Identifiers and Description

Gene Model Identifier

TTHERM_00046480

Standard Name

ENO2 (ENOlase 2)

Aliases

PreTt11127 | 3.m01762 | 3824.m02888

Description

ENO2 phosphopyruvate hydratase; Enolase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.8%

TetraMine Data

TTHERM_00046480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_310880
WormBaseWBGene000118849.997093137033517e-262locus:enol-1 Enolase statu
s:Confirmed UniProt:Q27527
protein_id:CAA92692.1
Tetrahymena borealisEI9_01799.19.997093137033517e-262enolase (465 aa)
DictyBaseDDB_G02831379.997093137033517e-262enoA on chromosome: 4 position
225309 to 226956
OxytrichaContig15891.0.g729.997093137033517e-262Enolase, C-terminal TIM barrel
domain
SGDYGR254W9.997093137033517e-262ENO1 Enolase I, a phosphopyruv
ate hydratase that catalyzes t
he conversion of 2-phosphoglyc
erate to phosphoenolpyruvate d
uring glycolysis and the rever
se reaction during gluconeogen
esis; expression is repressed
in response to glucose

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046480(coding)
ATGTTGAGCAAATTAACCAAGAACTTATATATGAACAAGCCTACCTTCGGCTTCTCATCT
ATCCAAAACGTCTTCGCCAGAGAAATTTTGGATTCCAGAGGTAATCCCACTATTGAAGCT
GAAGTCGTCACTTCTAAGGGTGCTTTCAGAGCTGCTGTTCCTTCTGGTGCTTCCACTGGT
ATTTATGAAGCTCTTGAACTCAGAGATGGTGACAAGAAGAGATACTTAGGTAAGGGTGTT
TAAAAGGCTGTCAACAATGTCAACAACGTTATTGCTCCTGCTTTGAAGGGCAAGAACCCC
GCTGAATAAGAAAAGTTGGACAGATTCATGGTCGAAAGCTTAGATGGTAGCAAGAACTAA
TATGGCTGGTGCAAGAGCAACTTAGGTGCTAATGCTATTTTGGGTGTCTCCCTTGCCTTA
GCCAGAGCTGGTGCTGCTGAAAAGAACATTCCTCTTTATCAATACTTAGGTCAATTGGCT
GGTAAGAAATAAAACAAATACATCTTACCCGTACCCTCCCTCAACGTTATTAACGGTGGT
AAGCACGCTGGTAACAAGCTTGCTATGCAAGAATTCATGATCTTGCCCACTGGTGCCACC
AGCTTCAAGGAATCTATGTAAATTGGTTGTGAAGTCTACCACTCCCTTAAGAGTGTCATC
AAGAAAAAATACGGTCTTGATGCTACCAACGTTGGTGATGAAGGTGGTTTCGCTCCTAAC
ATTCTCTAAACCAGAGACGGTCTTAACCTCCTCTTAGAAGCCATCGAAAAGGCTGGCCAC
AAGGGTAAGGTTGACATTGGTATGGATGTTGCTGCCTCTGAATTCTGGGTACCTGAAAAG
AAGGTTTATGACTTAGATTTCAAGACTGCCAACAACGACGGATCTAACTAACTCACTGGT
GAAGCTTTAACCAACCTCTACTAATAATTAGTTAAGGAATACGGTATTGTCTCTATTGAA
GATCCTTTCGACCAAGATGACTGGGCTGCTTATGCTAACATGAATGCCTTAGTTGGTAAG
ACCACTCAAATTGTTGGTGATGATTTACTCGTTACTAATCCTACCAGAGTTAAATAAGCT
ATCTAATCAAAGGCTTGCAACGCCCTTCTTTTGAAGGTCAACTAAATCGGTTCAGTTACT
GAATCTATTGAAGCTTCAGTTCTTTCTTAAAATGCTGGTTTTGGTGTTATGGTTTCTCAC
AGATCAGGTGAAACTGAAGATACCTTCATTGCTGACTTAGTCGTTGGTTTGGCTACTGGT
CAAATTAAGACTGGTGCTCCTTGCAGATCTGAACGTTTGGCTAAATACAACCAACTCTTA
AGAATCGAATAAGAAGTTGGCTCAAAGGCTGTTTTTGCTGGTAAGAGCTTCAGAAACCCC
TCTAACCTCCTTTGA


>TTHERM_00046480(protein)
MLSKLTKNLYMNKPTFGFSSIQNVFAREILDSRGNPTIEAEVVTSKGAFRAAVPSGASTG
IYEALELRDGDKKRYLGKGVQKAVNNVNNVIAPALKGKNPAEQEKLDRFMVESLDGSKNQ
YGWCKSNLGANAILGVSLALARAGAAEKNIPLYQYLGQLAGKKQNKYILPVPSLNVINGG
KHAGNKLAMQEFMILPTGATSFKESMQIGCEVYHSLKSVIKKKYGLDATNVGDEGGFAPN
ILQTRDGLNLLLEAIEKAGHKGKVDIGMDVAASEFWVPEKKVYDLDFKTANNDGSNQLTG
EALTNLYQQLVKEYGIVSIEDPFDQDDWAAYANMNALVGKTTQIVGDDLLVTNPTRVKQA
IQSKACNALLLKVNQIGSVTESIEASVLSQNAGFGVMVSHRSGETEDTFIADLVVGLATG
QIKTGAPCRSERLAKYNQLLRIEQEVGSKAVFAGKSFRNPSNLL


>TTHERM_00046480(gene)
ATGTTGAGCAAATTAACCAAGAACTTATATATGAACAAGCCTACCTTCGGCTTCTCATCT
ATCCAAAACGTCTTCGCCAGAGAAATTTTGGATTCCAGAGGTAATCCCACTATTGAAGCT
GAAGTCGTCACTTCTAAGGGTGCTTTCAGAGCTGCTGTTCCTTCTGGTGCTTCCACTGGT
ATTTATGAAGCTCTTGAACTCAGAGATGGTGACAAGAAGAGGTAAATATTGAATACATTT
ATAAAAAAAACTACAATTTCAATAAAGCTTGTTTCATCAAATTTTATACTTTGCAAATCC
AGAATCTTCAATTTTTTTTTGACTTCTTTCTACTTGGTTCTTGGGAATTAATTTTAAATA
TGTATAAGAAATTTCTACCTACTTGGCCTACTTTTTTCATAGTAGAATTGAATAAAAGAA
TCAAACACTTAGAAGATATATTTTAAAAAGATTAAACTTACATCATTATTTAAAAGATAC
TTAGGTAAGGGTGTTTAAAAGGCTGTCAACAATGTCAACAACGTTATTGCTCCTGCTTTG
AAGGGCAAGAACCCCGCTGAATAAGAAAAGTTGGACAGATTCATGGTCGAAAGCTTAGAT
GGTAGCAAGAACTAATATGGCTGGTGCAAGAGCAACTTAGGTGCTAATGCTATTTTGGGT
GTCTCCCTTGCCTTAGCCAGAGCTGGTGCTGCTGAAAAGAACATTCCTCTTTATCAATAC
TTAGGTCAATTGGCTGGTAAGAAATAAAACAAATACATCTTACCCGTACCCTCCCTCAAC
GTTATTAACGGTGGTAAGCACGCTGGTAACAAGCTTGCTATGCAAGAATTCATGATCTTG
CCCACTGGTGCCACCAGCTTCAAGGAATCTATGTAAATTGGTTGTGAAGTCTACCACTCC
CTTAAGAGTGTCATCAAGAAAAAATACGGTCTTGATGCTACCAACGTTGGTGATGAAGGT
GGTTTCGCTCCTAACATTCTCTAAACCAGAGACGGTCTTAACCTCCTCTTAGAAGCCATC
GAAAAGGCTGGTAAGAAATAAATTCTTTACCTTTACTTAACTCTTTAACTACATAAAAAT
AAATAAGAAGGCTTAGCTATTTTTCAACCCTAAATTGCGTATTTTTAATAATAGTAGTAA
AATGAAGTAAGAAATGAATAAATTTGCTTGAAATATCAAAGAAATAGCTTGAAAATTTTC
AAGAAATTATATTAAAAGCAAATAATTCTTATTAAATAAAAGTATAAGATATTTGAATAA
TAAATCGTCATTGTTGGTAGATATAACTAATAGCTAAGCTATATTTAAAATTAAATCGCA
ATTCTAAAATTTAATTAAGTTTCTATTAACGTATTAATAATCTATCTTTACAAAAAAATT
AATAAGGATTCATTCCAAAGAAACTTCTTATTAATTTCCAAATTTTACATAAAAACAGTA
AAAAAATAAAGTATAACCATAAAGAGTTTCTGCAATTTTTATAAATGAAATGCTAAATTA
TATTTATTAAAATATTTAGGCCACAAGGGTAAGGTTGACATTGGTATGGATGTTGCTGCC
TCTGAATTCTGGGTACCTGAAAAGAAGGTTTATGACTTAGATTTCAAGACTGCCAACAAC
GACGGATCTAACTAACTCACTGGTGAAGCTTTAACCAACCTCTACTAATAATTAGTTAAG
GAATACGGTATTGTCTCTATTGAAGATCCTTTCGACCAAGATGACTGGGCTGCTTATGCT
AACATGAATGCCTTAGTTGGTAAGACCACTCAAATTGTTGGTGATGATTTACTCGTTACT
AATCCTACCAGAGTTAAATAAGCTATCTAATCAAAGGCTTGCAACGCCCTTCTTTTGAAG
GTCAACTAAATCGGTTCAGTTACTGAATCTATTGAAGCTTCAGTTCTTTCTTAAGTAATT
AGCTTTTTTTTTTAACTCTTCAAATTAAAAATTTTGTATAAAAAAATAAAATTTACTTAT
TTCAATTTCTAAAAATAAAGAATGCTGGTTTTGGTGTTATGGTTTCTCACAGATCAGGTG
AAACTGAAGATACCTTCATTGCTGACTTAGTCGTTGGTTTGGCTACTGGTCAAATTAAGA
CTGGTGCTCCTTGCAGATCTGAACGTTTGGCTAAATACAACCAACTCTTAAGAATCGAAT
AAGAAGTTGGCTCAAAGGCTGTTTTTGCTGGTAAGAGCTTCAGAAACCCCTCTAACCTCC
TTTGA