Identifiers and Description

Gene Model Identifier

TTHERM_00046480

Standard Name

ENO2 (ENOlase)

Aliases

PreTt11127 | 3.m01762 | 3824.m02888

Description

enolase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.8%

TetraMine Data

TTHERM_00046480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_310880
WormBaseWBGene000118849.997093137033517e-262locus:enol-1 Enolase statu
s:Confirmed UniProt:Q27527
protein_id:CAA92692.1
Tetrahymena borealisEI9_01799.19.997093137033517e-262enolase (465 aa)
DictyBaseDDB_G02831379.997093137033517e-262enoA on chromosome: 4 position
225309 to 226956
OxytrichaContig15891.0.g729.997093137033517e-262Enolase, C-terminal TIM barrel
domain
SGDYGR254W9.997093137033517e-262ENO1 Enolase I, a phosphopyruv
ate hydratase that catalyzes t
he conversion of 2-phosphoglyc
erate to phosphoenolpyruvate d
uring glycolysis and the rever
se reaction during gluconeogen
esis; expression is repressed
in response to glucose

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046480(coding)
ATGTTGAGCAAATTAACCAAGAACTTATATATGAACAAGCCTACCTTCGGCTTCTCATCT
ATCCAAAACGTCTTCGCCAGAGAAATTTTGGATTCCAGAGGTAATCCCACTATTGAAGCT
GAAGTCGTCACTTCTAAGGGTGCTTTCAGAGCTGCTGTTCCTTCTGGTGCTTCCACTGGT
ATTTATGAAGCTCTTGAACTCAGAGATGGTGACAAGAAGAGATACTTAGGTAAGGGTGTT
TAAAAGGCTGTCAACAATGTCAACAACGTTATTGCTCCTGCTTTGAAGGGCAAGAACCCC
GCTGAATAAGAAAAGTTGGACAGATTCATGGTCGAAAGCTTAGATGGTAGCAAGAACTAA
TATGGCTGGTGCAAGAGCAACTTAGGTGCTAATGCTATTTTGGGTGTCTCCCTTGCCTTA
GCCAGAGCTGGTGCTGCTGAAAAGAACATTCCTCTTTATCAATACTTAGGTCAATTGGCT
GGTAAGAAATAAAACAAATACATCTTACCCGTACCCTCCCTCAACGTTATTAACGGTGGT
AAGCACGCTGGTAACAAGCTTGCTATGCAAGAATTCATGATCTTGCCCACTGGTGCCACC
AGCTTCAAGGAATCTATGTAAATTGGTTGTGAAGTCTACCACTCCCTTAAGAGTGTCATC
AAGAAAAAATACGGTCTTGATGCTACCAACGTTGGTGATGAAGGTGGTTTCGCTCCTAAC
ATTCTCTAAACCAGAGACGGTCTTAACCTCCTCTTAGAAGCCATCGAAAAGGCTGGCCAC
AAGGGTAAGGTTGACATTGGTATGGATGTTGCTGCCTCTGAATTCTGGGTACCTGAAAAG
AAGGTTTATGACTTAGATTTCAAGACTGCCAACAACGACGGATCTAACTAACTCACTGGT
GAAGCTTTAACCAACCTCTACTAATAATTAGTTAAGGAATACGGTATTGTCTCTATTGAA
GATCCTTTCGACCAAGATGACTGGGCTGCTTATGCTAACATGAATGCCTTAGTTGGTAAG
ACCACTCAAATTGTTGGTGATGATTTACTCGTTACTAATCCTACCAGAGTTAAATAAGCT
ATCTAATCAAAGGCTTGCAACGCCCTTCTTTTGAAGGTCAACTAAATCGGTTCAGTTACT
GAATCTATTGAAGCTTCAGTTCTTTCTTAAAATGCTGGTTTTGGTGTTATGGTTTCTCAC
AGATCAGGTGAAACTGAAGATACCTTCATTGCTGACTTAGTCGTTGGTTTGGCTACTGGT
CAAATTAAGACTGGTGCTCCTTGCAGATCTGAACGTTTGGCTAAATACAACCAACTCTTA
AGAATCGAATAAGAAGTTGGCTCAAAGGCTGTTTTTGCTGGTAAGAGCTTCAGAAACCCC
TCTAACCTCCTTTGA


>TTHERM_00046480(protein)
MLSKLTKNLYMNKPTFGFSSIQNVFAREILDSRGNPTIEAEVVTSKGAFRAAVPSGASTG
IYEALELRDGDKKRYLGKGVQKAVNNVNNVIAPALKGKNPAEQEKLDRFMVESLDGSKNQ
YGWCKSNLGANAILGVSLALARAGAAEKNIPLYQYLGQLAGKKQNKYILPVPSLNVINGG
KHAGNKLAMQEFMILPTGATSFKESMQIGCEVYHSLKSVIKKKYGLDATNVGDEGGFAPN
ILQTRDGLNLLLEAIEKAGHKGKVDIGMDVAASEFWVPEKKVYDLDFKTANNDGSNQLTG
EALTNLYQQLVKEYGIVSIEDPFDQDDWAAYANMNALVGKTTQIVGDDLLVTNPTRVKQA
IQSKACNALLLKVNQIGSVTESIEASVLSQNAGFGVMVSHRSGETEDTFIADLVVGLATG
QIKTGAPCRSERLAKYNQLLRIEQEVGSKAVFAGKSFRNPSNLL


>TTHERM_00046480(gene)
ATAAATAAAAAATTTATTAAAAATAAATATCCAGATTAGTTAAACTACTAAAAAAAAATA
AATAAACAATAGATAGCCAAAATGTTGAGCAAATTAACCAAGAACTTATATATGAACAAG
CCTACCTTCGGCTTCTCATCTATCCAAAACGTCTTCGCCAGAGAAATTTTGGATTCCAGA
GGTAATCCCACTATTGAAGCTGAAGTCGTCACTTCTAAGGGTGCTTTCAGAGCTGCTGTT
CCTTCTGGTGCTTCCACTGGTATTTATGAAGCTCTTGAACTCAGAGATGGTGACAAGAAG
AGGTAAATATTGAATACATTTATAAAAAAAACTACAATTTCAATAAAGCTTGTTTCATCA
AATTTTATACTTTGCAAATCCAGAATCTTCAATTTTTTTTTGACTTCTTTCTACTTGGTT
CTTGGGAATTAATTTTAAATATGTATAAGAAATTTCTACCTACTTGGCCTACTTTTTTCA
TAGTAGAATTGAATAAAAGAATCAAACACTTAGAAGATATATTTTAAAAAGATTAAACTT
ACATCATTATTTAAAAGATACTTAGGTAAGGGTGTTTAAAAGGCTGTCAACAATGTCAAC
AACGTTATTGCTCCTGCTTTGAAGGGCAAGAACCCCGCTGAATAAGAAAAGTTGGACAGA
TTCATGGTCGAAAGCTTAGATGGTAGCAAGAACTAATATGGCTGGTGCAAGAGCAACTTA
GGTGCTAATGCTATTTTGGGTGTCTCCCTTGCCTTAGCCAGAGCTGGTGCTGCTGAAAAG
AACATTCCTCTTTATCAATACTTAGGTCAATTGGCTGGTAAGAAATAAAACAAATACATC
TTACCCGTACCCTCCCTCAACGTTATTAACGGTGGTAAGCACGCTGGTAACAAGCTTGCT
ATGCAAGAATTCATGATCTTGCCCACTGGTGCCACCAGCTTCAAGGAATCTATGTAAATT
GGTTGTGAAGTCTACCACTCCCTTAAGAGTGTCATCAAGAAAAAATACGGTCTTGATGCT
ACCAACGTTGGTGATGAAGGTGGTTTCGCTCCTAACATTCTCTAAACCAGAGACGGTCTT
AACCTCCTCTTAGAAGCCATCGAAAAGGCTGGTAAGAAATAAATTCTTTACCTTTACTTA
ACTCTTTAACTACATAAAAATAAATAAGAAGGCTTAGCTATTTTTCAACCCTAAATTGCG
TATTTTTAATAATAGTAGTAAAATGAAGTAAGAAATGAATAAATTTGCTTGAAATATCAA
AGAAATAGCTTGAAAATTTTCAAGAAATTATATTAAAAGCAAATAATTCTTATTAAATAA
AAGTATAAGATATTTGAATAATAAATCGTCATTGTTGGTAGATATAACTAATAGCTAAGC
TATATTTAAAATTAAATCGCAATTCTAAAATTTAATTAAGTTTCTATTAACGTATTAATA
ATCTATCTTTACAAAAAAATTAATAAGGATTCATTCCAAAGAAACTTCTTATTAATTTCC
AAATTTTACATAAAAACAGTAAAAAAATAAAGTATAACCATAAAGAGTTTCTGCAATTTT
TATAAATGAAATGCTAAATTATATTTATTAAAATATTTAGGCCACAAGGGTAAGGTTGAC
ATTGGTATGGATGTTGCTGCCTCTGAATTCTGGGTACCTGAAAAGAAGGTTTATGACTTA
GATTTCAAGACTGCCAACAACGACGGATCTAACTAACTCACTGGTGAAGCTTTAACCAAC
CTCTACTAATAATTAGTTAAGGAATACGGTATTGTCTCTATTGAAGATCCTTTCGACCAA
GATGACTGGGCTGCTTATGCTAACATGAATGCCTTAGTTGGTAAGACCACTCAAATTGTT
GGTGATGATTTACTCGTTACTAATCCTACCAGAGTTAAATAAGCTATCTAATCAAAGGCT
TGCAACGCCCTTCTTTTGAAGGTCAACTAAATCGGTTCAGTTACTGAATCTATTGAAGCT
TCAGTTCTTTCTTAAGTAATTAGCTTTTTTTTTTAACTCTTCAAATTAAAAATTTTGTAT
AAAAAAATAAAATTTACTTATTTCAATTTCTAAAAATAAAGAATGCTGGTTTTGGTGTTA
TGGTTTCTCACAGATCAGGTGAAACTGAAGATACCTTCATTGCTGACTTAGTCGTTGGTT
TGGCTACTGGTCAAATTAAGACTGGTGCTCCTTGCAGATCTGAACGTTTGGCTAAATACA
ACCAACTCTTAAGAATCGAATAAGAAGTTGGCTCAAAGGCTGTTTTTGCTGGTAAGAGCT
TCAGAAACCCCTCTAACCTCCTTTGAGAGATAATTTGACTAATTTGTTGAATATTTATTT
TATTGTTTCTCTAGAAATTTATACTCTGTATTACTTTTTTATAATTCAGAATATCCAT