Identifiers and Description

Gene Model Identifier

TTHERM_00559720

Standard Name

EML12 (EMAP-Like Protein 12)

Aliases

PreTt27835 | 74.m00112 | 3720.m00003

Description

HELP domain protein; HELP domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00036 ) EF hand
  • ( PF03451 ) HELP domain
  • ( TIGR01612 ) rhoptry protein
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF07494 ) Two component regulator propeller
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF08450 ) SMP-30/Gluconolaconase/LRE-like region
  • ( PF08662 ) Eukaryotic translation initiation factor eIF2A
  • ( TIGR02276 ) 40-residue YVTN family beta-propeller repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00559720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_216080
Tetrahymena borealisEI9_16181.19.997093137033517e-262HELP domain-containing protein
(2299 aa)
OxytrichaContig14813.0.g809.997093137033517e-262WD domain, G-beta repeat
WormBaseWBGene000012484.0009493637353324e-18locus:elp-1 status:Partially
_confirmed UniProt:C4ALD8
protein_id:CAY39358.1
DictyBaseDDB_G02846210.0000000006000548789370351pwp2 on chromosome: 4 position
2240813 to 2244334
SGDYCR084C0.0000020007268868677913TUP1 General repressor of tran
scription, forms complex with
Cyc8p, involved in the establi
shment of repressive chromatin
structure through interaction
s with histones H3 and H4, app
ears to enhance expression of
some genes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00559720(coding)
ATGGTTGATAATAATGAAGGAGTTATACTTTATTTTAGTTATAGTCAATACATTTATTCA
TTCATCCATAAAGACAATTTATTATCTATATTATTGAAATCTTTTTCATCCTATTTGCTA
ATATGTATTTTTTTGTATAGATTATTCTCAGCAATAAATAAAATTGCATATTGTGTAAAT
AAAAGTTCATATCACTTTGAAGAAAACTAAGGAGTTTTGTTATATATTTTTTATAAAAAC
AATCAATTTTAATTAAAAAATTAGCACAAGTTCTAATAAAAAACCTTTTTAAATAAATAT
AAATACTAACTAGATAAAATGGGTAACTAAATCATGGGCAATTTTAGAAAAGCCCGTTAT
AAAGGATTTACAGAAGATCAAATAAACTATTTAAAAGATAAATTTAGTTTGATGTGCGAT
GACAAAGGGTTTTTAGATGTAAATAAGCTCAAAAATGTTTATAAATGTGATTTTGAATAA
GCTAAGAGGGTTTTTGAATTTTTAGATATGGAGGGCAGTGGAACTGTAGATTTTTATAAA
TTCACATGCGGCTCTGCTATTTTGTGTCAAGCTCCTTTAAAGGAAACCGCTTCACTATTG
TATGATATTTTTAACATCCGTAAAAAAGATAATATCGCAGCTGATGAATTGAAGTTATTT
GTGCGTACTTATATGCAATACTCAGCGTTTTTGGATGATTAGTCTATTTAGGAAGAAGAT
ATAGATAATAAAACAAAAGCATTAATGAAAAAATGGGATTTAGACAGAGATGGTTAACTC
AGTATAGATGAATGGGAAGTTATGCTTTAAAGAGATCCTGATCTTAAGTTTTATATGTTT
AGAATGGGTTTTATTACTCGTGCAGAAATGGGTTATGAAGAAGACCAATATGAAGATTGT
GATAGCGATCTAGAAATAGAACTAGATAGAAAAAACATGGATAGAGATGAAAGAATAGAA
AAGATTAAAAGTGGTATTGAGCATAATGAAAAAGCAGACGGAGAAGATGCAGATTAGTTT
GAAAGTGAAGTAAAAGAAAAAGGTGATTAATTCCGTGCAAATGATAGCTGGAAAATTTGT
AAGAATTTCCCTCCAAGCACTTATTAATAAAAAAAGAGTGATTCTGAAGCTCCTAAAGCT
ACATTAGATTTAGATTATATTCATGGCTATAGATGCCACGATGCAAGAAATAATTTGAAA
TTTGGAGTTGGTGATTCAATTATTTATCATACAGCTGCAGTTGGCATTAAATTAGATCCT
AAATCAAATAAATAGCAATTCAATTTTGAACACAATGATGATATTACTTGCTTAGACATT
TCTTAAAATGGTGAGCGCGTTGTGACAGGTTAAGTAGGAGCCAAACCACTATTATGTGTT
TGGAATACTACTGACATGTCCACTCTCATAGTTTTTTCTGGAGATCTTTTAAAAGGTATT
GGTAACTGTTGTATTTCTCCTGACGGACGTATAGTTGCTGCTAATGCCTTGGATGATTAT
CATACAGTTTGTGTATATGATGTTGATGCAGCTATTGAAGCTAAGAAGAATATTAACTCA
AAAACTACTGGTTTAGTTTCAAGCGGAAGATGCACAAGAGCTGAAATTTTACATTTGAAA
TTCCATCCTACAGAAAAGCTTATTATAGCTGCATGCATGAAAGAAATTTAATTTATCACT
TATGGTGGTAAAGAAATTAAGTGTTAAAAAGGTATATGGGGTAAGTAATCACCTTAAGCA
GTTATGGCAGTAACATTCATTAATAATGACTGCATAACTGGTATGTTTAATGGTAATATC
TTTACTTGGTAAGGCTAAAGTTTAGGAAATGTCATTAAAGCACATAATGGACCATGCACA
TCTATTTCTAATCGCAAGAAAGGAAATGGATTCATCACTGGTGGTAAAAATGGAGATATT
ATGATTTGGAATGAAAGTTACAAATGTATTGGCACTCTTAACATTTAAGACTGCTTTACT
GTAAAGCTTCCCTAAATTAAAGTCATATCTCTTTGCGAAAATAGTTAAGGAGATCTTTTA
GTAGGTCTTCGTGGTAGTGAAGTTATTTTGATTAGTAAAGGAGATAAAACAAAAGCTGCA
ATCCTTAATCAAGGACATTATGATTAAGAACTTTGGGGTTTAGCCGTTCACCCTGACTCT
AAGAGTTATTTCACATCAGGTGAAGATAAACTACTTTGTAAATTTGATGTCAGCAGTAGA
AAAATCATATCTAAAACAATATTGTAATATGCATCCAAGACTTTAGCTATTTCTCCAGAT
GGTAAATACTTAGCTGTTGGTATGAAGAATGGCCTTGTTTAAATTCTAGACCCAAAAAGT
TTATCTGAAATAACATAAATTAAGGAATTTATCAATCCCGATAAAGATTTGGTTAGCTAT
ATGAAATTCTCACCAGACAGTAAACAACTTTTAATCGCTTACAGTCCTCCTATTTCTAAT
GTTCTTGGATTTGATGTTCCTTCTTTCAAAAAGAAATATGTAATGAAAGGTTCTCCATCC
AGAATTTCATCAATTGATTTCTCAACTGATGGTACTGCCATTTAACTTAACAATACTTCC
TATGAAATTCTACATTTTTCTACCTCTAATGGAGTATAGGAAAAATCAGGTATGACAAAA
TATAGAGACGAAAAGTGGGCAACTTGGAACTTGACACTTGGATGGCCAACCTAAGGTATT
TGGCCTCCTTGCACAAGTGGTGATGATATTAACAGTGTAGATAGAACTCCTACTGGAGAT
ATCCTTGCAACTGCTGATGATTTTAGTAAGATCAAGCTTTTTAAATTCCCTTGTCCTATT
GAAAAAAGCTCATTTACCAAATATAATGGTCATAGCTCTCATGTCACAAATGTTAAATTT
ACTTAGGATGAAAAGATGTTAATTTCTACAGGTGGTGAAGAAAAATCTGTTTTCTAATGG
AAATTCCAAAGAGAGCAATAGCAAAATTAGCAATAAGAAGAAGAAGAAGAACCTCAAGAA
GAAGATGATGGACTTTTTGGTGAAGCAGAAGTTGAAAAGGGTGATTAAGCTCTTGCAGTC
AAGGCGTTCTTGGGTGAAGTTAAAAATAGTACTCCTTCAAATTATCAACCCAATCCTAAA
AAATATAATGTAAAACCTGATGGAGATATTTCTCTTGATACAGTACATGGATACAGACAT
TTTTACATCAAGGACGAATGCAGAGATATGGTCAAATATTCTAGTGACTATAAAAGCATT
GTATACCCTGCTGCAGCAGTTGGTGTTAAATAAGAGAAAAAATTAGGTGGATTATAAAAA
TTCTTTATCAAGCATGTTGAAGATATCGTGTCATTTTCAATACATCCTACTCGTACTGTA
GCTGCTACAGGTCAAATGGCAGCAAAAGGTGCAGCAGCTAAGTGTCTTGATTTATTTGTT
TGGGATGTTAACACTATGGAAATTAAGGCTCACTTCAATGAATTCCATAGAAGAGCAATT
GTTTTGACATCTTTCAGTCCAAATGGTTAACTATTGCTGTCTGTTGGTCAAGATGATGAT
AACTCTCTTGCTATCCATGAATGGTAGGCTAAGAGATTAGTTACTACAAGTCCTGTTGAT
AAAGCTAAAATCACAGCTGTAATTTGGAAAAGTGATACAGAATTCGTTACTACTGGCTTT
AAAGTAGTAAAGTTTTGGACATTAAATGGAAGAAACGTAAAGGGAACAAATGGAAGTGTA
GGTGGAGCTAAATTTGTTTCATAGTTTTGTGGTGTTTATGTTGGTTAAACTTTATTCACG
GGCTCTGGCGAGGGTTAAATATTTTCTTGGAATGGCTCAGCTGGTGCTGAAGTTAAAGGT
GCTAAGCATGACAAAAAAGTACAAAGTATTATTTATGATCAAACATCAAAATGTGTTTTC
TCTGGAGCTATGGATGGAAAAATTCTTAAGTGGTAGGTAGCAAGTGGAACATTAAAGTCT
GCAGGAGTTTATTATGATTTAAATACTTTAGATTCACCAACCAAATTTTAGTATTAATGC
GGTGTAACTTCTATTGATACAGCACCTGATGGTAATATGCTTGTAGCAACTAGTGGAGGA
GAAGTATATGAAATTTCTGGAAAGAACTGCAACTTACTCTTGTAGAGCCACTATGAAAAT
GAATTGTGGGGTCTAGCAGTTTCACCTACTAATCCTAATTTGTATATCACTAGTGGAGGA
GATAAAACAATAAGACTTTGGGATATTAAAAAAAGAAAAATGATAACTTCCACCAAGCCC
ATGAAAAATGATGTAAAAGGTATTCACTGGGGAGTTTAAAATGGTAAAGAATTTGTTGTT
GCTGGAGATGATTTAGGTTTTGTCTATTTGCTGAATCCTTAAACTTTAGAAGTTTTAGCA
ACTCATAATTCAAGCTTTACAAAATAGAAAGCTAGATAGTCTACTTACTGGATTGAAGAT
ATTAAAATATCTCCTGATGGTACTTAAGTAGCTTTCGGTGCTCACGGTGGTGCTTCTAAG
CTTGAAATAGTAAAAGTAGAAGGAGGATAGAAGTTTGGATCATCATTTGAAATTAATTGT
GGTTTGACATCTGCACTTCTTCATGTTGACTGGTCAGTTGATTCAACAGTTTGTGTTGTC
AATTCATAAGCTTATGAGCTTAAGTTTGTCTCTATTCCTGCCAAGAAGAATATGGCTTCA
TCTGCAGCTAAAGATATAGAATTCGCTTCATGGACTTGTAAAATAGGTTTCCCTGTATAA
GGTGTTTTCTAAGGCGTTGACTATACAGATGTTAATGCAGTTTGCAGATCATCTAGCGGA
TTGTATTTGGCTTCAGGAAATGATGATAGTTAGGTTAAGCTTTTCAAGTATCCAGTAGTT
GTTGAAAAGTAAGTACACAAGGGATACTACGGTCATAGTTCTCATGTTACAAGAGTCCGT
TTTACTATTGATGATTCATATCTAGTGTCAACAGGTGGTAATGATAAATGTGTCATGGTA
TGGAAAACAACTTTTGGAAGTGGTGGAAAGTAAGACTTCCATCCAATGTCTGCAATTGAA
GAGAGTAATAACAACAATGATGATATTGATGTTCCTGTTTAAAAGAAAAAACCAAAGGGT
GCTGAAAAGTATGCAGATTAAGAAGAGGATGAAAATTAATAAGAAGAACATAGCAATGAA
ATGTTTGGATAAGAAGATTTAGATAAAGGTGATGAATTCATGGCAGTAAAACCTTGGTTG
GGTGCTATCAAAGAACCTTCTTACAAATACTTCAAGGACAAAAACTAATTTGAAGAACCT
CCTGTTACAATTAATCCTTATTATGTTTTTGGTATTCGTACTAAGGACTAAAGAGGAAAT
TTGAGATATACATCATCTGGTAAAATTGTTTACAATGCTGCTGCTCTCGGTATAGTCTTG
GATGTCGAAAATAATACTCAAACATTCTTTAACAAGCATACAGATGATATTATTTCTCTA
GATCTTCATCCAGATGGCAACCTCGTTGCTACTGGTGAAATAGGGCCTAAGCCATACATT
TACATATGGGATTCTGAAACTAAGGAAGTTAAAAATTCTTGGAAGGGTGCTATCCTAAAG
GGTATTGCATGTCTTGCATTCTCTCCTTCTGGTAATAAATTAGTTGCAGCTGCTATTAAT
GATGATCATCAAATTGGTGTGTTTGATCTCAAATCAAATGCAGTCATGGCTTTTAAGGGT
GGTCCTGAAGTCATAGTCGATTGCGATTGGGTTAATGAAGATAACTTTGTTACTGTAGGT
GTTAAACATTTTAAGCTTTGGGCACCTGCTGGCAAAGCATACAAAGAGACTAAAGGTGAT
AAAACAAACTTTGTATTCTCAGGATTAGCATTTATTAACAACTAAACCCTTGTAGGAACT
TCTACAGGTGACTTATAGGTTTGGTAAGGAAACAGTTTTACTCGTAACTCACAAGACAAA
AAGTTACATGAAAAGGGTATTGAAACTATCAGAGTCGATCAAAATTATGTCTTCACTGGA
GGTAAAGATTGCAAAGTAAACATTTTAGGAAAAGACCTAAAAGTTATCACTTCAATCAAC
GTGGCAGAACTATTTCCAGAAACTCTAAGTGGTGAAGTTAGAAGTATTTGTCCTAGTTAA
GATTTGAAGAGAGTATTAGTTGCTACACTTGCTTGTGAAATTATTGAATTCGAAGCAAGC
CAAGTACCTTATACTTCTAATACTAAATTTTCTTTTAGAAACTGCTATATGAAAGGCCAT
TTCTCTCCTAACTTAAAGTGGACTAATGAAGTTTGGGGTTTATCAGTGTTCCCTGACACT
GATACATTTGCAACTTGCTCTGATGATGGTACATTAAGAGTTTGGTCTCTTCCTGAAAGA
AAGCAAATTGCTTTAATTAAGACTAACTTAAATAAAGAAAACTCTGAAACCCCTAGAGAC
CCAGCAACTGGTGATTTCGCAGATTCTGTTAAAGGAAGAGCCCTTGCCGTTTCACCTGAA
GGTAATACAATTGTAGCAGGTTTTAAAGAAGGAACACTAAAAGAATTCACTGTTAGTGGA
GAAGGATCAGAAATGAAATTAGAATAAACAAAAGTTATCAAGCATGCTTAAAGATGGATA
TCCGATATAAAATTCTCACCAGATGGTACAACTTTAGTAGCAGGAGCTCATGATTAAACT
ATATATGCTTACAATTTACCAGATTGGAAACCCCGTTGCAAACCCATGAAAAAGCACTCT
TCATACATCACCCATATAGATTTCTCAAGATGCGGTAACTATCTCCATAGTACATGTGGA
GCTTATGAGCTTTTATTCTGGGAAGCAAACACTGGCAAATAGCTAACATCCGGTGCTAGC
GCTCTTAAAGACGAATTATGGGCTACATGGAATGTCACTCTTGGATGGCCAGTTCAAGGT
ATATGGCCTGAGTGTGCAGATGGTACTGACATAAATGCAGTAGACAGATCAAACTTTACC
ATAGCTAAGAATAAAGACATTGAAAAATCTTATCATTTATTAGCAACAGGAGATGATTTC
TCTCATGTAAGAATTCTTAGATTCCCATCACTAAAAAAGAGCTCCAAGGGTGTCATAGGA
TATGGCCACTCTTCACATGTCACAAACGTAAAGTGGACCAAAGATGATTAATACATATAC
TCAACTGGTGGTGAAGATTAATGTGTCATAATTTGGAAAGTTGATAAAAAATGA


>TTHERM_00559720(protein)
MVDNNEGVILYFSYSQYIYSFIHKDNLLSILLKSFSSYLLICIFLYRLFSAINKIAYCVN
KSSYHFEENQGVLLYIFYKNNQFQLKNQHKFQQKTFLNKYKYQLDKMGNQIMGNFRKARY
KGFTEDQINYLKDKFSLMCDDKGFLDVNKLKNVYKCDFEQAKRVFEFLDMEGSGTVDFYK
FTCGSAILCQAPLKETASLLYDIFNIRKKDNIAADELKLFVRTYMQYSAFLDDQSIQEED
IDNKTKALMKKWDLDRDGQLSIDEWEVMLQRDPDLKFYMFRMGFITRAEMGYEEDQYEDC
DSDLEIELDRKNMDRDERIEKIKSGIEHNEKADGEDADQFESEVKEKGDQFRANDSWKIC
KNFPPSTYQQKKSDSEAPKATLDLDYIHGYRCHDARNNLKFGVGDSIIYHTAAVGIKLDP
KSNKQQFNFEHNDDITCLDISQNGERVVTGQVGAKPLLCVWNTTDMSTLIVFSGDLLKGI
GNCCISPDGRIVAANALDDYHTVCVYDVDAAIEAKKNINSKTTGLVSSGRCTRAEILHLK
FHPTEKLIIAACMKEIQFITYGGKEIKCQKGIWGKQSPQAVMAVTFINNDCITGMFNGNI
FTWQGQSLGNVIKAHNGPCTSISNRKKGNGFITGGKNGDIMIWNESYKCIGTLNIQDCFT
VKLPQIKVISLCENSQGDLLVGLRGSEVILISKGDKTKAAILNQGHYDQELWGLAVHPDS
KSYFTSGEDKLLCKFDVSSRKIISKTILQYASKTLAISPDGKYLAVGMKNGLVQILDPKS
LSEITQIKEFINPDKDLVSYMKFSPDSKQLLIAYSPPISNVLGFDVPSFKKKYVMKGSPS
RISSIDFSTDGTAIQLNNTSYEILHFSTSNGVQEKSGMTKYRDEKWATWNLTLGWPTQGI
WPPCTSGDDINSVDRTPTGDILATADDFSKIKLFKFPCPIEKSSFTKYNGHSSHVTNVKF
TQDEKMLISTGGEEKSVFQWKFQREQQQNQQQEEEEEPQEEDDGLFGEAEVEKGDQALAV
KAFLGEVKNSTPSNYQPNPKKYNVKPDGDISLDTVHGYRHFYIKDECRDMVKYSSDYKSI
VYPAAAVGVKQEKKLGGLQKFFIKHVEDIVSFSIHPTRTVAATGQMAAKGAAAKCLDLFV
WDVNTMEIKAHFNEFHRRAIVLTSFSPNGQLLLSVGQDDDNSLAIHEWQAKRLVTTSPVD
KAKITAVIWKSDTEFVTTGFKVVKFWTLNGRNVKGTNGSVGGAKFVSQFCGVYVGQTLFT
GSGEGQIFSWNGSAGAEVKGAKHDKKVQSIIYDQTSKCVFSGAMDGKILKWQVASGTLKS
AGVYYDLNTLDSPTKFQYQCGVTSIDTAPDGNMLVATSGGEVYEISGKNCNLLLQSHYEN
ELWGLAVSPTNPNLYITSGGDKTIRLWDIKKRKMITSTKPMKNDVKGIHWGVQNGKEFVV
AGDDLGFVYLLNPQTLEVLATHNSSFTKQKARQSTYWIEDIKISPDGTQVAFGAHGGASK
LEIVKVEGGQKFGSSFEINCGLTSALLHVDWSVDSTVCVVNSQAYELKFVSIPAKKNMAS
SAAKDIEFASWTCKIGFPVQGVFQGVDYTDVNAVCRSSSGLYLASGNDDSQVKLFKYPVV
VEKQVHKGYYGHSSHVTRVRFTIDDSYLVSTGGNDKCVMVWKTTFGSGGKQDFHPMSAIE
ESNNNNDDIDVPVQKKKPKGAEKYADQEEDENQQEEHSNEMFGQEDLDKGDEFMAVKPWL
GAIKEPSYKYFKDKNQFEEPPVTINPYYVFGIRTKDQRGNLRYTSSGKIVYNAAALGIVL
DVENNTQTFFNKHTDDIISLDLHPDGNLVATGEIGPKPYIYIWDSETKEVKNSWKGAILK
GIACLAFSPSGNKLVAAAINDDHQIGVFDLKSNAVMAFKGGPEVIVDCDWVNEDNFVTVG
VKHFKLWAPAGKAYKETKGDKTNFVFSGLAFINNQTLVGTSTGDLQVWQGNSFTRNSQDK
KLHEKGIETIRVDQNYVFTGGKDCKVNILGKDLKVITSINVAELFPETLSGEVRSICPSQ
DLKRVLVATLACEIIEFEASQVPYTSNTKFSFRNCYMKGHFSPNLKWTNEVWGLSVFPDT
DTFATCSDDGTLRVWSLPERKQIALIKTNLNKENSETPRDPATGDFADSVKGRALAVSPE
GNTIVAGFKEGTLKEFTVSGEGSEMKLEQTKVIKHAQRWISDIKFSPDGTTLVAGAHDQT
IYAYNLPDWKPRCKPMKKHSSYITHIDFSRCGNYLHSTCGAYELLFWEANTGKQLTSGAS
ALKDELWATWNVTLGWPVQGIWPECADGTDINAVDRSNFTIAKNKDIEKSYHLLATGDDF
SHVRILRFPSLKKSSKGVIGYGHSSHVTNVKWTKDDQYIYSTGGEDQCVIIWKVDKK


>TTHERM_00559720(gene)
ATGGTTGATAATAATGAAGGAGTTATACTTTATTTTAGTTATAGTCAATACATTTATTCA
TTCATCCATAAAGACAATTTATTATCTATATTATTGAAATCTTTTTCATCCTATTTGCTA
ATATGTATTTTTTTGTATAGATTATTCTCAGCAATAAATAAAATTGCATATTGTGTAAAT
AAAAGTTCATATCACTTTGAAGAAAACTAAGGAGTTTTGTTATATATTTTTTATAAAAAC
AATCAATTTTAATTAAAAAATTAGCACAAGTTCTAATAAAAAACCTTTTTAAATAAATAT
AAATACTAACTAGATAAAATGGGTAACTAAATCATGGGCAATTTTAGAAAAGCCCGTTAT
AAAGGATTTACAGAAGATCAAATAAACTATTTAAAGTAAAATTTTAAATAATATGTTTAG
CATAATTTAACATAATTCTCAATACATACATTTTAAGTTGAAAATTTTATGACTCATGAG
TGAATTAATTTATTACTAATAATTATTAGAGATAAATTTAGTTTGATGTGCGATGACAAA
GGGTTTTTAGATGTAAATAAGCTCAAAAATGTTTATAAATGTGATTTTGAATAAGCTAAG
AGGGTAACCAATTCAATTATTTTTCAGTTATGACGAACTTCAATTTTATAATATAAATTA
TAGGTTTTTGAATTTTTAGATATGGAGGGCAGTGGAACTGTAGATTTTTATAAATTCACA
TGCGGCTCTGCTATTTTGTGTCAAGCTCCTTTAAAGGAAACCGCTTCACTATTGTATGAT
ATTTTTAACATCCGTAAAAAAGATAATATCGCAGCTGATGAATTGAAGTTATTTGTGCGT
ACTTATATGCAATACTCAGCGTTTTTGGATGATTAGTCTATTTAGGAAGAAGATATAGAT
AATAAAACAAAAGCATTAATGAAAAAATGGGATTTAGACAGAGATGGTTAACTCAGTATA
GATGAATGGGAAGTTATGCTTTAAAGAGATCCTGATCTTAAGTTTTATATGTTTAGAATG
GGTTTTATTACTCGTGCAGAAATGGGTTATGAAGAAGACCAATATGAAGATTGTGATAGC
GATCTAGAAATAGAACTAGATAGAAAAAACATGGATAGAGATGAAAGAATAGAAAAGATT
AAAAGTGGTATTGAGCATAATGAAAAAGCAGACGGAGAAGATGCAGATTAGTTTGAAAGT
GAAGTAAAAGAAAAAGGTAAATAAATAAATAAACAAATAAATAGCTACTTAATTTATAAT
ATAATTAACAAAATTTTTATAGATGAGCGATAAAATTTAAATTAATTTAATTGAATTAAA
TTTATAATTAATTATTAAAAACGTATTATTTAATACTAACATAATTTATTTCAAAAACAT
TTTTTAAAGAATAAATATTAAATTTAAATTATTTTTTTTTAACACATTATTAAATAATTA
TTTTTAAATTTTAAGGTGATTAATTCCGTGCAAATGATAGCTGGAAAATTTGTAAGAATT
TCCCTCCAAGCACTTATTAATAAAAAAAGAGTGATTCTGAAGCTCCTAAAGCTACATTAG
ATTTAGATTATATTCATGGCTATAGATGCCACGATGCAAGAAATAATTTGAAATTTGGAG
TTGGTGATTCAATTATTTATCATACAGCTGCAGTTGGCATTAAATTAGATCCTAAATCAA
ATAAATAGCAATTCAATTTTGAACACAATGATGATATTACTTGCTTAGACATTTCTTAAA
ATGGTGAGCGCGTTGTGACAGGTTAAGTAGGAGCCAAACCACTATTATGTGTTTGGAATA
CTACTGACATGTCCACTCTCATAGTTTTTTCTGGAGATCTTTTAAAAGGTATTGGTAACT
GTTGTATTTCTCCTGACGGACGTATAGTTGCTGCTAATGCCTTGGATGATTATCATACAG
TTTGTGTATATGATGTTGATGCAGCTATTGAAGCTAAGAAGAATATTAACTCAAAAACTA
CTGGTTTAGTTTCAAGCGGAAGATGCACAAGAGCTGAAATTTTACATTTGAAATTCCATC
CTACAGAAAAGCTTATTATAGCTGCATGCATGAAAGAAATTTAATTTATCACTTATGGTG
GTAAAGAAATTAAGTGTTAAAAAGGTATATGGGGTAAGTAATCACCTTAAGCAGTTATGG
CAGTAACATTCATTAATAATGACTGCATAACTGGTATGTTTAATGGTAATATCTTTACTT
GGTAAGGCTAAAGTTTAGGAAATGTCATTAAAGCACATAATGGACCATGCACATCTATTT
CTAATCGCAAGAAAGGAAATGGATTCATCACTGGTGGTAAAAATGGAGATATTATGATTT
GGAATGAAAGTTACAAATGTATTGGCACTCTTAACATTTAAGACTGCTTTACTGTAAAGC
TTCCCTAAATTAAAGTCATATCTCTTTGCGAAAATAGTTAAGGAGATCTTTTAGTAGGTC
TTCGTGGTAGTGAAGTTATTTTGATTAGTAAAGGAGATAAAACAAAAGCTGCAATCCTTA
ATCAAGGTAAGCTATTTATGAAATTAATAGTTTGTTAAATGATATTTTTAAATTATTTAT
ATGTAGGACATTATGATTAAGAACTTTGGGGTTTAGCCGTTCACCCTGACTCTAAGAGTT
ATTTCACATCAGGTGAAGATAAACTACTTTGTAAATTTGATGTCAGCAGTAGAAAAATCA
TATCTGTAAATTATATTTTTATAAATTAATTGCTAAAAAAATTATTTACCTAAATAGAAA
ACAATATTGTAATATGCATCCAAGACTTTAGCTATTTCTCCAGATGGTAAATACTTAGCT
GTTGGTATGAAGAATGGCCTTGTTTAAATTCTAGACCCAAAAAGTTTATCTGAAATAACA
TAAATTAAGGAATTTATCAATCCCGATAAAGATTTGGTTAGCTATATGAAATTCTCACCA
GACAGTAAACAACTTTTAATCGCTTACAGTCCTCCTATTTCTAATGTTCTTGGATTTGAT
GTTCCTTCTTTCAAAAAGAAATATGTAATGAAAGGTTCTCCATCCAGAATTTCATCAATT
GATTTCTCAACTGATGGTACTGCCATTTAACTTAACAATACTTCCTATGAAATTCTACAT
TTTTCTACCTCTAATGGAGTATAGGAAAAATCAGGTATGACAAAATATAGAGACGAAAAG
TGGGCAACTTGGAACTTGACACTTGGATGGCCAACCTAAGGTATTTGGCCTCCTTGCACA
AGTGGTGATGATATTAACAGTGTAGATAGAACTCCTACTGGAGATAGTAATTAATCAACA
AAGACATAATATTTTTATTTATAAATTATCATAATATTATTTTAGTCCTTGCAACTGCTG
ATGATTTTAGTAAGATCAAGCTTTTTAAATTCCCTTGTCCTATTGAAAAAAGCTCATTTA
CCAAATATAATGGTCATAGCTCTCATGTCACAAATGTTAAATTTACTTAGGATGAAAAGA
TGTTAATTTCTACAGGTGGTGAAGAAAAATCTGTTTTCTAATGGAAATTCCAAAGAGAGC
AATAGCAAAATTAGCAATAAGAAGAAGAAGAAGAACCTCAAGAAGAAGATGATGGACTTT
TTGGTGAAGCAGAAGTTGAAAAGGGTGATTAAGCTCTTGCAGTCAAGGCGTTCTTGGGTG
AAGTTAAAAATAGTACTCCTTCAAATTATCAACCCAATCCTAAAAAATATAATGTAAAAC
CTGATGGAGATATTTCTCTTGATACAGTACATGGATACAGACATTTTTACATCAAGGACG
AATGCAGAGATATGGTCAAATATTCTAGTGACTATAAAAGCATTGTATACCCTGCTGCAG
CAGTTGGTGTTAAATAAGAGAAAAAATTAGGTGGATTATAAAAATTCTTTATCAAGCATG
TTGAAGATATCGTGTCATTTTCAATACATCCTACTCGTACTGTAGCTGCTACAGGTCAAA
TGGCAGCAAAAGGTGCAGCAGCTAAGTGTCTTGATTTATTTGTTTGGGATGTTAACACTA
TGGTAATTTCAGCATTTTTAAATTTAAAATTCAATTTAAATAAAAAAAAATAGGAAATTA
AGGCTCACTTCAATGAATTCCATAGAAGAGCAATTGTTTTGACATCTTTCAGTCCAAATG
GTTAACTATTGCTGTCTGTTGGTCAAGATGATGATAACTCTCTTGCTATCCATGAATGGT
AGGCTAAGAGATTAGTTACTACAAGTCCTGTTGATAAAGCTAAAATCACAGCTGTAATTT
GGAAAAGTGATACAGAATTCGTTACTACTGGCTTTAAAGTAGTAAAGTTTTGGACATTAA
ATGGAAGAAACGTAAAGGGAACAAATGGAAGTGTAGGTGGAGCTAAATTTGTTTCATAGT
TTTGTGGTGTTTATGTTGGTAATAAATTTGTTTTTAGTTTTAAAGTAAAATGTAATTATT
CTTTTTGTTAAATTATTAGGTTAAACTTTATTCACGGGCTCTGGCGAGGGTTAAATATTT
TCTTGGAATGGCTCAGCTGGTGCTGAAGTTAAAGGTGCTAAGCATGACAAAAAAGTACAA
AGTATTATTTATGATCAAACATCAAAATGTGTTTTCTCTGGAGCTATGGATGGAAAAATT
CTTAAGTGGTAGGTAGCAAGTGGAACATTAAAGTCTGCAGGAGTTTATTATGATTTAAAT
ACTTTAGATTCACCAACCAAATTTTAGTATTAATGCGGTGTAACTTCTATTGATACAGCA
CCTGATGGTAATATGCTTGTAGCAACTAGTGGAGGAGAAGTATATGAAATTTCTGGAAAG
AACTGCAACTTACTCTTGTAGAGCCACTATGAAAATGAATTGTGGGGTCTAGCAGTTTCA
CCTACTAATCCTAATTTGTATATCACTAGTGGAGGTAATTAATTAATTTTAAATATTTAT
TTTAATTAAGATTTGATCTTTAAAATCTATTAATAAATAAATAGGAGATAAAACAATAAG
ACTTTGGGATATTAAAAAAAGAAAAATGATAACTTCCACCAAGCCCATGAAAAATGATGT
AAAAGGTATTCACTGGGGAGTTTAAAATGGTAAAGAATTTGTTGTTGCTGGAGATGATTT
AGGTTTTGTCTATTTGCTGAATCCTTAAACTTTAGAAGTTTTAGCAACTCATAATTCAAG
CTTTACAAAATAGAAAGCTAGATAGTCTACTTACTGGATTGAAGATATTAAAATATCTCC
TGATGGTACTTAAGTAGCTTTCGGTGCTCACGGTGGTGCTTCTAAGCTTGAAATAGTAAA
AGTAGAAGGAGGATAGAAGTTTGGATCATCATTTGAAATTAATTGTGGTTTGACATCTGC
ACTTCTTCATGTTGACTGGTCAGTTGATTCAACAGTTTGTGTTGTCAATTCATAAGCTTA
TGAGCTTAAGTTTGTCTCTATTCCTGCCAAGAAGAATATGGCTTCATCTGCAGCTAAAGA
TATAGAATTCGCTTCATGGACTTGTAAAATAGGTTTCCCTGTATAAGGTGTTTTCTAAGG
CGTTGACTATACAGATGTTAATGCAGTTTGCAGATCATCTAGCGGATTGGTAATTAATTT
TTTAGTTTTTGATTTATCTATAAAATTACTAATTGCAAATTTAGTATTTGGCTTCAGGAA
ATGATGATAGTTAGGTTAAGCTTTTCAAGTATCCAGTAGTTGTTGAAAAGTAAGTACACA
AGGGATACTACGGTCATAGTTCTCATGTTACAAGAGTCCGTTTTACTATTGATGATTCAT
ATCTAGTGTCAACAGGTGGTAATGATAAATGTGTCATGGTATGGAAAACAACTTTTGGAA
GTGGTGGAAAGTAAGACTTCCATCCAATGTCTGCAATTGAAGAGAGTAATAACAACAATG
ATGATATTGATGTTCCTGTTTAAAAGAAAAAACCAAAGGGTGCTGAAAAGTATGCAGATT
AAGAAGAGGATGAAAATTAATAAGAAGAACATAGCAATGAAATGTTTGGATAAGAAGATT
TAGATAAAGGTGATGAATTCATGGCAGTAAAACGTAAACCAAAATTTAAATTTGCAAATT
AAAGATATATTTATTTAACAAATTAAATCATTTCAATAGTATTTAAATATTATTAACATA
TTAAAAGCTTGGTTGGGTGCTATCAAAGAACCTTCTTACAAATACTTCAAGGACAAAAAC
TAATTTGAAGAACCTCCTGTTACAATTAATCCTTATTATGTTTTTGGTATTCGTACTAAG
GACTAAAGAGGAAATTTGAGATATACATCATCTGGTAAAATTGTTTACAATGCTGCTGCT
CTCGGTATAGTCTTGGATGTCGAAAATAATACTCAAACATTCTTTAACAAGCATACAGAT
GATATTATTTCTCTAGATCTTCATCCAGATGGCAACCTCGTTGCTACTGGTGAAATAGGG
CCTAAGCCATACATTTACATATGGGATTCTGAAACTAAGGAAGTTAAAAATTCTTGGAAG
GGTGCTATCCTAAAGGGTATTGCATGTCTTGCATTCTCTCCTTCTGGTAATAAATTAGTT
GCAGCTGCTATTAATGATGATCATCAAATTGGTGTGTTTGATCTCAAATCAAATGCAGTC
ATGGCTTTTAAGGTATACACATTAATAAATTTATAATTAAGAAAAATCAATTATTTTAAT
ATAGGGTGGTCCTGAAGTCATAGTCGATTGCGATTGGGTTAATGAAGATAACTTTGTTAC
TGTAGGTGTTAAACATTTTAAGCTTTGGGCACCTGCTGGCAAAGCATACAAAGAGACTAA
AGGTGATAAAACAAACTTTGTATTCTCAGGATTAGCATTTATTAACAACTAAACCCTTGT
AGGAACTTCTACAGGTGACTTATAGGTTTGGTAAGGAAACAGTTTTACTCGTAACTCACA
AGACAAAAAGTTACATGAAAAGGGTATTGAAACTATCAGAGTCGATCAAAATTAGTAAAT
GATTAGAATTTTATTAAATTAAAAAATAAAAAATAAATTTATTTGAATAAACCTTTATCT
TCAAAGATTTTTTCAAATTTGAATATTTTCTCTACATAAGCTTCAATGGTTTAAACACAT
TAAAATTAATATATGTTTTTTATTTGTAAAGTGTCTTCACTGGAGGTAAAGATTGCAAAG
TAAACATTTTAGGAAAAGACCTAAAAGTTATCACTTCAATCAACGTGGCAGAACTATTTC
CAGAAACTCTAAGTGGTGAAGTTAGAAGTATTTGTCCTAGTTAAGATTTGAAGAGAGTAT
TAGTTGCTACACTTGCTTGTGAAATTATTGAATTCGAAGCAAGCCAAGTACCTTATACTT
CTAATACTAAATTTTCTTTTAGAAACTGCTATATGAAAGGCCATTTCTCTCCTAACTTAA
AGGTAAAAATAAATAAATTAATAAAATTAAAAATATATCTTTAATTGATTATCAATATTT
TTTAATAGTGGACTAATGAAGTTTGGGGTTTATCAGTGTTCCCTGACACTGATACATTTG
CAACTTGCTCTGATGATGGTACATTAAGAGTTTGGTCTCTTCCTGAAAGAAAGCAAATTG
CTTTAATTAAGACTAACTTAAATAAAGGTAAGGTTTATGATAATAAATAATATGAATTAA
ATAAATTTTATTTTTTATTATAGAAAACTCTGAAACCCCTAGAGACCCAGCAACTGGTGA
TTTCGCAGATTCTGTTAAAGGAAGAGCCCTTGCCGTTTCACCTGAAGGTAATACAATTGT
AGCAGGTTTTAAAGAAGGAACACTAAAAGAATTCACTGTTAGTGGAGAAGGATCAGAAAT
GAAATTAGAATAAACAAAAGTTATCAAGCATGCTTAAAGATGGATATCCGATATAAAATT
CTCACCAGATGGTACAACTTTAGTAGCAGGAGCTCATGATTAAACTATATATGCTTACAA
TTTACCAGATTGGAAACCCCGTTGCAAACCCATGAAAAAGCACTCTTCATACATCACCCA
TATAGATTTCTCAAGATGCGGTAACTATCTCCATAGTACATGTGGAGCTTATGAGCTTTT
ATTCTGGGAAGCAAACACTGGCAAATAGCTAACATCCGGTGCTAGCGCTCTTAAAGACGA
ATTATGGGCTACATGGAATGTCACTCTTGGATGGCCAGTAATCTAAATAAACTTTATATC
ATAAATTTATATTTATTAATTAAGAAATATTCATTAAAGATTAACATTTGATTTTAAAAA
AAGGTTCAAGGTATATGGCCTGAGTGTGCAGATGGTACTGACATAAATGCAGTAGACAGA
TCAAACTTTACCATAGCTAAGAATAAAGACATTGAAAAATCTTATCATTTATTAGCAACA
GGAGATGATTTCTCTCATGTAAGAATTCTTAGATTCCCATCACTAAAAAAGAGCTCCAAG
GGTGTCATAGGATATGGCCACTCTTCACATGTCACAAACGTAAAGTGGACCAAAGATGAT
TAATACATATACTCAACTGGTGGTGAAGATTAATGTGTCATAATTTGGAAAGTTGATAAA
AAATGA