Identifiers and Description

Gene Model Identifier

TTHERM_00578520

Standard Name

EPA1 (EPiplasmin A1; the major protein component of the membrane skeleton (epiplasm); influences cell shap)

Aliases

PreTt05745 | 78.m00117 | 3733.m00012

Description

Viral A-type inclusion protein repeat containing protein; EPA1 Epiplasmin A; the major protein component of the membrane skeleton (epiplasm); influences cell shape and the fidelity of cortical development

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF07620 ) SLEI
  • ( PF02524 ) KID repeat
  • ( PF00261 ) Tropomyosin
  • ( PF01576 ) Myosin tail
  • ( PF08912 ) Rho Binding
  • ( PF03148 ) Tektin family
  • ( PF05227 ) CHASE3 domain
  • ( PF00435 ) Spectrin repeat
  • ( PF02370 ) M protein repeat
  • ( PF06008 ) Laminin Domain I
  • ( PF00904 ) Involucrin repeat
  • ( PF01920 ) Prefoldin subunit
  • ( PF02996 ) Prefoldin subunit
  • ( TIGR01612 ) rhoptry protein
  • ( PF07989 ) Spindle associated
  • ( PF01540 ) Adhesin lipoprotein
  • ( TIGR01257 ) rim ABC transporter
  • ( PF06780 ) Erp protein C-terminus
  • ( PF00170 ) bZIP transcription factor
  • ( PF04702 ) Vicilin N terminal region
  • ( PF07926 ) TPR/MLP1/MLP2-like protein
  • ( PF08657 ) DASH complex subunit Spc34
  • ( TIGR00293 ) prefoldin, alpha subunit
  • ( PF00447 ) HSF-type DNA-binding domain
  • ( PF08580 ) Yeast cortical protein KAR9
  • ( PF00038 ) Intermediate filament protein
  • ( PF01442 ) Apolipoprotein A1/A4/E family
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( PF04849 ) HAP1 N-terminal conserved region
  • ( PF05377 ) Flagella accessory protein C (FlaC)
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF06435 ) Repeat of unknown function (DUF1079)
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( PF07195 ) Flagellar hook-associated protein 2 C-terminus
  • ( PF09006 ) Lung surfactant protein D coiled-coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 69.8%

TetraMine Data

TTHERM_00578520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16283.19.997093137033517e-262viral A-type inclusion protein
repeat containing protein (25
60 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00578520(coding)
ATGAATTAGCTAATATTTATTATGTTAGTGTGGTTGATAATTTCATAGAGTTTTGAATAA
TATTGGGTAAGGAGAAAGATATCTTTTAAAAGTAATAATTTTTTATTTATAAATAAATAA
AAAGAAAATAAATCATAAAATAAGAAAACCTTAAATAAAAAGATTGAAAAAGGAAAAAGG
TTTATTACGATCGTTGTAGAGAAACAATACATAATAAAAAACCAAATGAATCAACAATCA
TAATTTTTAACTCAGTCTAGGCAAACTCCCACTAGAAGTGTTAATGTTCGTTCTCCTTCA
AAAAGTGGAATCAAGTCACCCACTTATCGCGGAGACTATGCCTAAACACGCAATTTACCC
TCAACTAATCCCATTCGCGCTCCCACTCCAGATTTGATGCCCCGTCATGAACGTATTTCT
TCCACTGCTGTTCCCAACGGACTTAGATTTACTACAAAGAAAAAATAAAACCTTTCTGTA
TCTCCTCAAAGAGGTGGTTTCAGAGACGTTGATGAAATTACTGAGCAATTCAATAGAATC
CTTAAAGAAAAGAATGATTAGATTGATTAGTTGAAGAGATAACTTAACGACCCTGAAGAA
AATGTTAAGAGAGCTGCAAATAGAGGTGGACCAAGTGAAAACGATGTATCCGAGTTAATT
TAGTAGCTCTAAAACTTAAATGTTGAATTAACTAAATCCAGATAGAATGAAATTAGACTC
AGTGCTATGGTTTAGAACTATGAAAATTAAATCAACAAGTTAAGTGATGCCAACTTGAAA
CTCTCACAAGAATTAAAAGAAGTTGGTGAGTAAAACCAATACCTCGTATCTCAACTTTAA
GGCTAAAACCCAGAAAGCAGAATCAGAGAAATATAAATCAAGCACGCTGAAGAACTTAAT
AAATTACACGCCTAATTAAGAGAAGCTTAATTAAATGCTGAAAGAAACTAAAATGATTAA
ATCAACTAATTGAGAAAGCAAAATCAAGAATTAGTCAACGAAATCGAAAGATTGACTAGC
TTGATCAAGACTCTCTAGCAAGAATTATCTGCTAAGGGTGATACCACCTAGTTGAATATC
ATCATTTAGTAGAGAAACTAAGAGTTAGATAATTGGAAGAACAAGTACAACCTTCTTGCT
GAAGAAAGAGCTAGAATGGAAGAAAAGATTGTTCAAGCCTAAACTGAAATTATGCGTCTT
GAAAAGTAAGTTGAAATTTGGAAAGATCACTGCAACAAGATTCAATAATCTCATCCTAAC
TAAGACTAAAGAATCTAAGAATTACAAAACAAGATTGCTGATTACGAGTCAAAGATCAAC
TAACTTGCTATCGACAATCAAAGATTAAACTAATTAATCTAGATTAAGGATGAAGAAGCT
GATAAAATCAAAAGAGCTTCCAGACAAAGCAATGTCGATTAACGTACTTATGATTCTCTT
TAAAATGAAAATTACTAATTGAAGAACGATCTTTCTTCTAAGGAATTATTGATTGTCTAG
TTGAATCAAAGAATCAGAGACTTTGAAGGCAACGGTTAGAAGACCACTCAAGAATTAACT
CAAAAGATCTTCATTTTAACTAATGAATTAGATAATGTCACTTCCCACTTGAAGGCTCGT
AACTAAGAATACGAAGACTTGTCTAAGAGATACAACTAATTACTCTAACAAACCAACTAA
ATGACCCAATCTGGTGAATTCAAATATCAAGAACAACTCAGCAAGTCTATTTAATTAGGT
CAAGAAGTTGAAAAATTAGCTGCTCTAACCAGAGCTTAAGCTGATGAAATTAAAGACTGG
AGAAATAAGTATGCTGATTTGGAATCTAGATACAACTAATAGATCATCCTTATTAGCTAA
CAAACCAACTAGGAAGTTTATAGAAGACAAATCTAAGACTTAGAAGATTAACTTAGAAGA
AAGACTGCAGAAGCCAATGAATGGTAATAGAGTTTCACCAATCTCTAGGCTCAAAAGGAA
AGAGAACTCAAGAACCTCATGGAAACCTTGAAAGATGAAATTAGAAAATCAAGCTCTAGC
TTAAATCTTTAAAACGACTACAATAAGCTCAAGGACCAAGTTTAATTATTAACCCACTAA
ATCGAACAACTCAATAAGATTAGTATCGAAAAGGACAATGAAATTCGTCTTTTGAGAAAC
TAGGCTGGTAACGATGCTTTATACAGAGAAAAGATTATTAATATGGAAAACAAACTTGTT
CAACTCACTTCTGAATTATAAAACTAGATCAATTTGAACTAAATCAAGGAAAGTGAAATC
GTTTCTTTGAAGCGTTAATTGGAAGAAGCACGTGGCAGATACAGTGCTGACATTGAAACT
TAATTGATTCAACTAAGATCATAAGTTACCACTTTACAACAATTATTACAATAAAAGGAT
GAAATCATTAATGATTTACAAAGAAAGCTTGCTGAGCACGAAGATCCCGTCAAGAGATCC
AAGAAAGATAATGAAACTTAAAGATTACTCAACTAGATCCAAGAACTTACTTTTGATAAC
CAAAGATTAACTAAATTGAACAATGAATAAGCAGTTACTATTGACTAACTCAGAAGAGAT
CTTATCAATTTACAATAACAATCATAGAATGTTGTTGAACAAAATAGAAAAATTGAAGCT
CTTCTTTATTAGATCGAAGTTCTTGAAAAGTAACTCAGAGCTGTCGCTGAAGAAAGAGAC
AACCTTAAGAGATAATTGTTAGAAACCGAAACTCTCAGACAAAAACTCAAGGAATAAGAA
GCTCGTGAACTCTACTTGTAAGAATAAATTCGTAATTTGGTTGCTTAATTAGAAAATGCT
TAAACTGAAAATGTCAAGAGAGCAGGAAAGGAAAGCCAAATTAACCAATAACAAGTCCGC
ATCAACGAATTAGAAAATTTGATTTAAGTCCTCAGAGGAGAAATCGAAAAGCTTAACAAT
ATTATTCGTATGAAGGATTAAGATTTAGATTCTCTCAAGAGAGAATCTAACAGAAAGAGT
GTTGTTGATGCCGAGAAACAATAGCTCGAAAATAAGATTCTCTTATTAGCTAGTGAAATT
GATAGATTATCTAGATCTCTTCAAGACAAGCACGAAGAAGTCAATCGTTTGAAATCTATT
ATTATTGAGAAGGATAGCTAACTCTAGTCTCTTCCTCAATTACAAAGCAGAATTGCTCTC
TTGTAAGATGAAAATAATAGATTGAATGCTCAAATCAAGCTCTTAACTGAAGAAAACATC
AGAAAGCTCACTGATGAAAACATTTAACTCCGTTAACGCTTAAATGAAATGGCTGACTTT
GAAAGACAAAAGAATGAACTTGAAAACAAAATTTAATTATTGATTTCCGAACGTGAACGC
TTAAATGGTATCATCACCACCATGACTTAAGAAAAGCTTTCCCTTCAAGCTCAATTGAAT
GACTATGCTCAAGGTGACCGCATCAGAAAAGAACTTGAATACCAAATCGAATCTTTGAAG
AGAGACAAGCAAAGATTAGAAGAAGGTCTTACTAACTTGGCCAATGAAAACAATGAATTG
AGATCTCGTCTTTAACAATTAGGTGATATGGATAGAGTCAGAGGTGAATTAGAAAATAAG
ATCAATCTTTTGATTCAAGAAAATGATAGACTCCGTGCTGCTTTGGCTGCTAAGAATGAA
GAAAACACTAAATTAATTTTGAAGATTAACGATTTATCCAACTTAGAAAAGCTTAGAGCT
GATCTTGAAGGAAGAATTAAGATCTACGGAGAAGAAAACCAAAGACTTAATGATATTATC
AGACGTTTAACTGAAGATAATACTAGCTTGTAGACTCGTATTGCTTAATTAAGCAATATC
GAACAAGTCCGTATCACTTTAGAAGGCTAGATCAACTTGTTAGTTGCAGAAAATAAGCGT
TTGAATGATTTAGTCCGTGCTAAGGATGAAGAACTTGTCTAGATTCGTGACATCAAGACT
AGATTCGAATTATTCTAATTGAGAAACATCGATGCCTTAGCTAGATTGACTATCACTATG
GCTGAATTAGAAAGAGTTTCTGCTTAAAGTGTTGAAAAGACTAATAAGATTATTCAATTA
GAATAGCGTTTGAGAGACAACACATTAGAATATTAAAACCAAGCTTTATAACAAAAGGTT
AATCTTTTAACTGAATAAATCGAACGTTTAGTTAGAGAATTAGAAAATGCTCGTAACGAA
TTAATCTAGGTCTCTAGAAAGTGCCAAAGCTTAGAAATCGAAAAGCAAACTTGGGATGCT
CAAAGAGCTCAATATGAATAAACAATTGCTTAATTGCATGCTGAAATTTAACGTTTAAGA
GAACAAGCTGATGAAGGTGAAAAAGTCAAGAGAAGTAAACAAAACTAAGATAACAGAGTT
GCTCAATTAGAAGCTGAAAATAAGTATTTATAAGACCAACTTGAAAAGTTAAGAAATGAT
AACAACCAACTTCTTTAACAAGTCAGCTAACTCACATTAACTCTTCAATAATTACAAGCT
AAATTAAATGACAACACTTTATAAATTTAAAACTAAGAACTTCAAAATAGACTCAATGCC
AAGACTGCTGAGCTTGAAAGAGTTGCTCAAGAACTCTAACGTCTTAGCTAATTAATCAAT
GAATTAACTTTAGAAGTTAACAGACTTAAATCTGAAAATGCTGGATTTGAAGTTACCAAG
AGAGCTCTTGAAGGCAGAATCTAAGAACTCGCTTCTAGATTGGAAATGTTGACTGGTGAA
ATCAATAGACTTAACTAACTCAATGGTGAATTATCTTACAAGCTTTCTTCTTCTGCCACT
ATCAACGAAAGATATGCTAGACTTTCTGATGCCTATGTCCTCTAATGCGCTTTATCTGAA
TCATTGTCCAAAAAGGTTTCTGACCTTATTGGTTTCCAAAACGAAGCAGATGAACATAGA
AAGAGAGCTTAACGTCAAAGTTAAGATAACGAAGCTCTTATTCAAAGAATTAACTAACTT
GAACAATTATTGGCTGAAAAAGATAGAGAATTACAAAACTTAAAGGTAGCCAGCTAAAAT
GTTAGCATCCTTCAAATGTAACTCCAATAATCTAACCAAGATAAAGAAAATTTAATTAAG
AGAATCAGAGAATTAGAAAATATTCTTGGAGAAAGGGATAAAGAAATTGCAGGTTTGAGA
AATGCAAACAGTTAAGTCAACCTCCTTCAAATTCAAATTTAATAATACGAAAACTAAATT
AACGACTTGAAGCGCAGACATGCTGATGAACTCGAAAATGTAAAGAGATAATACGAAGGT
CTTCGTCAATCTACTGTCAATAGAGAAATCAATGAGCTCACAGTTAAGTTCAACATTCGT
ATCCAAGAACTTGAAAGAGAAATCCAAAAATACAAATCTCTCTCAGAATAATATGAAAAT
GAATTACGTGCTCAACGTCAATAAAACTCTGAACTTCTCCAACGTTTGGTTGATGCTGAA
AACCGTGCTCGCGATTCTGATGAATAAGTCAAACGCTCTAGAGCTGGTCAATAATAGGTC
AATAATTTGGAAGAAAATCTCAGATTCGTAACTGCTGAATTAGAAAAGTAGAAGAACCTT
TTAGCTGAAGAAAAGAATAAGAATGCCTAACTTGAAAGTCAAAAATCTATTTTAGCTATG
GAAATCGAACGTCTTAACACCATCTTGAAAGAAAAGCTCATTTTAATCGAAGACTTCTAA
CGTCGTGAAGCTGAATATGAAAACTAATTGAGAGAATTGCAAGCTAGACTTGCCTCTGTT
GCTGAATTAGAAAGCAAACTCCAATTCTTCAACAACTAAATCTAGACATTGAACTTCAGC
TTGGAGTAAAAGGAAAAGGAAAAGCAAGCACTTGGTCAACATTTAGTTGAACTTCAACAA
ACTATTGAATAATTAAGAGCTGAAAATACTTAAGTTGCTGCTTTCAAATACTAAGTTGAA
AATCTCTCACGTGAAAACGAAGCATTAAAATAACGTCTTGTTGAACAATAACAAACTATC
GACAAGTTAAGAGCTGAAGCTTCATAATTCGCTTCTCTTAAGTTCTAAGCTGAAAACTTA
TAACGTGAAAATGAAGCTTTGAAACAACGTCTCGTTGAACTCTAACAAACTGTTGATAAA
CTAAGAGCAGAAGCTGCTTAATTCGGAAGTCTTTAATACTAAGTTGAAAATCTCACTCGT
GAAAATGAAGCATTAAAGCAACGTTTGGCCTAAACAGCAGAAACTCTTAGCTAATAAGTA
GCTCAAAACAGCGAACTTTAAAGAAGAGTTCAATAACTAGAAAGCGAACTCCAATTACTC
AAGATGTAATTAGAAGGTGAACGTGAAGATAACAAGGTCAAGAGAAGCAGAAACGATAAG
AATAATGAAGATCTCTAAAAGGTCATCCAACAACTCCAATAAGAAATTGAAAATTTAAGA
AGAGAAATTTAAGCTCGTGATTAGAAGATTGCTGAACTCTCAAATGCAAGCTACACCATT
CAAATACTCCAACATGAAAAGGAAGATTTGATCAGAAAGTTAGATGCTATTAGTTAGGTA
TATGCCAAATCTTAGACTGATCTCTAAAACAGTCTCCAAAAGGTTGTTGTCCTTTCAGCT
CGTGTTGAAAGCTCTGATGAAGCAAACAAGAATCTTACTGCCTAAGTTCAAATTCTTTCT
CAATCTTTACAAAATAAGGATTAAGAATTAAGAAACTTGATGATTGCTTACTAAGAACTC
CAAGTTAAATTTGGTCAAGAATAAGAAAATTCTCGTCGTAGCTCTTCAATGGCTTCTTCC
AAGTTCATTCAAGAAAGAGTTTAATTGGAAGCTGAAATTAACAGACTTAAAAACGAATTA
GCTATCATCGAACACAAGCATAACCTCACAATTGAAGAAATCAAGCGTTAGATGGAAGTA
TAGCTTTCTGAAGAACTCAGAAAGTAACTTGCTGCTGCCAAGGCTGAATATGAAAGAAGA
TTAAACGATGCCCTCAACGCTCAACAACAATAATACGAAGATGACCGTGTCAAGAGATCT
AAATAACAACAAAAGGAAAATGATGATCTTAAGAACTAACTCTAATTAACTATATAAATG
CAACTTGAATAACAACTTGCTGAAGTTAAGGCTAGAATGGAAGCTGAAAGAAGAAGACTT
GAAGAAGAAAATGCCATGCTCAGAGCCAGAGTTTAATAATTAGAAGACTAATTGTAACAT
GCTTTGGTTAACGAAGAAGAAATCTTAAAATTCAAGGACTTGATCCAATAACTTCAAATG
CAAAAACTTAAGGATATCTCTGAACTCTAACAAAAATTAGAAGAATACAGAAGCTTACAC
GTCAATGCTGGTGGTTCTCTTCAAGATGCAATCAAGACATCCTTCCAAACTGAAATTCAA
TAACTCAGAGACAAGGTCCAATAACTCAACTAGATTCTCGAAGTCAAGAGCAAGGAAAAT
AACGAGCTCTAAAGTGCTAACCTCAACCTCATGAGAGAAAGATCAGAAATAAAGAAATCT
ATGACATCATCCAACTCTAACATTCAATTCACCATGGAAATTGAATCTCTCAAGAGATAA
CTTATTCAATCTAATGATAGAACTTAAGAATATGAAGCCAGAATTAAATCTTATGAAGGT
AAACTCAATCAATATGAATTACAACTTTCTTAAGTTGTTAATGAACTCAAGCAAACTCAA
GATATCCTCAATATTAAGAAGATGGAAAGAGACAATGCTTTCAATCAAATGGATTAACTT
AAGAGCTAGACCCTCAGCATGTCACAAGCTTTATCTCAAGGAAGCAACGATGTTGATCTT
TAAAATATTGTTTTCTTAAAGAAGGAAATTGAGAATTTAACTGTTGAAAAAGAAATGTAT
AAGTCCTAATCAGAAAAGAACTATGCTGAACTCAATAGAAAGAACGAAGAATTGGTTAGA
AAGATTGAAGAATTAAATAACGTCAAGCTCCAATATCAATAAAATAATAACAAGATCTAT
GCCCTTGAAAAGGAACTTCTCAAAAAACTTGAAACTGAAGAAATCCATATCATGTGA


>TTHERM_00578520(protein)
MNQLIFIMLVWLIISQSFEQYWVRRKISFKSNNFLFINKQKENKSQNKKTLNKKIEKGKR
FITIVVEKQYIIKNQMNQQSQFLTQSRQTPTRSVNVRSPSKSGIKSPTYRGDYAQTRNLP
STNPIRAPTPDLMPRHERISSTAVPNGLRFTTKKKQNLSVSPQRGGFRDVDEITEQFNRI
LKEKNDQIDQLKRQLNDPEENVKRAANRGGPSENDVSELIQQLQNLNVELTKSRQNEIRL
SAMVQNYENQINKLSDANLKLSQELKEVGEQNQYLVSQLQGQNPESRIREIQIKHAEELN
KLHAQLREAQLNAERNQNDQINQLRKQNQELVNEIERLTSLIKTLQQELSAKGDTTQLNI
IIQQRNQELDNWKNKYNLLAEERARMEEKIVQAQTEIMRLEKQVEIWKDHCNKIQQSHPN
QDQRIQELQNKIADYESKINQLAIDNQRLNQLIQIKDEEADKIKRASRQSNVDQRTYDSL
QNENYQLKNDLSSKELLIVQLNQRIRDFEGNGQKTTQELTQKIFILTNELDNVTSHLKAR
NQEYEDLSKRYNQLLQQTNQMTQSGEFKYQEQLSKSIQLGQEVEKLAALTRAQADEIKDW
RNKYADLESRYNQQIILISQQTNQEVYRRQIQDLEDQLRRKTAEANEWQQSFTNLQAQKE
RELKNLMETLKDEIRKSSSSLNLQNDYNKLKDQVQLLTHQIEQLNKISIEKDNEIRLLRN
QAGNDALYREKIINMENKLVQLTSELQNQINLNQIKESEIVSLKRQLEEARGRYSADIET
QLIQLRSQVTTLQQLLQQKDEIINDLQRKLAEHEDPVKRSKKDNETQRLLNQIQELTFDN
QRLTKLNNEQAVTIDQLRRDLINLQQQSQNVVEQNRKIEALLYQIEVLEKQLRAVAEERD
NLKRQLLETETLRQKLKEQEARELYLQEQIRNLVAQLENAQTENVKRAGKESQINQQQVR
INELENLIQVLRGEIEKLNNIIRMKDQDLDSLKRESNRKSVVDAEKQQLENKILLLASEI
DRLSRSLQDKHEEVNRLKSIIIEKDSQLQSLPQLQSRIALLQDENNRLNAQIKLLTEENI
RKLTDENIQLRQRLNEMADFERQKNELENKIQLLISERERLNGIITTMTQEKLSLQAQLN
DYAQGDRIRKELEYQIESLKRDKQRLEEGLTNLANENNELRSRLQQLGDMDRVRGELENK
INLLIQENDRLRAALAAKNEENTKLILKINDLSNLEKLRADLEGRIKIYGEENQRLNDII
RRLTEDNTSLQTRIAQLSNIEQVRITLEGQINLLVAENKRLNDLVRAKDEELVQIRDIKT
RFELFQLRNIDALARLTITMAELERVSAQSVEKTNKIIQLEQRLRDNTLEYQNQALQQKV
NLLTEQIERLVRELENARNELIQVSRKCQSLEIEKQTWDAQRAQYEQTIAQLHAEIQRLR
EQADEGEKVKRSKQNQDNRVAQLEAENKYLQDQLEKLRNDNNQLLQQVSQLTLTLQQLQA
KLNDNTLQIQNQELQNRLNAKTAELERVAQELQRLSQLINELTLEVNRLKSENAGFEVTK
RALEGRIQELASRLEMLTGEINRLNQLNGELSYKLSSSATINERYARLSDAYVLQCALSE
SLSKKVSDLIGFQNEADEHRKRAQRQSQDNEALIQRINQLEQLLAEKDRELQNLKVASQN
VSILQMQLQQSNQDKENLIKRIRELENILGERDKEIAGLRNANSQVNLLQIQIQQYENQI
NDLKRRHADELENVKRQYEGLRQSTVNREINELTVKFNIRIQELEREIQKYKSLSEQYEN
ELRAQRQQNSELLQRLVDAENRARDSDEQVKRSRAGQQQVNNLEENLRFVTAELEKQKNL
LAEEKNKNAQLESQKSILAMEIERLNTILKEKLILIEDFQRREAEYENQLRELQARLASV
AELESKLQFFNNQIQTLNFSLEQKEKEKQALGQHLVELQQTIEQLRAENTQVAAFKYQVE
NLSRENEALKQRLVEQQQTIDKLRAEASQFASLKFQAENLQRENEALKQRLVELQQTVDK
LRAEAAQFGSLQYQVENLTRENEALKQRLAQTAETLSQQVAQNSELQRRVQQLESELQLL
KMQLEGEREDNKVKRSRNDKNNEDLQKVIQQLQQEIENLRREIQARDQKIAELSNASYTI
QILQHEKEDLIRKLDAISQVYAKSQTDLQNSLQKVVVLSARVESSDEANKNLTAQVQILS
QSLQNKDQELRNLMIAYQELQVKFGQEQENSRRSSSMASSKFIQERVQLEAEINRLKNEL
AIIEHKHNLTIEEIKRQMEVQLSEELRKQLAAAKAEYERRLNDALNAQQQQYEDDRVKRS
KQQQKENDDLKNQLQLTIQMQLEQQLAEVKARMEAERRRLEEENAMLRARVQQLEDQLQH
ALVNEEEILKFKDLIQQLQMQKLKDISELQQKLEEYRSLHVNAGGSLQDAIKTSFQTEIQ
QLRDKVQQLNQILEVKSKENNELQSANLNLMRERSEIKKSMTSSNSNIQFTMEIESLKRQ
LIQSNDRTQEYEARIKSYEGKLNQYELQLSQVVNELKQTQDILNIKKMERDNAFNQMDQL
KSQTLSMSQALSQGSNDVDLQNIVFLKKEIENLTVEKEMYKSQSEKNYAELNRKNEELVR
KIEELNNVKLQYQQNNNKIYALEKELLKKLETEEIHIM


>TTHERM_00578520(gene)
ATGAATTAGCTAATATTTATTATGTTAGTGTGGTTGATAATTTCATAGAGTTTTGAATAA
TATTGGGTAAGGAGAAAGATATCTTTTAAAAGTAATAATTTTTTATTTATAAATAAATAA
AAAGAAAATAAATCATAAAATAAGAAAACCTTAAATAAAAAGATTGAAAAAGGAAAAAGG
TTTATTACGATCGTTGTAGAGAAACAATACATAATAAAAAACCAAATGAATCAACAATCA
TAATTTTTAACTCAGTCTAGGCAAACTCCCACTAGAAGTGTTAATGTTCGTTCTCCTTCA
AAAAGTGGAATCAAGTCACCCACTTATCGCGGAGACTATGCCTAAACACGCAATTTACCC
TCAACTAATCCCATTCGCGCTCCCACTCCAGATTTGATGCCCCGTCATGAACGTATTTCT
TCCACTGCTGTTCCCAACGGGTAATTTAAATTCAATAGTTTTAATTATATTATCAGCATA
AAGTTTCAAATTTGCTCACTGAACACTTATTTTCATTCAATCTGCATTTTGCATACATGT
CCATAGAAGGTAGTTTCTCTCCATAATATTTATCGATGTGATAGTTTTTCATTTTTTACT
ATATTTTCTATACTCATTTTTTTTGTTGATGTCTGATTCTTTTATCAGCATCACATATAA
AAAATATTCCAGTGAAACATTATTTTTATAAATCGAGTGCAAAAGTTGAATTTTATAAGG
TTGAAGGATAGATAAGTAGTTAAGTGAAGCTCATTATATAAAATACATATGCCATTACAA
ACATCGGATCATTTTTTATTAAATTTTTATAAATAGACTTAGATTTACTACAAAGAAAAA
ATAAAACCTTTCTGTATCTCCTCAAAGAGGTGGTTTCAGAGACGTTGATGAAATTACTGA
GCAATTCAATAGAATCCTTAAAGAAAAGAATGATTAGATTGATTAGTTGAAGAGATAACT
TAACGACCCTGAAGAAAATGTTAAGAGAGCTGCAAATAGAGGTGGACCAGTAATAAATTT
TGCATTATTATTTTTCTCTACCAAATAGTTTGTTTACAAATATACCAAAAGCTTTTCAAA
ATTGAAGATTTGCAATTGACATATTAAATAATCAATTATGTCTAAATAAATACTTCAAAA
AGCACAATCATTTTAAATGTTTTTCATTTTTAGAAATTCATAAATTGTGCTTTGTAGCTA
GCTTTTGAATATAAAAAATGTTTCAAAACTTTAAAATCAATCAAACTAATCCATCAACTT
TTTTTGAAATAAACTTTTTCTATAAAATAAACAGAGTGAAAACGATGTATCCGAGTTAAT
TTAGTAGCTCTAAAACTTAAATGTTGAATTAACTAAATCCAGATAGAATGAAATTAGACT
CAGTGCTATGGTTTAGAACTATGAAAATTAAATCAACAAGTTAAGTGATGCCAACTTGAA
ACTCTCACAAGAATTAAAAGAAGTTGGTGAGTAAAACCAATACCTCGTATCTCAACTTTA
AGGCTAAAACCCAGAAAGCGTAAATTATTTATTCATTTGTATAAAATATAATAGAATGAC
TATTATCTTTTAATGTTTGAGTTGCAAAAAAAAAATAAACTGAATGATTGATTAATAATA
AAAAATACATGAAAAAATTTTGAAAAATATCTTTATAAAAGTTATTTTCTATCTTCCCTA
ATAGAATAATTAATTCGTTTAATTACTCAATTAACTAATTTCTACAGCCAGTAGGTATAA
TGATAATACTAACTAATTTATATCAAATAATAATTTTACACAATTAGTCAATTATTAAAA
AATCTTTCAAATTAGTTTTACATTTTTCTTTCTAAATTTTGATAGATAAAACACTTTAAA
TTACAGAGCAACTTAATAAGTTTATCAATTAAAAAAGAAGAAATAAAAATTCTAATAAAA
ATTTTTAATTAGAAGATATTATTGAGTACATACCAATCAATAAATATTAAACAAATTAAT
TTACTTATTTAATAAAGAGAAAGAAATAGAATTTAGAGTTAATTTAAAAAAATCAAAATA
TTATATTAATAAATAAATAAATAAGCAAGCAAAGAGTAAGTTATTAAGTTAGATATTATC
TTAGCTAATTTATATAGGAAATAAATAGCTTTAGCAAATAAAATTATCTTAAAGAAGATG
AAATATCATTACAATAAAATAGCAAGAAATTATTCTTTAGAAGCAACAAAAAAATTTAGT
TATTATAAAAAAATGACTTTTGCATTTAGTTTTTTATGGATCAAATATATTTTTGATTCA
ACTTGCACCATTTCAACTACTTTTTACATATATCATTCTTAATTTGATTTCATTTAAAAT
TAAATTCATTTTTAAATAAATTTAGAGAATCAGAGAAATATAAATCAAGCACGCTGAAGA
ACTTAATAAATTACACGCCTAATTAAGAGAAGCTTAATTAAATGCTGAAAGAAACTAAAA
TGATTAAATCAACTAATTGAGAAAGCAAAATCAAGAATTAGTCAACGAAATCGAAAGATT
GACTAGCTTGATCAAGACTCTCTAGCAAGAATTATCTGCTAAGGGTGATACCACCTAGTT
GAATATCATCATTTAGTAGAGAAACTAAGAGTTAGATAATTGGAAGAACAAGTACAACCT
TCTTGCTGAAGAAAGAGCTAGAATGGAAGAAAAGATTGTTCAAGCCTAAACTGAAATTAT
GCGTCTTGAAAAGTAAGTTGAAATTTGGAAAGATCACTGCAACAAGATTCAATAATCTCA
TCCTAACTAAGACTAAAGAATGTAAATTAACTTAAAATAAAAACAAATAAAATACTCAAT
TTAAATTTTTACTAAAACAGCTAAGAATTACAAAACAAGATTGCTGATTACGAGTCAAAG
ATCAACTAACTTGCTATCGACAATCAAAGATTAAACTAATTAATCTAGATTAAGGATGAA
GAAGCTGATAAAATCAAAAGAGCTTCCAGACAAAGCAATGTCGATTAACGTACTTATGAT
TCTCTTTAAAATGAAAATTACTAATTGAAGAACGATCTTTCTTCTAAGGAATTATTGATT
GTCTAGTTGAATCAAAGAATCAGAGACTTTGAAGGCAACGGTTAGAAGACCACTCAAGAA
TTAACTCAAAAGATCTTCATTTTAACTAATGAATTAGATAATGTCACTTCCCACTTGAAG
GCTCGTAACTAAGAATACGAAGACTTGTCTAAGAGATACAACTAATTACTCTAACAAACC
AACTAAATGACCCAATCTGGTGAATTCAAATATCAAGAACAACTCAGCAAGTCTATTTAA
TTAGGTCAAGAAGTTGAAAAATTAGCTGCTCTAACCAGAGCTTAAGCTGATGAAATTAAA
GACTGGAGAAATAAGTATGCTGATTTGGAATCTAGATACAACTAATAGATCATCCTTATT
AGCTAACAAACCAACTAGGAAGTTTATAGAAGACAAATCTAAGACTTAGAAGATTAACTT
AGAAGAAAGACTGCAGAAGCCAATGAATGGTAATAGAGTTTCACCAATCTCTAGGCTCAA
AAGGAAAGAGAACTCAAGAACCTCATGGAAACCTTGAAAGATGAAATTAGAAAATCAAGC
TCTAGCTTAAATCTTTAAAACGACTACAATAAGCTCAAGGACCAAGTTTGTAAGAAAAAA
TTTTTATTTGCTAATTTCATTATTAATTTATAAAATTATTAAAAACTAAATAGAATTATT
AACCCACTAAATCGAACAACTCAATAAGATTAGTATCGAAAAGGACAATGAAATTCGTCT
TTTGAGAAACTAGGCTGGTAACGATGCTTTATACAGAGAAAAGATTATTAATATGGAAAA
CAAACTTGTTCAACTCACTTCTGAATTATAAAACTAGATCAATTTGAACTAAATCAAGGA
AAGTGAAATCGTTTCTTTGAAGCGTTAATTGGAAGAAGCACGTGGCAGATACAGTGCTGA
CATTGAAACTTAATTGATTCAACTAAGATCATAAGTTACCACTTTACAACAATTATTACA
ATAAAAGGATGAAATCATTAATGATTTACAAAGAAAGCTTGCTGAGCACGAAGATCCCGT
CAAGAGATCCAAGAAAGATAATGAAACTTAAAGATTACTCAACTAGATCCAAGAACTTAC
TTTTGATAACCAAAGATTAACTAAATTGAACAATGAATAAGCAGTTACTATTGACTAACT
CAGAAGAGATCTTATCAATTTACAATAACAATCATAGAATGTTGTTGAACAAAATAGAAA
AATTGAAGCTCTTCTTTATTAGATCGAAGTTCTTGAAAAGTAACTCAGAGCTGTCGCTGA
AGAAAGAGACAACCTTAAGAGATAATTGTTAGAAACCGAAACTCTCAGACAAAAACTCAA
GGAATAAGAAGCTCGTGAACTCTACTTGTAAGAATAAATTCGTAATTTGGTTGCTTAATT
AGAAAATGCTTAAACTGAAAATGTCAAGAGAGCAGGAAAGGAAAGCCAAATTAACCAATA
ACAAGTCCGCATCAACGAATTAGAAAATTTGATTTAAGTCCTCAGAGGAGAAATCGAAAA
GCTTAACAATATTATTCGTATGAAGGATTAAGATTTAGATTCTCTCAAGAGAGAATCTAA
CAGAAAGAGTGTTGTTGATGCCGAGAAACAATAGCTCGAAAATAAGATTCTCTTATTAGC
TAGTGAAATTGATAGATTATCTAGATCTCTTCAAGACAAGCACGAAGAAGTCAATCGTTT
GAAATCTATTATTATTGAGAAGGATAGCTAACTCTAGTCTCTTCCTCAATTACAAAGCAG
AATTGCTCTCTTGTAAGATGAAAATAATAGATTGAATGCTCAAATCAAGCTCTTAACTGA
AGAAAACATCAGAAAGCTCACTGATGAAAACATTTAACTCCGTTAACGCTTAAATGAAAT
GGCTGACTTTGAAAGACAAAAGAATGAACTTGAAAACAAAATTTAATTATTGATTTCCGA
ACGTGAACGCTTAAATGGTATCATCACCACCATGACTTAAGAAAAGCTTTCCCTTCAAGC
TCAATTGAATGACTATGCTCAAGGTGACCGCATCAGAAAAGAACTTGAATACCAAATCGA
ATCTTTGAAGAGAGACAAGCAAAGATTAGAAGAAGGTCTTACTAACTTGGCCAATGAAAA
CAATGAATTGAGATCTCGTCTTTAACAATTAGGTGATATGGATAGAGTCAGAGGTGAATT
AGAAAATAAGATCAATCTTTTGATTCAAGAAAATGATAGACTCCGTGCTGCTTTGGCTGC
TAAGAATGAAGAAAACACTAAATTAATTTTGAAGATTAACGATTTATCCAACTTAGAAAA
GCTTAGAGCTGATCTTGAAGGAAGAATTAAGATCTACGGAGAAGAAAACCAAAGACTTAA
TGATATTATCAGACGTTTAACTGAAGATAATACTAGCTTGTAGACTCGTATTGCTTAATT
AAGCAATATCGAACAAGTCCGTATCACTTTAGAAGGCTAGATCAACTTGTTAGTTGCAGA
AAATAAGCGTTTGAATGATTTAGTCCGTGCTAAGGATGAAGAACTTGTCTAGATTCGTGA
CATCAAGACTAGATTCGAATTATTCTAATTGAGAAACATCGATGCCTTAGCTAGATTGAC
TATCACTATGGCTGAATTAGAAAGAGTTTCTGCTTAAAGTGTTGAAAAGACTAATAAGAT
TATTCAATTAGAATAGCGTTTGAGAGACAACACATTAGAATATTAAAACCAAGCTTTATA
ACAAAAGGTTAATCTTTTAACTGAATAAATCGAACGTTTAGTTAGAGAATTAGAAAATGC
TCGTAACGAATTAATCTAGGTCTCTAGAAAGTGCCAAAGCTTAGAAATCGAAAAGCAAAC
TTGGGATGCTCAAAGAGCTCAATATGAATAAACAATTGCTTAATTGCATGCTGAAATTTA
ACGTTTAAGAGAACAAGCTGATGAAGGTGAAAAAGTCAAGAGAAGTAAACAAAACTAAGA
TAACAGAGTTGCTCAATTAGAAGCTGAAAATAAGTATTTATAAGACCAACTTGAAAAGTT
AAGAAATGATAACAACCAACTTCTTTAACAAGTCAGCTAACTCACATTAACTCTTCAATA
ATTACAAGCTAAATTAAATGACAACACTTTATAAATTTAAAACTAAGAACTTCAAAATAG
ACTCAATGCCAAGACTGCTGAGCTTGAAAGAGTTGCTCAAGAACTCTAACGTCTTAGCTA
ATTAATCAATGAATTAACTTTAGAAGTTAACAGACTTAAATCTGAAAATGCTGGATTTGA
AGTTACCAAGAGAGCTCTTGAAGGCAGAATCTAAGAACTCGCTTCTAGATTGGAAATGTT
GACTGGTGAAATCAATAGACTTAACTAACTCAATGGTGAATTATCTTACAAGCTTTCTTC
TTCTGCCACTATCAACGAAAGATATGCTAGACTTTCTGATGCCTATGTCCTCTAATGCGC
TTTATCTGAATCATTGTCCAAAAAGGTTTCTGACCTTATTGGTTTCCAAAACGAAGCAGA
TGAACATAGAAAGAGAGCTTAACGTCAAAGTTAAGATAACGAAGCTCTTATTCAAAGAAT
TAACTAACTTGAACAATTATTGGCTGAAAAAGATAGAGAATTACAAAACTTAAAGGTAGC
CAGCTAAAATGTTAGCATCCTTCAAATGTAACTCCAATAATCTAACCAAGATAAAGAAAA
TTTAATTAAGAGAATCAGAGAATTAGAAAATATTCTTGGAGAAAGGGATAAAGAAATTGC
AGGTTTGAGAAATGCAAACAGTTAAGTCAACCTCCTTCAAATTCAAATTTAATAATACGA
AAACTAAATTAACGACTTGAAGCGCAGACATGCTGATGAACTCGAAAATGTAAAGAGATA
ATACGAAGGTCTTCGTCAATCTACTGTCAATAGAGAAATCAATGAGCTCACAGTTAAGTT
CAACATTCGTATCCAAGAACTTGAAAGAGAAATCCAAAAATACAAATCTCTCTCAGAATA
ATATGAAAATGAATTACGTGCTCAACGTCAATAAAACTCTGAACTTCTCCAACGTTTGGT
TGATGCTGAAAACCGTGCTCGCGATTCTGATGAATAAGTCAAACGCTCTAGAGCTGGTCA
ATAATAGGTCAATAATTTGGAAGAAAATCTCAGATTCGTAACTGCTGAATTAGAAAAGTA
GAAGAACCTTTTAGCTGAAGAAAAGAATAAGAATGCCTAACTTGAAAGTCAAAAATCTAT
TTTAGCTATGGAAATCGAACGTCTTAACACCATCTTGAAAGAAAAGCTCATTTTAATCGA
AGACTTCTAACGTCGTGAAGCTGAATATGAAAACTAATTGAGAGAATTGCAAGCTAGACT
TGCCTCTGTTGCTGAATTAGAAAGCAAACTCCAATTCTTCAACAACTAAATCTAGACATT
GAACTTCAGCTTGGAGTAAAAGGAAAAGGAAAAGCAAGCACTTGGTCAACATTTAGTTGA
ACTTCAACAAACTATTGAATAATTAAGAGCTGAAAATACTTAAGTTGCTGCTTTCAAATA
CTAAGTTGAAAATCTCTCACGTGAAAACGAAGCATTAAAATAACGTCTTGTTGAACAATA
ACAAACTATCGACAAGTTAAGAGCTGAAGCTTCATAATTCGCTTCTCTTAAGTTCTAAGC
TGAAAACTTATAACGTGAAAATGAAGCTTTGAAACAACGTCTCGTTGAACTCTAACAAAC
TGTTGATAAACTAAGAGCAGAAGCTGCTTAATTCGGAAGTCTTTAATACTAAGTTGAAAA
TCTCACTCGTGAAAATGAAGCATTAAAGCAACGTTTGGCCTAAACAGCAGAAACTCTTAG
CTAATAAGTAGCTCAAAACAGCGAACTTTAAAGAAGAGTTCAATAACTAGAAAGCGAACT
CCAATTACTCAAGATGTAATTAGAAGGTGAACGTGAAGATAACAAGGTCAAGAGAAGCAG
AAACGATAAGAATAATGAAGATCTCTAAAAGGTCATCCAACAACTCCAATAAGAAATTGA
AAATTTAAGAAGAGAAATTTAAGCTCGTGATTAGAAGATTGCTGAACTCTCAAATGCAAG
CTACACCATTCAAATACTCCAACATGAAAAGGAAGATTTGATCAGAAAGTTAGATGCTAT
TAGTTAGGTATATGCCAAATCTTAGACTGATCTCTAAAACAGTCTCCAAAAGGTTGTTGT
CCTTTCAGCTCGTGTTGAAAGCTCTGATGAAGCAAACAAGAATCTTACTGCCTAAGTTCA
AATTCTTTCTCAATCTTTACAAAATAAGGATTAAGAATTAAGAAACTTGATGATTGCTTA
CTAAGAACTCCAAGTTAAATTTGGTCAAGAATAAGAAAATTCTCGTCGTAGCTCTTCAAT
GGCTTCTTCCAAGTTCATTCAAGAAAGAGTTTAATTGGAAGCTGAAATTAACAGACTTAA
AAACGAATTAGCTATCATCGAACACAAGCATAACCTCACAATTGAAGAAATCAAGCGTTA
GATGGAAGTATAGCTTTCTGAAGAACTCAGAAAGTAACTTGCTGCTGCCAAGGCTGAATA
TGAAAGAAGATTAAACGATGCCCTCAACGCTCAACAACAATAATACGAAGATGACCGTGT
CAAGAGATCTAAATAACAACAAAAGGAAAATGATGATCTTAAGAACTAACTCTAATGTAA
ATATTTTTCATAATTTTGACATTTTTTTAAAAGATTTTTATTAAATATGACATATTCTTA
TAATTAATTTAACAAAATATAGTAACTATATAAATGCAACTTGAATAACAACTTGCTGAA
GTTAAGGCTAGAATGGAAGCTGAAAGAAGAAGACTTGAAGAAGAAAATGCCATGCTCAGA
GCCAGAGTTTAATAATTAGAAGACTAATTGTAACATGCTTTGGTTAACGAAGAAGAAATC
TTAAAATTCAAGGACTTGATCCAATAACTTCAAATGCAAAAACTTAAGGATATCTCTGAA
CTCTAACAAAAATTAGAAGAATACAGAAGCTTACACGTCAATGCTGGTGGTTCTCTTCAA
GATGCAATCAAGACATCCTTCCAAACTGAAATTCAATAACTCAGAGACAAGGTCCAATAA
CTCAACTAGATTCTCGAAGTCAAGAGCAAGGAAAATAACGAGCTCTAAAGTGCTAACCTC
AACCTCATGAGAGAAAGATCAGAAATAAAGAAATCTATGACATCATCCAACTCTAACATT
CAATTCACCATGGAAATTGAATCTCTCAAGAGATAACTTATTGTAATTTTTAATTATTAT
TTTTTAGCTTAACTAAAAATATTTAATTTAAATCTAGCAATCTAATGATAGAACTTAAGA
ATATGAAGCCAGAATTAAATCTTATGAAGGTAAACTCAATCAATATGAATTACAACTTTC
TTAAGTTGTTAATGAACTCAAGCAAACTCAAGATATCCTCAATATTAAGAAGATGGAAAG
AGACAATGCTTTCAATCAAGTAAAAATATAACCAACACGCCATTACTTAGTGTTAAATTT
CTTTTAAATAAATAGATGGATTAACTTAAGAGCTAGACCCTCAGCATGTCACAAGCTTTA
TCTCAAGGAAGCAACGATGTTGATCTTTAAAATATTGTTTTCTTAAAGAAGGAAATTGAG
AATTTGTAAAATTTAAAACATTTATTTATCTTTTTAAATAACAAATTAAACTTAAATCAA
AAAAGAACTGTTGAAAAAGAAATGTATAAGTCCTAATCAGAAAAGAACTATGCTGAACTC
AATAGAAAGAACGAAGAATTGGTTAGAAAGATTGAAGAATTAAATAACGTCAAGCTCCAA
TATCAATAAAATAATAACAAGATCTATGCCCTTGAAAAGGAAGTAATAAATTTACTATTC
TTTATTTTGAATAAATTTTAATCATTTTTCATTTTAAAAAATAAATAGCTTCTCAAAAAA
CTTGAAACTGAAGAAATCCATATCATGTGA