Identifiers and Description

Gene Model Identifier

TTHERM_00823650

Standard Name

EOA1 (Epi-like Oral Apparatus 1)

Aliases

PreTt20435 | 141.m00092 | 3682.m00026

Description

EPI-like oral apparatus protein; localizes to the oral apparatus

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00823650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_176260
Tetrahymena borealisEI9_18163.12.998990600740728e-62hypothetical protein (165 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000388

Sequences

>TTHERM_00823650(coding)
ATGAGCACCACAAATACCCCTGTAAAAGATGTCTTATATTCATCTAGATATTATTCTTCT
CCTTACGCATCCACACTCGCATACTCAACTTACCCCTATACAAGCTCTCTTTACAGATCA
GCAATTACCCCTCCTAGAACAAGCGAATGGACTGAATACTAGCCAGTTGAAAGAAAGTAC
ATTGACTATGTACCTGAAACAAAGGTAGAATATGTTCCCGTTGAAAGAACCACTAGAGAC
TATGTTGAAATTAAGCATGTCACTTCATATGAGCCCTAGACAAGAGTTGAAAGAAGAACT
GAATACGTTCCAGTAGAACACGTTGATGAGTATGTTGACTATTATCCTAAAAATTACTCA
TATGTCTCTCGTAGCCCAAGCTATGATTACTCACCCTCTCTCACAACTTCTAGCTTGAGA
ACCAGCAACTACCTTCCTTACTACACTTCCAGCTACTACAGATCTCCTTATTCTTACAGA
TATTACTACTGA


>TTHERM_00823650(protein)
MSTTNTPVKDVLYSSRYYSSPYASTLAYSTYPYTSSLYRSAITPPRTSEWTEYQPVERKY
IDYVPETKVEYVPVERTTRDYVEIKHVTSYEPQTRVERRTEYVPVEHVDEYVDYYPKNYS
YVSRSPSYDYSPSLTTSSLRTSNYLPYYTSSYYRSPYSYRYYY


>TTHERM_00823650(gene)
ATGAGCACCACAAATACCCCTGTAAAAGATGTCTTATATTCATCTAGATATTATTCTTCT
CCTTACGCATCCACACTCGCATACTCAACTTACCCCTATACAAGCTCTCTTTACAGATCA
GCAATTACCCCTCCTAGAACAAGCGAATGGACTGAATACTAGCCAGTTGAAAGAAAGTAC
ATTGACTATGTACCTGAAACAAAGGTAGAATATGTTCCCGTTGAAAGAACCACTAGAGAC
TATGTTGAAATTAAGCATGTCACTTCATATGAGCCCTAGACAAGAGTTGAAAGAAGAACT
GAATACGTTCCAGTAGAACACGTTGATGAGTATGTTGACTATTATCCTAAAAATTACTCA
TATGTCTCTCGTAGCCCAAGCTATGATTACTCACCCTCTCTCACAACTTCTAGCTTGAGA
ACCAGCAACTACCTTCCTTACTACACTTCCAGCTACTACAGATCTCCTTATTCTTACAGA
TATTACTACTGA