Identifiers and Description

Gene Model Identifier

TTHERM_00283840

Standard Name

END5 (Endonuclease V family protein)

Aliases

PreTt04923 | 25.m00387 | 3694.m00170

Description

homolog to human protein ENDOV

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04493 ) endonuclease V
  • ( TIGR00162 ) conserved hypothetical protein TIGR00162

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00283840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09020.19.997093137033517e-262endonuclease V family protein
(307 aa)
OxytrichaContig36.1.g1249.004385969422137e-73Endonuclease V
DictyBaseDDB_G02731656.999654975490295e-63DDB_G0273165 on chromosome: 2
position 2484199 to 2485276
Stentor CoeruleusSteCoe_135312.1705220113036395e-29
WormBaseWBGene000074641.9999391735788327e-19Probable dolichyl pyrophosphat
e Glc1Man9GlcNAc2 alpha-1,3-gl
ucosyltransferase status:Par
tially_confirmed UniProt:P52
887 protein_id:CAA91145.3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00283840(coding)
ATGGAAAATATTGAAGATCAAGATAAAAAATCTTTTCATGAGCTTAGAGCTCAAATAGAC
CCAGAAGTATATGAAAAATGGGACTGTGAACAAATTTATGTCAGAGGTTTGATTACTGAA
GAAGATACTTTTGAGTGGAAATTAGATCCAAAGTCTGAAAAAGCTCTTAAATATATTGGT
GGAGTTGACATCTCTTTTTCTTAGAAGCATTAAGATATTGCTGTTGCAATCCTTGTAGTT
ATAGAATATCCAAGCTTAAAAAAAGTTCATGAAGAATTTGAGATAGTCAAATTAGATGGG
CCATACATTCCAGGTTTTCTTGCATTCAGAGAAGCAGCACATCTTGTCAAATTATTTAAA
AAGCTTTAAATTAATAAACCTCAATTTACGCCATAAGTAATTATGGTAGATGGAAATGGA
ATTCTCCATTAAAATGCTTGCGGTCTTGCAAGTCACTTGGGTGTACTTATTGATAAGCCA
ACTATTGGAGTTGGCAAGACAATTTTTTTTGTCGATGGATTAAGAAAAGATATTGTCTTA
GATAAATTTAAGAAAGTTACTGATGAAGGAGGATTTGCTATCCTTCAAGGTGATAGTGGA
AGAATTTGGGGAGCCGCTTACAAAAGCAAAAAAGATGTAGTAGATCCAATTATTGTCTCT
GTAGGACATAAGATTTCTCTTTAGAGTGCTTTAGACTTGATTTCAAAATGCTGCAACTTT
AGAATTCCTGAACCAGTTAGAGTAGCTGATATAAGGTCTAGAGAATTGGTCAAAAAAATT
ACCTTACAAGAAGCCCTTACTGCCCCAACAAATTCACTTGAATTTTTGACTGATAAATTT
GATGCTGAAAAAAAGAAAAAAGTCATGGAAAAAAAGAATCTCGTTTTTAAACCAAAAGAA
GAAGATTTCCCATCTTTATTCTGA


>TTHERM_00283840(protein)
MENIEDQDKKSFHELRAQIDPEVYEKWDCEQIYVRGLITEEDTFEWKLDPKSEKALKYIG
GVDISFSQKHQDIAVAILVVIEYPSLKKVHEEFEIVKLDGPYIPGFLAFREAAHLVKLFK
KLQINKPQFTPQVIMVDGNGILHQNACGLASHLGVLIDKPTIGVGKTIFFVDGLRKDIVL
DKFKKVTDEGGFAILQGDSGRIWGAAYKSKKDVVDPIIVSVGHKISLQSALDLISKCCNF
RIPEPVRVADIRSRELVKKITLQEALTAPTNSLEFLTDKFDAEKKKKVMEKKNLVFKPKE
EDFPSLF


>TTHERM_00283840(gene)
ATGGAAAATATTGAAGATCAAGATAAAAAATCTTTTCATGAGCTTAGAGCTCAAATAGAC
CCAGAAGTATATGAAAAATGGGACTGGTAAATAATTAAATTTTATATGAAAGAAATAAAA
TAAAATAATTTTTTAACAAAAGTGAACAAATTTATGTCAGAGGTTTGATTACTGAAGAAG
ATACTTTTGAGTGGAAATTAGATCCAAAGTCTGAAAAAGCTCTTAAATATGTATTTTCAA
AGTAATAAAGTTTTATTTTTGTAAAAAATATACAATTTAAAAAAGATTGGTGGAGTTGAC
ATCTCTTTTTCTTAGAAGCATTAAGATATTGCTGTTGCAATCCTTGTAGTTATAGAATAT
CCAAGCTTAAAAGTAGACTTTTTATTTTACTCAATTAACTAAATTATAAATATTTCTTTT
TTTAATAAAACAGAAAGTTCATGAAGAATTTGAGATAGTCAAATTAGATGGGCCATACAT
TCCAGGTTTTCTTGCATTCAGAGAAGCAGCACATCTTGTCAAATTATTTAAAAAGCTTTA
AATTAATAAACCTCAATTTACGCCATAAGTAATTATGGTAGATGGAAATGGAATTCTCCA
TTAAAATGCTTGCGGTCTTGCAAGTCACTTGGGTGTACTTATTGATAAGCCAACTATTGG
AGTTGGCAAGACAATTTTTTTTGTCGATGGATTAAGAAAAGTACATATTTATTTAAAAAT
ATAATTATTTATTTTATAAACATCAATTTATCCTCAATTTAATAAAAATTAGGATATTGT
CTTAGATAAATTTAAGAAAGTTACTGATGAAGGAGGATTTGCTATCCTTCAAGGTGATAG
TGGAAGAATTTGGGGAGCCGTAAAAATTAATTTTTTATCTAATTGTATTAATAATTTTAT
TTAAAAAAGGCTTACAAAAGCAAAAAAGATGTAGTAGATCCAATTATTGTCTCTGTAGGA
CATAAGATTTCTCTTTAGAGTGCTTTAGACTTGATTTCAAAATGCTGCAACTTTAGAATT
CCTGAACCAGTAATAAATATTATAATTAACTAATAAACTAAACTCTTTAAATATTTTAGG
TTAGAGTAGCTGATATAAGGTCTAGAGAATTGGTCAAAAAAATTACCTTACAAGAAGCCC
TTACTGCCCCAACAAATTCACTTGAATTTTTGACTGATAAATTTGATGCTGAAAAAAAGA
AAAAAGTCATGGAAAAAAAGAATCTCGTTTTTAAACCAAAAGAAGAAGATTTCCCATCTT
TATTCTGA