Identifiers and Description

Gene Model Identifier

TTHERM_00486480

Standard Name

ENO1 (ENOlase 1)

Aliases

PreTt19579 | 59.m00217 | 3680.m00074

Description

Enolase; portions of this gene may have been laterally transferred

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03952 ) Enolase, N-terminal domain
  • ( TIGR01060 ) phosphopyruvate hydratase
  • ( PF00113 ) Enolase, C-terminal TIM barrel domain
  • ( PF01188 ) Mandelate racemase / muconate lactonizing

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00486480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_44960
Tetrahymena borealisEI9_12148.19.997093137033517e-262enolase (441 aa)
DictyBaseDDB_G02831379.997093137033517e-262enoA on chromosome: 4 position
225309 to 226956
OxytrichaContig15891.0.g729.997093137033517e-262Enolase, C-terminal TIM barrel
domain
WormBaseWBGene000118841.9999987447608204e-178locus:enol-1 Enolase statu
s:Confirmed UniProt:Q27527
protein_id:CAA92692.1
SGDYGR254W2.0002969069156684e-168ENO1 Enolase I, a phosphopyruv
ate hydratase that catalyzes t
he conversion of 2-phosphoglyc
erate to phosphoenolpyruvate d
uring glycolysis and the rever
se reaction during gluconeogen
esis; expression is repressed
in response to glucose

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17785518: Kilburn CL, Pearson CG, Romijn EP, Meehl JB, Giddings TH, Culver BP, Yates JR, Winey M (2007) New Tetrahymena basal body protein components identify basal body domain structure. The Journal of cell biology 178(6):905-12
  2. Ref:11526220: Keeling PJ and Palmer JD (2001) Lateral transfer at the gene and subgenic levels in the evolution of eukaryotic enolase. Proc Natl Acad Sci U S A 98(19):10745-50

Sequences

>TTHERM_00486480(coding)
ATGGCTACTATTAAAGATATCAAAGCTAGAGAAATACTAGATTCTAGAGGTAATCCTACT
GTTGAAGTTGATTTGACAGTAGATAATGGTCAAGTTTTTAGAGCTGCTGTTCCTTCTGGT
GCTTCAACAGGTATCTATGAAGCCTGTGAACTTAGAGACGGGGATAATCACAGATATTTA
GGGAAAGGTGTTTTGAAGGCTGTAAACAATGTGAACACCATCATTAAACCTCATTTAATT
GGTAAAAATGTTACTGAATAAGAATAATTAGATAAGTTAATGGTAGAATAGCTTGATGGA
ACTAAAAATGAATGGGGTTGGTGCAAAAGCAAATTAGGAGCAAATGCTATTTTAGCAGTT
TCTATGGCTGTTGCCAGAGCTGCCGCAGCTCATAAGAACCTTCCTTTATACAAATACTTG
TCTCATTTGAATGGATAAGACAACCTAACCCAATTCAATTTACCTCTTCCATTCTTCAAT
GTCATTAATGGTGGAAAGCATGCAGGAAACAAATTAGCTTTCTAAGAGTTTATGTTCACA
CCATGCGGTGCATCTAACTTTGCAGAAGGTCTAAGAATGGGTGCTGAGGTTTATCACAAC
TTAAAGAAAGTAATTGAAAAAAAGTACGGACAAACAGCTACTAATGTAGGTGATGAAGGA
GGTTTTGCCCCAGATACTAGTAATCCAGATGAAGCATTAGAATTACTAGTTGAAGCTATC
AAGAAGGCAGGTCATGAAGGAAAGATTAAAATATCTATGGATGTTGCAGCTTCTGAATTC
TACGACGCTAAAACTAAGCTTTATGATTTAGATTTTAAGAATAGTAACTCAGATGGTAAG
CATAAGTTAACTTCTGAATAGTTAGTTGAATACTTTGCCAATTTAGTTTCAAAATATCCA
ATTTTTTCAATTGAAGATCCTTTCGACTAGGATGACTGGGCTGCTTATGCTCAATTGACT
GCTCGTATTGGTAATTAAGTCAAGATTGTTGGTGATGACTTACTTGTTACTAACCCTTTA
CGTGCAGAAAAAGCTATTTAAGAAAAAGCCTGTAATTATCTTCTACTTAAAGTCAATCAA
ATTGGAACAGTAACAGAAGCAATTTAAACATATCAAATTGTCTCTAAAGCCAACTTTGGA
ACTATGGTCTCACATAGATCAGGTGAAACTGAAGATACTTTCATAGCTGATTTAGTTGTA
GGAATAGGTGCTGCTACAATTAAAACTGGTGCTCCCTGCAGATCTGAAAGATTAGCTAAA
TATAATTAGCTTATCAGAATTGAAGAAGAGCTTGGTCAAAATTCTACTTATGGAAAAAAT
CACTGA


>TTHERM_00486480(protein)
MATIKDIKAREILDSRGNPTVEVDLTVDNGQVFRAAVPSGASTGIYEACELRDGDNHRYL
GKGVLKAVNNVNTIIKPHLIGKNVTEQEQLDKLMVEQLDGTKNEWGWCKSKLGANAILAV
SMAVARAAAAHKNLPLYKYLSHLNGQDNLTQFNLPLPFFNVINGGKHAGNKLAFQEFMFT
PCGASNFAEGLRMGAEVYHNLKKVIEKKYGQTATNVGDEGGFAPDTSNPDEALELLVEAI
KKAGHEGKIKISMDVAASEFYDAKTKLYDLDFKNSNSDGKHKLTSEQLVEYFANLVSKYP
IFSIEDPFDQDDWAAYAQLTARIGNQVKIVGDDLLVTNPLRAEKAIQEKACNYLLLKVNQ
IGTVTEAIQTYQIVSKANFGTMVSHRSGETEDTFIADLVVGIGAATIKTGAPCRSERLAK
YNQLIRIEEELGQNSTYGKNH


>TTHERM_00486480(gene)
ATGGCTACTATTAAAGATATCAAAGCTAGAGAAATACTAGATTCTAGAGGTAATCCTACT
GTTGAAGTTGATTTGACAGTAGATAATGGTCAAGTTTTTAGAGCTGCTGTTCCTTCTGGT
GCTTCAACAGGTATCTATGAAGCCTGTGAACTTAGAGACGGGGATAATCACAGATATTTA
GGGAAAGGTGTTTTGAAGGCTGTAAACAATGTGAACACCATCATTAAACCTCATTTAATT
GGTAAAAATGTTACTGAATAAGAATAATTAGATAAGTTAATGGTAGAATAGCTTGATGGA
ACTAAAAATGAATGGGGTTGGTGCAAAAGCAAATTAGGAGCAAATGCTATTTTAGCAGTT
TCTATGGCTGTTGCCAGAGCTGCCGCAGCTCATAAGAACCTTCCTTTATACAAGTAAATA
TTTTTAAAATTCTATTTCAAATTATAAAAAGCCTCTTTACTTTATTTAAAAACCAAATCT
TATCATCTTTGCATTAACATTTTTTATGGAAGATTTTAAAACTTTGCAGCAATAAATACT
TAGGTTAAAAGCTTCATATAAACAAAAAAACATGAAATTATTTATTCCTAACTTAATATA
AATAAAATTAAACTAGATACTTGTCTCATTTGAATGGATAAGACAACCTAACCCAATTCA
ATTTACCTCTTCCATTCTTCAATGTCATTAATGGTGGAAAGCATGCAGGAAACAAATTAG
CTTTCTAAGAGTTTATGTTCACACCATGCGGTGCATCTAACTTTGCAGAAGGTCTAAGAA
TGGGTGCTGAGGTTTATCACAACTTAAAGAAAGTAATTGAAAAAAAGTACGGACAAACAG
CTACTAATGTAGGTGATGAAGGAGGTTTTGCCCCAGATACTAGTAATCCAGATGAAGCAT
TAGAATTACTAGTTGAAGCTATCAAGAAGGCAGGTCATGAAGGAAAGATTAAAATATCTA
TGGATGTTGCAGCTTCTGAATTCTACGACGCTAAAACTAAGCTTTATGATTTAGATTTTA
AGAATAGTAACTCAGATGGTAAGCATAAGTTAACTTCTGAATAGTTAGTTGAATACTTTG
CCAATTTAGTTTCAAAATATCCAATTTTTTCAATTGAAGATCCTTTCGACTAGGATGACT
GGGCTGCTTATGCTCAATTGACTGCTCGTATTGGTAATTAAGTCAAGATTGTTGGTGATG
ACTTACTTGTTACTAACCCTTTACGTGCAGAAAAAGCTATTTAAGAAAAAGCCTGTAATT
ATCTTCTACTTAAAGTCAATCAAATTGGAACAGTAACAGAAGCAATTTAAACATATCAAA
TTGTCTCTAAAGCCAACTTTGGAACTATGGTCTCACATAGATCAGGTGAAACTGAAGATA
CTTTCATAGCTGATTTAGTTGTAGGAATAGGTGCTGCTACAATTAAAACTGGTGCTCCCT
GCAGATCTGAAAGATTAGCTAAATATAATTAGCTTATCAGAATTGAAGAAGAGCTTGGTC
AAAATTCTACTTATGGAAAAAATCACTGA