Identifiers and Description

Gene Model Identifier

TTHERM_00322910

Standard Name

EMG1 (EMG1 nucleolar protein homolog)

Aliases

PreTt16010 | 32.m00254 | NEP1

Description

ribosomal RNA small subunit methyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF03587 ) Nep1 ribosome biogenesis protein
  • ( PF08597 ) Translation initiation factor eIF3 subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00322910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10057.14.999288603441066e-168suppressor Mra1 family protein
(301 aa)
OxytrichaContig11355.0.g921.9998099689916736e-77EMG1/NEP1 methyltransferase
SGDYLR186W4.998338612125368e-60EMG1 Member of the alpha/beta
knot fold methyltransferase su
perfamily; required for matura
tion of 18S rRNA and for 40S r
ibosome production; interacts
with RNA and with S-adenosylme
thionine; associates with spin
dle/microtubules; forms homodi
mers
WormBaseWBGene000126526.9972728945133496e-59Ribosomal RNA small subunit me
thyltransferase nep-1 status
:Confirmed UniProt:Q9XX15
protein_id:CAA21025.1
DictyBaseDDB_G02727323.998097515166115e-39emg1 on chromosome: 2 position
2220282 to 2221393
Stentor CoeruleusSteCoe_273651.7587922024243116e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00322910(coding)
ATGTCAGGCAGAGATAGAAAGTTTAACAATAACAAGAGAAAATAAAACTTCAATGATATG
AAGAAGAAGAAATAGAAATAAGTCAAAGAAGATTAATACGATGAAGAAGAAGAAGAAGTA
GAAGCTCAAGATTTATTACAAGACTAAGACGAATCTGACAATGATGTTGATTTAAAAAAA
GCAACCACTTCTTCTAAGGCTGAAGAAAAAGATGAAGCTGAAAAAGAAAGTGAATAAAAA
GCCACTGAAGCAGAAGAAGATAATGAAGATTTCTTAACAAAGGATGATGTATAAGATAAA
CGTAAAGTCTACGTAATTCTTGAAAAGTGTCCTTTAGAAACAGCCAAGTTAGGAAAAGAT
TTTGTTTTATTGAATTCTGATGAACACAAGGGTTATATTTCTAAGAAATTGAAGAAAGAT
TTCTCAACATACAGACCCGATATTGTTCATCACTCTTTGCTTTCTTTGATGGACTCTCCT
TTAAATAAAGCTGGCTTATTGCAAGTTTACATTCACACTGAAAATAATGTTTTAATATAT
ATTTCTCCTAACACTAAAATCCCAAGAACTTATAAGAGATTTGCAGCTCTTTTCGCATAA
TTGCTCACAAAATTGAAGGTTAGAGCTGTATAAAGCAGTGAAACTTTACTTAAAATCGTT
AAAAATCCTGTTACTCAACATCTCCCTTCAGATGCCATGAAAATTGGTATGTCTACCTAA
GCCCGTTTAGTAAGTTTTAAGGAATACATCGAAAAGTTACCTAAAAACAAGCCCGTAGTT
TATATTGTTGGTGGTGTTAGCAAAGGTAACCCTGCTATGGAAGTTGACTATGCTGATGAG
CACATCTGTATTTCAAAATACGGTCTTTCAGCCGGTTACTGCATATCCAGAATGATGAAC
TGCTATGAATAGATGTGGAATATCAATTGA


>TTHERM_00322910(protein)
MSGRDRKFNNNKRKQNFNDMKKKKQKQVKEDQYDEEEEEVEAQDLLQDQDESDNDVDLKK
ATTSSKAEEKDEAEKESEQKATEAEEDNEDFLTKDDVQDKRKVYVILEKCPLETAKLGKD
FVLLNSDEHKGYISKKLKKDFSTYRPDIVHHSLLSLMDSPLNKAGLLQVYIHTENNVLIY
ISPNTKIPRTYKRFAALFAQLLTKLKVRAVQSSETLLKIVKNPVTQHLPSDAMKIGMSTQ
ARLVSFKEYIEKLPKNKPVVYIVGGVSKGNPAMEVDYADEHICISKYGLSAGYCISRMMN
CYEQMWNIN


>TTHERM_00322910(gene)
ATGTCAGGCAGAGATAGAAAGTTTAACAATAACAAGAGAAAATAAAACTTCAATGATATG
AAGAAGAAGAAATAGAAATAAGTCAAAGAAGATTAATACGATGAAGAAGAAGAAGAAGTA
GAAGCTCAAGATTTATTACAAGACTAAGACGAATCTGACAATGATGTTGATTTAAAAAAA
GCAACCACTTCTTCTAAGGCTGAAGAAAAAGATGAAGCTGAAAAAGAAAGTGAATAAAAA
GCCACTGAAGCAGAAGAAGATAATGAAGATTTCTTAACAAAGGATGATGTATAAGATAAA
CGTAAAGTCTACGTAATTCTTGAAAAGTGTCCTTTAGAAACAGCCAAGTTAGGAAAAGAT
TTTGTTTTATTGAATTCTGATGAACACAAGGGTTATATTTCTAAGAAATTGAAGAAAGAT
TTCTCAACATACAGACCCGATATTGTTCATCACTCTTTGCTTTCTTTGATGGACTCTCCT
TTAAATAAAGCTGGCTTATTGCAAGTTTACATTCACACTGAAAATAATGTTTTAATATAT
ATTTCTCCTAACACTAAAATCCCAAGAACTTATAAGAGATTTGCAGCTCTTTTCGCATAA
TTGCTCACAAAATTGAAGGTTAGAGCTGTATAAAGCAGTGAAACTTTACTTAAAATCGTT
AAAAATCCTGTTACTCAACATCTCCCTTCAGATGCCATGAAAATTGGTATGTCTACCTAA
GCCCGTTTAGTAAGTTTTAAGGAATACATCGAAAAGTTACCTAAAAACAAGCCCGTAGTT
TATATTGTTGGTGGTGTTAGCAAAGGTAACCCTGCTATGGAAGTTGACTATGCTGATGAG
CACATCTGTATTTCAAAATACGGTCTTTCAGCCGGTTACTGCATATCCAGAATGATGAAC
TGCTATGAATAGATGTGGAATATCAATTGA