Identifiers and Description

Gene Model Identifier

TTHERM_01055420

Standard Name

EMIT2 (Enables Micronucleus Transcription)

Aliases

PreTt15296 | 215.m00039 | 3809.m00210

Description

Encodes a conjugation-specific Mediator complex-associated protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01055420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20643.19.997093137033517e-262hypothetical protein (622 aa)

General Information

Paragraph NoGene NameParagraph Text
133EMIT2Emit1 and Emit2 tether the Mediator complex to the nucleus and activate transcription. Emit2 tethers Rib1 to chromatin to position the transcription machinery. Rib1 promotes the formation of small RNA precursors to guide DNA elimination

Associated Literature

  1. Ref:31280995: Tian M, Mochizuki K, Loidl J (2019) Non-coding RNA Transcription in Tetrahymena Meiotic Nuclei Requires Dedicated Mediator Complex-Associated Proteins. Current biology : CB ( ):

Sequences

>TTHERM_01055420(coding)
ATGAGCAACTAATAAACAATTCAAAATAAGCAGAAAGAGTCTTACAATGCAAGCGTTTTA
AATGATAAAAACCAAGCATCTAAAATTTAGCAATAGTTTAGAGAAAGCTTTATTAGACAC
AGTGGATGGATTAACGTTCTTGATAAGTATATCAATTATTCTACTGGGCATGTCTCAAGT
GAAGTGCCTATTGATATATATTAATTTTAGCAAGAAATTGCTCGGAAATTCAATAACTTT
TTGATAAGCAAAGAAGATGTTTTCACATACTTTTTAAGTATTAAGAATTAAGTGATAGGA
CTTAGGGATTAGGATCATATTAGATAAACTTTACAGGATTTTGTTAGAGAATTATGCAAT
CCGGCTTACTATCGTGAATGTGTTGATTGCTAATTCTTCTAGTAGAAGTGTGAAAGAATG
AGGAAGATTATAGAAAATAATTTTGAAGAAAATTTATTTAAACAGCTCTTGGACTTCCTT
TCTGAAAAAAGAAAACAGTTTACTGAGCAACCTTCATATTTGAAATCCTAGATTCTTAAT
GAAATTGTCGGGTAGGCTTCTTCGATGAGAAAAAAACAGGAAAAAAAAACATCTGAATAA
AATGGATTGAAAAAATTTGTTAAAGACTGCTAAATGTTTGTTGTCATCGAAGACAATGAA
GGTAATTTGATACCTGCATCTTCATAGAAAAAGAATAAAGTAGTGATATCTAACGAAAAG
AATAAGGTTAGTCTGGTAAATGAACTGATTTAAAAGTTGTCTCAATATGAATAACTAAAG
CTTTAAGAAGTGCCTTAGCCTTCTAAGGATGGAATAAGCAATTTTTAGTTTGAATTAAAA
GGCAATGACTTAAGTATAAAAGGAGAAGTAAAGCAATAAAAACAAAAAGCTAAAGAAAGC
TGCTGTGAAAATGTGATTAATTTTATCATCAAATCTCTTTAAAATAATGCTGAAAGCCTT
TCAGAAAAATCTTCAATTGTAGAAAATGAATCAAATTACCAAGATTATCTTCTGTTTGAT
GCAGAAGACCTTAATGTTGCAGAAATAAACTTTGATGCACTCAATAATGAGTAAATGGAA
GAAATAGATAATACTGCCGATGATAATTTATTGTTCTAATCAAATGACAGGTTGAATAAT
TAAAATGACCAAGAAGAGATCGATCACGCTAAGAAATAGTAAGCCACTTCAAATTAGTAA
TAGATAGAATAAAAAAACCAAAAAAGCAGCAATTATGTTTAAAATAAAGAGAATCCTAAT
GAATATGATAAAATAGTAGAGAAACTTTACTAAACTTTAGATGACCTAGATGCTCTTGCT
AAAGTTGAGTTGCATCCATATAAAATTTTAAAGAAGTTAACTGAAGGTAAAAACAAATCT
GAGTCCTACAAAAAACTGAATGGTTGGCTGATGGAAATAATATAGAGTGCTGTTAAATTA
TATGACTATGAAGATTTTAAGTAGAGCCCTTGTGTAATTGTATAGGAAAATAGCAAGGCA
TTCTTTCTAAAAACTTTAATTATGAAGAAAAAAGTAAAAAGTCAAAATTTAATTGGTCAT
ACTAGATGCATTAATGAGGAGCATTCATTTATATTCTCTGCTCTAGAGCTTATCTACAAG
TTCGCTTTCAAACACTAAAGCCACAAAGGGGAAATAACTTGTCTTGAATAAGTTATTGAA
GGCTTAATTTTGGAAGCAGTGTATTTGAGCGAGGAATATGAAAGATAAAAAAAAGAAAGT
TAAACAGAAAAATCTCTCTTTACAGATAAAATGTATCCAAACAAAAATAAGTAGCAAATT
AATAAATCTTCAAACGACTCTAAATCATAATTTGTTAATTCAAAGTAATCCTAATTAAAA
GAACAATTTAAATTAGTTTTATGA


>TTHERM_01055420(protein)
MSNQQTIQNKQKESYNASVLNDKNQASKIQQQFRESFIRHSGWINVLDKYINYSTGHVSS
EVPIDIYQFQQEIARKFNNFLISKEDVFTYFLSIKNQVIGLRDQDHIRQTLQDFVRELCN
PAYYRECVDCQFFQQKCERMRKIIENNFEENLFKQLLDFLSEKRKQFTEQPSYLKSQILN
EIVGQASSMRKKQEKKTSEQNGLKKFVKDCQMFVVIEDNEGNLIPASSQKKNKVVISNEK
NKVSLVNELIQKLSQYEQLKLQEVPQPSKDGISNFQFELKGNDLSIKGEVKQQKQKAKES
CCENVINFIIKSLQNNAESLSEKSSIVENESNYQDYLLFDAEDLNVAEINFDALNNEQME
EIDNTADDNLLFQSNDRLNNQNDQEEIDHAKKQQATSNQQQIEQKNQKSSNYVQNKENPN
EYDKIVEKLYQTLDDLDALAKVELHPYKILKKLTEGKNKSESYKKLNGWLMEIIQSAVKL
YDYEDFKQSPCVIVQENSKAFFLKTLIMKKKVKSQNLIGHTRCINEEHSFIFSALELIYK
FAFKHQSHKGEITCLEQVIEGLILEAVYLSEEYERQKKESQTEKSLFTDKMYPNKNKQQI
NKSSNDSKSQFVNSKQSQLKEQFKLVL


>TTHERM_01055420(gene)
ATGAGCAACTAATAAACAATTCAAAATAAGCAGAAAGAGTCTTACAATGCAAGCGTTTTA
AATGATAAAAACCAAGCATCTAAAATTTAGCAATAGTTTAGAGAAAGCTTTATTAGACAC
AGTGGATGGATTAACGTTCTTGATAAGTATATCAATTATTCTACTGGGCATGTCTCAAGT
GAAGTGCCTATTGATATATATTAATTTTAGCAAGAAATTGCTCGGAAATTCAATAACTTT
TTGATAAGCAAAGAAGATGTTTTCACATACTTTTTAAGTATTAAGAATTAAGTGATAGGA
CTTAGGGATTAGGATCATATTAGATAAACTTTACAGGATTTTGTTAGAGAATTATGCAAT
CCGGCTTACTATCGTGAATGTGTTGATTGCTAATTCTTCTAGTAGAAGTGTGAAAGAATG
AGGAAGATTATAGAAAATAATTTTGAAGAAAATTTATTTAAACAGCTCTTGGACTTCCTT
TCTGAAAAAAGAAAACAGTTTACTGAGCAACCTTCATATTTGAAATCCTAGATTCTTAAT
GAAATTGTCGGGTAGGCTTCTTCGATGAGAAAAAAACAGGAAAAAAAAACATCTGAATAA
AATGGATTGAAAAAATTTGTTAAAGACTGCTAAATGTTTGTTGTCATCGAAGACAATGAA
GGTAATTTGATACCTGCATCTTCATAGAAAAAGAATAAAGTAGTGATATCTAACGAAAAG
AATAAGGTTAGTCTGGTAAATGAACTGATTTAAAAGTTGTCTCAATATGAATAACTAAAG
CTTTAAGAAGTGCCTTAGCCTTCTAAGGATGGAATAAGCAATTTTTAGTTTGAATTAAAA
GGCAATGACTTAAGTATAAAAGGAGAAGTAAAGCAATAAAAACAAAAAGCTAAAGAAAGC
TGCTGTGAAAATGTGATTAATTTTATCATCAAATCTCTTTAAAATAATGCTGAAAGCCTT
TCAGAAAAATCTTCAATTGTAGAAAATGAATCAAATTACCAAGATTATCTTCTGTTTGAT
GCAGAAGACCTTAATGTTGCAGAAATAAACTTTGATGCACTCAATAATGAGTAAATGGAA
GAAATAGATAATACTGCCGATGATAATTTATTGTTCTAATCAAATGACAGGTAAAAAGAA
TATTTGATAGTAATTTTAGTTATTTGTTTATTTTTAATTAAGGTTGAATAATTAAAATGA
CCAAGAAGAGATCGATCACGCTAAGAAATAGTAAGCCACTTCAAATTAGTAATAGATAGA
ATAAAAAAACCAAAAAAGCAGCAATTATGTTTAAAATAAAGAGAATCCTAATGAATATGA
TAAAATAGTAGAGAAACTTTACTAAACTTTAGATGACCTAGATGCTCTTGCTAAAGTTGA
GTTGCATCCATATAAAATTTTAAAGAAGTTAACTGAAGGTAAAAACAAATCTGAGTCCTA
CAAAAAACTGAATGGTTGGCTGATGGAAATAATATAGAGTGCTGTTAAATTATATGACTA
TGAAGATTTTAAGTAGAGCCCTTGTGTAATTGTATAGGAAAATAGCAAGGCATTCTTTCT
AAAAACTTTAATTATGAAGAAAAAAGTAAAAAGTCAAAATTTAATTGGTCATACTAGATG
CATTAATGAGGAGCATTCATTTATATTCTCTGCTCTAGAGCTTATCTACAAGTTCGCTTT
CAAACACTAAAGCCACAAAGGGGAAATAACTTGTCTTGAATAAGTTATTGAAGGCTTAAT
TTTGGAAGCAGTGTATTTGAGCGAGGAATATGAAAGATAAAAAAAAGAAAGTTAAACAGA
AAAATCTCTCTTTACAGATAAAATGTATCCAAACAAAAATAAGTAGCAAATTAATAAATC
TTCAAACGACTCTAAATCATAATTTGTTAATTCAAAGTAATCCTAATTAAAAGAACAATT
TAAATTAGTTTTATGA