATCTTATAACTTAAGTAGAGAGAATAAAGAATCAATGATCTTGAAAACGAAAATGC
TCAACTCCGTAGAAGAATCGAAGATTTACTCGGCTAAGTCAATGACGAAAAGGTTAAGAA
GTCTGCTAAAGATAACAGATCTGAATAAGAATTAGCTGAACTCAGAGCCAAGCTTGCTGA
ATCTCAAAACAACAACCAAAAGCTCGTTTTTGAAAACACTCGTTTGAGCGAATAACTCTA
ACTCATTGCTAAGGACAATGAAAAGCTTCGTCAAACCATTATTCAACTTGAATAAACTCT
TGCTTCATACAAGACATTTGAACTTAAGGTACAACAATACGAAAGAACAATTGCTGAATT
GAACTAGAGAGTCTAAGAACTTATCACCTAAGTCACTGAAATTAATGATGACAGACTTAA
GAAACAAAGAATTATTGCTGAAAATGAAGCCAAATTGAAATAATTCGACTTATTATAAGA
AAGAAACAACCAACTCAATCAATAGATTGATCAACTCAACATTAGAATCAGACAGTAAAA
CTTAATTTTGCAAATTATAATATAAATATTTAATGAATTTTTTTAATAAAAATAGATTGG
AAAGCTAACTTGCTCAATATGCCCAATTCAGCAACCTCGCTCAATAGAACGAATAACTTA
TTGCTAGAGTTAAAATGTAATAATTTAATAAATTTTTTTTGTTTTGTTTATTAAAATAAT
ATTTTAAAATATAGATTGGAATAAGAAAACACTACATTAGTTCTTAAAATCAAGGAAATA
AGCAGCTTATTCTTGGAATGGAGTTCTACTTATTCTAAGATCCAAGGCTACAACCAATTA
GTAGAACGTCTCAATCAATCTATTTCTCAAATCTAAATTAGCTCTTCTTAAAGCATCGTT
AGATACTCCACTCAAGTTCCTAGAAACTGA