Identifiers and Description

Gene Model Identifier

TTHERM_00474960

Standard Name

ENO3 (ENOlase)

Aliases

PreTt02295 | 57.m00234 | 3709.m00094

Description

Enolase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03952 ) Enolase, N-terminal domain
  • ( TIGR01060 ) phosphopyruvate hydratase
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF00113 ) Enolase, C-terminal TIM barrel domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00474960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13174.19.000270655364168e-50hypothetical protein (658 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00474960(coding)
ATGGGTGATGAGGTAAAGAATAATCGATATTCAGATTTACAATGGGATGATGACGACATC
CCTTTAAATGTAAACAAAAATACTTTAAAGTAATTAGGAGAAGCTCTACAATATAAATAA
GATATAAATTATAAGATAGTGAGCGAAGAGCTAAAGTAGTTTATGGATGAGTCACCCAGA
ATAATCTAAAGATGTGATTCTAAATAACAAAAGGATCTTTTAAAGCTAGGAAAATGCAAC
AATGATAGTACCTAGAAAACCAATAAAATTGATAGTAGTATGGCTAAGTATATTGATAAT
AATATTATTGCTACACCTAATCAGAGACTTCTTAAGTTATAAATTTTGAAAAAGAATAAC
ACTAATGATAATTATTTTAGAGATTAATTTACAGATAGAGCTTTTGATCACTCTGAAAAG
AAAATTAGAGGATCTAACTCAAGTAGGAGTACTTTGATAAATATTATGAATAAATAGAAT
TCTTTTTTAGAAAAGACAAAAATCTTGAACAACTAAATTAATGGCAGCAACAGTGAATTT
TAGAAGGATATTCAAGCTATGATAGAAGAAGAAAAGTAAAACGATAAATTAAAAGAAAGA
CAATCTTACATAAGCTAAACTGAGCATATGATAGGTGCAAGAGAAAGATCTTAGTAGCAT
AATTAATTGCTTAAAAATAAATAAGAAGAGTAGGCTGCAAATGCAGAGAAGTAAGCTATG
TAGGCAGAAGCAGCATTTGAATTTAAGAAAAAAATGAACTAAGTTTTAAATTAAAAAAAC
AAAGAATTTATTAGATAATTTACTAAAATGAAAAATGAAAATAAGTCTAAGCAATCAGAG
ATTTATTAGAAAATATTAGATTTTTACTAATAAAAAAATAAAATTGATCCCAATGAGATC
TAATTATACCAGGATATATATAACAGCCACTAAAAAGCAGCACGTGAATTTATTCAACAG
ATTAGAAATAATAGCTAACCAAATCGATAAGATCAAAACTTAAAATAGTACTAGGTAATG
AACAACTTTATTAAAAGTAAATCAGCTAGAGTTTGCTTGAGCGCTTAATCTCAAAGGAAG
ATTGAATCTCAGCAATAAATATCTTAAAAGTCAGGAAAATTAGAAGGGAGAAAAAGGATT
AATACTCAGGTTACTCCTTTTGAATATTAGGATTCTAAATATTTAAATCTAAGCTAACAT
GAATAAGAAGCTTCTTAAATTAATTAAAGCTAATAATAGCACAGTTAGAAAGGACATTCT
TATTCCGTTTAAAATATGAAATCACTTCTCTAAAATAGCTAATAGAATATTTATGTGGAG
AATTCTTTATATGAATAAGATTTAATAATGAAACAAAATAACAATCATTATGACAGCTTT
ATAAATTAAAAGCTAAATAGGAAAATTCTTTCTACTCTTAGGATGTAAAAAGAATAAAAC
AGTTTGCAACCCTAGAAAAATTCAATAGGAAATGCAAGTTACACTTAACCATTTCAATTA
CCTACTTCAAATGAGAGTAGAACTAAAGGAAAGTAAGATTGTGAAACATAAACTACCCTT
CCATATAAAGTGAGGTCTAAAACTCGTAGTCCAGTAAAAATAAATAGGAACACCGTTGTT
GATTAATATTAGATTATGGCCAAACCAATAGTAATGATTTCTCACAATAGATCTAATTCG
AACTCTCCAATAGAATTAAAATCGATATTAAAAGAATAAGATAAATGTGAAACAGTTGAA
ATTGATTCACCTTCTAATTAAAAAATTGATAAAATAAAATAAATTTAATTTAGACAGCAA
AGGTAAAAGGCAAACAGCAAACACATTAGCAGTTCTCATTCATTTTTAGCAAATATGTTT
CAAAACTAAAAGAAATTAGCTGAATAATAAATGTAATTTAAACACCCTGAATTATAAAAT
TTTCCTTAAACTAACAATTAGCTAAAATGCCAATTTGCATAATAAAATAATACTCAACCT
CATATTAAAAATAAATAAGGATCCTTAATTCTAAATAAAGATTAAGAAAAAGGTGAAAAT
ACAAGTGATAATGAAAACAATGTGAAATCTAGTCCAACTTCTGCCAGAAATAATTAATTT
CGTCCAGATATATTATCTTTCAACTTATTTTAGCAGATTCAATAAAATCAGCATAATCAA
AAATAAAATCATCAAAAGAACTTATAAAAGCAGCAAGAGCACTCATAATTCAATGATTTA
GTTGGAATAAATAGTAATCTAATTAAATAAAACTACTCATTACAAAACAATAAAGTAGGT
TTATCACTTAAAAATAAGTTTTAAAACAAAAATACTAATATCTCTTCACTAAGTTCTAAA
TTATTTACCTAAATTAAAGAAAGAATTTTTATGAGTTGA


>TTHERM_00474960(protein)
MGDEVKNNRYSDLQWDDDDIPLNVNKNTLKQLGEALQYKQDINYKIVSEELKQFMDESPR
IIQRCDSKQQKDLLKLGKCNNDSTQKTNKIDSSMAKYIDNNIIATPNQRLLKLQILKKNN
TNDNYFRDQFTDRAFDHSEKKIRGSNSSRSTLINIMNKQNSFLEKTKILNNQINGSNSEF
QKDIQAMIEEEKQNDKLKERQSYISQTEHMIGARERSQQHNQLLKNKQEEQAANAEKQAM
QAEAAFEFKKKMNQVLNQKNKEFIRQFTKMKNENKSKQSEIYQKILDFYQQKNKIDPNEI
QLYQDIYNSHQKAAREFIQQIRNNSQPNRQDQNLKQYQVMNNFIKSKSARVCLSAQSQRK
IESQQQISQKSGKLEGRKRINTQVTPFEYQDSKYLNLSQHEQEASQINQSQQQHSQKGHS
YSVQNMKSLLQNSQQNIYVENSLYEQDLIMKQNNNHYDSFINQKLNRKILSTLRMQKEQN
SLQPQKNSIGNASYTQPFQLPTSNESRTKGKQDCETQTTLPYKVRSKTRSPVKINRNTVV
DQYQIMAKPIVMISHNRSNSNSPIELKSILKEQDKCETVEIDSPSNQKIDKIKQIQFRQQ
RQKANSKHISSSHSFLANMFQNQKKLAEQQMQFKHPELQNFPQTNNQLKCQFAQQNNTQP
HIKNKQGSLILNKDQEKGENTSDNENNVKSSPTSARNNQFRPDILSFNLFQQIQQNQHNQ
KQNHQKNLQKQQEHSQFNDLVGINSNLIKQNYSLQNNKVGLSLKNKFQNKNTNISSLSSK
LFTQIKERIFMS


>TTHERM_00474960(gene)
TTATTATTTTGCAAACTACTGTAAACCAAAAAATCATAAGCAAACAAAGAAAACAGTAAT
AAATATAAAAGGTAGAGAATATTATAACTAAAATATAATTAAGAAGATATTTTTTAATTA
TTACAATCACTTTATTTGATGGGTGATGAGGTAAAGAATAATCGATATTCAGATTTACAA
TGGGATGATGACGACATCCCTTTAAATGTAAACAAAAATACTTTAAAGTAATTAGGAGAA
GCTCTACAATATAAATAAGATATAAATTATAAGATAGTGAGCGAAGAGCTAAAGTAGTTT
ATGGATGAGTCACCCAGAATAATCTAAAGATGTGATTCTAAATAACAAAAGGATCTTTTA
AAGCTAGGAAAATGCAACAATGATAGTACCTAGAAAACCAATAAAATTGATAGTAGTATG
GCTAAGTATATTGATAATAATATTATTGCTACACCTAATCAGAGACTTCTTAAGTTATAA
ATTTTGAAAAAGAATAACACTAATGATAATTATTTTAGAGATTAATTTACAGATAGAGCT
TTTGATCACTCTGAAAAGAAAATTAGAGGATCTAACTCAAGTAGGAGTACTTTGATAAAT
ATTATGAATAAATAGAATTCTTTTTTAGAAAAGACAAAAATCTTGAACAACTAAATTAAT
GGCAGCAACAGTGAATTTTAGAAGGATATTCAAGCTATGATAGAAGAAGAAAAGTAAAAC
GATAAATTAAAAGAAAGACAATCTTACATAAGCTAAACTGAGCATATGATAGGTGCAAGA
GAAAGATCTTAGTAGCATAATTAATTGCTTAAAAATAAATAAGAAGAGTAGGCTGCAAAT
GCAGAGAAGTAAGCTATGTAGGCAGAAGCAGCATTTGAATTTAAGAAAAAAATGAACTAA
GTTTTAAATTAAAAAAACAAAGAATTTATTAGATAATTTACTAAAATGAAAAATGAAAAT
AAGTCTAAGCAATCAGAGATTTATTAGAAAATATTAGATTTTTACTAATAAAAAAATAAA
ATTGATCCCAATGAGATCTAATTATACCAGGATATATATAACAGCCACTAAAAAGCAGCA
CGTGAATTTATTCAACAGATTAGAAATAATAGCTAACCAAATCGATAAGATCAAAACTTA
AAATAGTACTAGGTAATGAACAACTTTATTAAAAGTAAATCAGCTAGAGTTTGCTTGAGC
GCTTAATCTCAAAGGAAGATTGAATCTCAGCAATAAATATCTTAAAAGTCAGGAAAATTA
GAAGGGAGAAAAAGGATTAATACTCAGGTTACTCCTTTTGAATATTAGGATTCTAAATAT
TTAAATCTAAGCTAACATGAATAAGAAGCTTCTTAAATTAATTAAAGCTAATAATAGCAC
AGTTAGAAAGGACATTCTTATTCCGTTTAAAATATGAAATCACTTCTCTAAAATAGCTAA
TAGAATATTTATGTGGAGAATTCTTTATATGAATAAGATTTAATAATGAAACAAAATAAC
AATCATTATGACAGCTTTATAAATTAAAAGCTAAATAGGAAAATTCTTTCTACTCTTAGG
ATGTAAAAAGAATAAAACAGTTTGCAACCCTAGAAAAATTCAATAGGAAATGCAAGTTAC
ACTTAACCATTTCAATTACCTACTTCAAATGAGAGTAGAACTAAAGGAAAGTAAGATTGT
GAAACATAAACTACCCTTCCATATAAAGTGAGGTCTAAAACTCGTAGTCCAGTAAAAATA
AATAGGAACACCGTTGTTGATTAATATTAGATTATGGCCAAACCAATAGTAATGATTTCT
CACAATAGATCTAATTCGAACTCTCCAATAGAATTAAAATCGATATTAAAAGAATAAGAT
AAATGTGAAACAGTTGAAATTGATTCACCTTCTAATTAAAAAATTGATAAAATAAAATAA
ATTTAATTTAGACAGCAAAGGTAAAAGGCAAACAGCAAACACATTAGCAGTTCTCATTCA
TTTTTAGCAAATATGTTTCAAAACTAAAAGAAATTAGCTGAATAATAAATGTAATTTAAA
CACCCTGAATTATAAAATTTTCCTTAAACTAACAATTAGCTAAAATGCCAATTTGCATAA
TAAAATAATACTCAACCTCATATTAAAAATAAATAAGGATCCTTAATTCTAAATAAAGAT
TAAGAAAAAGGTGAAAATACAAGTGATAATGAAAACAATGTGAAATCTAGTCCAACTTCT
GCCAGAAATAATTAATTTCGTCCAGATATATTATCTTTCAACTTATTTTAGCAGATTCAA
TAAAATCAGCATAATCAAAAATAAAATCATCAAAAGAACTTATAAAAGCAGCAAGAGCAC
TCATAATTCAATGATTTAGTTGGAATAAATAGTAATCTAATTAAATAAAACTACTCATTA
CAAAACAATAAAGTAGGTTTATCACTTAAAAATAAGTTTTAAAACAAAAATACTAATATC
TCTTCACTAAGTTCTAAATTATTTACCTAAATTAAAGAAAGAATTTTTATGAGTTGA