Identifiers and Description

Gene Model Identifier

TTHERM_00088150

Standard Name

EMA1 (En-MA (the lord of death in Japanese))

Aliases

PreTt16465 | 6.m00539 | 3836.m02132 | DRH26

Description

DExH box putative RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF07813 ) LTXXQ motif
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08970 ) Sporulation inhibitor A
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00088150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02502.19.997093137033517e-262nucleic acid helicase (1699 aa
)
OxytrichaContig21414.0.g1022.9990539278805726e-74Helicase conserved C-terminal
domain
DictyBaseDDB_G02753132.00017271388466e-38dhx9 on chromosome: 2 position
5331812 to 5336775
WormBaseWBGene000099229.99893167504554e-35status:Partially_confirmed U
niProt:Q20644 protein_id:CAA
99855.1
Stentor CoeruleusSteCoe_365289.854154686111257e-34
SGDYKL078W1.9991517704232713e-32DHR2 Predominantly nucleolar D
EAH-box ATP-dependent RNA heli
case, required for 18S rRNA sy
nthesis

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29021213: Noto T, Mochizuki K (2017) Whats, hows and whys of programmed DNA elimination in Tetrahymena. Open biology 7(10):
  2. Ref:22855833: Schoeberl UE, Kurth HM, Noto T, Mochizuki K (2012) Biased transcription and selective degradation of small RNAs shape the pattern of DNA elimination in Tetrahymena. Genes & development 26(15):1729-42
  3. Ref:21914793: Schoeberl UE, Mochizuki K (2011) Keeping the soma free of transposons: programmed DNA elimination in ciliates. The Journal of biological chemistry 286(43):37045-52
  4. Ref:19596782: Bednenko J, Noto T, DeSouza LV, Siu KW, Pearlman RE, Mochizuki K, Gorovsky MA (2009) Two GW repeat proteins interact with Tetrahymena thermophila argonaute and promote genome rearrangement. Molecular and cellular biology 29(18):5020-30
  5. Ref:18708581: Aronica L, Bednenko J, Noto T, DeSouza LV, Siu KW, Loidl J, Pearlman RE, Gorovsky MA, Mochizuki K (2008) Study of an RNA helicase implicates small RNA-noncoding RNA interactions in programmed DNA elimination in Tetrahymena. Genes & development 22(16):2228-41

Sequences

>TTHERM_00088150(coding)
ATGAGCAATGTCAACTATAAGAGACCATTTTAGAAAATGAGTGTTCTCATAGAAAATGCT
AGCTCTGAGAAAACATAAAGCAAAGCTTAAGATTAAGATATCTAAATTATAAATGAACCA
GAAAAAATCAAAAAGATTAAGCTTATTTCTGATATAACAAAAGAGTATAGCAAAATAAAC
CCATCTTCTGTGCAACTTAGTGAAAAAAGAAATGAAAAAAATTAAGAAAAGAGGAATTCT
TTTTAAATAAACGATGTTCCTAAAAATACTCTCTTCCTAAATAGTGGGAATAGGCAAGAT
AAATTTGGAGAAGGATAAGAGGATTTTATGAAATTTGATGAGGAGATTTAGATTAGTAAC
ACTATAGTTAAAGAAGAGATAGTAGTTGAAGAGGATTAAAATAATAGCAATAATAGAAAT
AAGAAAAAAGTATTTTACGAATTTAATGAGCCGATTAGTCCTGAACAAGAAGAGCTTCCA
GTACATGAAAATAGGCTATCAATTTTAGAGACAATTAAAAATAACAGCGTGATTGTAATT
TCTGGAAATACAGGTTGTGGCAAAAGTACTTAAATCCCTAAATTTATTGCTTGTGATGAT
ACTTCTACTAAAATTATTGTAACTTAGCCAAGAAGAGTAGCTGCAATAGCTTTGGCAGAA
AGAGTATCATAAGAGTTAAAATCAAATCTTGGACAAAGAGTAGGCTATTAAATAGGATAA
GACTCTAACTTTAATAGAAATACATAAATACTCTATGTTACGATAGGTATATTTTTATAG
AAGTTAATTAATGATCCTGATTAATTTCTGAGAGAGTACACTCACATAATTCTAGATGAA
GTCCACGAAAGAGGTATTGAGTCTGATTTTGGTTTAATTGCACTGAAGACGTTTTTATCT
CAGCATAAGAATAGAAATTCTATCAAGCTTATTGTAATGAGTGCTACACTGAATAAAGAT
ATTTTTTTAAATTACTTTTCAACTACAGAACTTAATAATCTTGAAAAGGAAATAAAGGAA
GATTAGGATTGTCAAGAATATTATTTTGATAGCTCGAAGTTTTCTGAATAGCTAAAAATT
ACTAAACAAAATGACGATTACAGTAATTGGGGACAGCAGAAAGCTCATCAAACTTGGAAT
GATCAAGATGACCATGATGATACATATGAAAAAATGCAAAAAATGATTTGCAGATTTAAT
TGCAAATATGAGTCAAATTAAAAAAATTATGTTGAGATCCAAGTAGTTTAAAAATACAAA
ATTTAGACAGTATGGTTAGAGGATTTAAAAGATACTTAAAAGTTATGCAACAAGAATTAT
TTTAATGCTCGTAAACCTGAATTGAATGAAGATCTTTATAAAATAGTTGCTAAAGAAATA
AAAAGAGTGCAATTTTAGGAAGAACCTATGCTGAGATCATATAAGAAAGGTGACATTCTT
GTATTTCTTCCAGGTTACAACGAAATCGTCAAGCTTCATTCAATCTTAGATTAAATAATG
ATGGAATTCAAACAAACCAATTAGAGTATTTATAATTAAAATAAATATAAAATCATAGAG
TTGCACTCCTGTTTGGGAGACATCAATACTAAAGAACTTTTTGGGAGAAATTAAGATTAC
ACAAAAATTATTCTAGCCACAAATATTGCAGAATCTTCTATTACTATCCCAAACTGCTTT
GTAGTGTTTGACTTTTGCTTGACTAAAGAAATAAATTATAATCCATCAAGTGGAATTGAA
AAGCTTGAACTATAATGGGCTTCAAAGGCTTCAATTACACAAAGAGCAGGCAGAACTGGC
AGAAACTGCAATGGTGTAAATATTAGACTAGTTCCTAAACAATTTTTTATGGCAGAAATA
AAAGATTATTAAACACCAGAAATATTAAGATGCCCAATTGAAAAGGTTATTTTAAAAATA
AAAATTCTAGATGAAGGAGAAAGTGACTACCAAAAGATTCATCTTAGTGATGATGACGAT
GTTGAATAAAATAATTTGATAGAAGAGATAATTAAAGAGAAGTAAAGCGAGAAGTCGAAA
AAAAAGAGATTAAATTTTAGCACTGATTTTGATGATATAGATTATATGAAGTAATTTGAT
ACAAAACCTGTTTTTGATGGGCAAGATACAGCTTTCCTTATAGCAGGACCTATTACTAAA
AATAAATCTAAAAAGTAGTAATTAGAGAATTCATAAAATTTAAGATTGTTTGAAGACCCT
GTGAGAGTTCTTTAAAGAGCAATAGAAGCACCTGATGATTATAGCATTTGCTAGTCTATG
GAAAATTTGATGTCAGTAGGAGCTTTGAAACTAAAAAAAATACAATACACTGATACATAA
AAAGAAAAAATAAAAGTAAAAGTTACTAAACTTGGTAGATTTTATAATGACATGCCTTGC
GACCTGAAGCTTGCTAAATTCATATGCTTTGGGTACTTTTTCGATTGTCTTATAGAATGT
ATCACTATTGCCAGCATCTACAGCTAGAGAAAATCATTTTTTAATCCCTTTTACAAAATT
AGTGGCAATTTAAAATAAATTGATTAATTCACTGATTTGATATTTAGATATGATCAAGGC
TAAGAATCTGACATGATATTAGAACTTAAGATATTTTAAGAATGGGAAAATGAATTTTTT
TAATCTTAGCTAGAGTTTATCAAGTTAAGGAAAGAGTCTAAAATGCAGAGCAGGTAAATT
AGGCAAGAATCAGAATAAAATGATTTTCTTTCTTTGGATCAATCAATTCCTAAAATTTTG
AGTGAAGAATAACTCAAATTACCTTTGTCTAAGCAATTAGAATTATTAAAAAATTCTTCC
AACCATCCTTAAAATTAAGATAGTTCTATTGCACCCACTCTTTCTTTTTAATAATATTTA
CCAGATAGGAGCAGTGAAGAAAAACCACTAAAAGGAATAATAGATAGGTATTTTATAGAA
GAATTTAAGAAGAAAAGAGCTTCTAGAGAAGAACTACAATGGTGTGAAAAGCATTTTTGT
GATCCTAAGGTTTTGAGAGAAATTCTAAGTACGAGAGAAGACCTGAAATAGAGAATACCA
AAAGAAGCAGGAAGCATGTACGATATTTTTGAATTCAAAGATTTAAATGATGATAGTCAT
TTGATGAAAATAAAGTTTTGTTTGGCTGGAGCTTTTAATAAATACACTTTAAAGTCAGAC
ATATTTGATATAAAGGAAATGTAAAAAATCCGTTAGTACCTTTTAGTAGAGTAGATGGAT
CCATTTAGCACTATAATTATAGAAAATACAGTTTATGGATTTTAATCTCTCTCTATTAAT
GACAAAGATATTATAATTAAAAAAATAATAGATGGAGTCAACCATTTCATCAAAACAAAA
CAGCTATTTAAAGAGCTAGATGATCCATACGAAAATGTAGAAGCTTTAAATAACAACTTC
GTTTCAAAAATTAAGCTTAAATATTCATCAGTCTACATAGAATTCAAAAAATTTTCAAAA
CTTCCTATCCTGTTAAAGCAAATTATGACTTTCAAAAAAAGATACTTCAATTTCATTAAA
CTATAAGACAAAGACACTAACATTAAAGAAATATCGGCTACAATTTTTTTAGATAAAAAA
ATTGACTTTGATTAAATCTTTATTAAGTAGTAAAATAATTTTAAATATGCTTATGAAGCA
AAATTGAATATTTCAAATTAAAAACTTAATCGCCTTGTTTCTCTTGAGAGTGATTCTATA
AATTTAGTTACACTAGGAGATTATAATAGGCATAAATACTTAGTCGCCTCAGAGTTAATG
TGCAGAGGTCATAGGGTAGTTGCTTAAGGAATTACTGTTATGCCTCCAAACTTTCCTTTA
TTTTTGGCTTTTGCAGCTTTGATTTTTGGGTCATAATGTTATGTTAATTGTGATAAAGAT
GGCAAGAAATACGAAGGAGTTAATGTGGATAGCGTTGAAATAGAAATAGACCATTATATG
CTTGATAATGATATTAAAGAAATAAATGATATTAGAAGAGAACTTAGGGCTTGCTTAGAT
GAAGATAGTTTTTTCAATGGATAAGCTAATCTGCAGCTAGATTTATGGAATAAAGTAAAA
AGAAAATTACTTTCTAGAGTAATGATGAGACATGTTGATTCTGAGAAATGGGAAGACATA
TATAGCAAGGAATATCTAAATGGGACTTTTTCTGTAAATGTTGAAGAATAAAACAAATAA
AAGGTGATGAAAATACTGAATAGTATCAGGACGACAAATAGTTCTGAAAATTGTAAAACA
AGTGAATGTTAAAACGAAGAAATGGATTTAGAAAAAAATAACAATTCATTATCAATTGCA
TAACAAAATTAAAAAAAGAGAAATGTTAAGTTATTATTTTAGAATCATAAAAGAAAAAAC
AACTAAGAAAAAATAACTCATGCTTCTGAGAAAGGATTTATGAATTAAATTCTTCAAACT
AAGAAGTAGGAATCGAATCTTGTAACTCTTTCTGAATAGGAAAATATCAATCTTTTATAG
GAATACTTTGAGAATTACAATATTTGGAAGCAAATGAAAATGAGAGAACTCAAGAGATTT
TTCCTTCTTCATACCATAGATGAGCCAATTATAACTTGCAAAGCTTGCTATCATTAACTG
CTCTTTTAAGTGCCTTTGTTCAAAGCAAATAAATTGTAAGCCCAACTTGAAAAGTTTATG
AAATTAAATTTTAATGGTTTTACAGATAATTTATATTTGAAGGACATTAAAATTGAATAG
CTACTTCAAGAAGCAGAATTTAACCAAGATAAAACCAAATATAAAACTTAATAGGAAAAA
GATTTAGAACAAAATGCAGATTTTATCAAAGAATTGAAATATAATTTTAATTAACTCAAT
TCATAAAACTCAGATCAAATTTATAGCTTCAAATATTATGCCTGTTAAAATGGCCATCTT
ATTGGATTTACTTAAGACGATAATTAGTTATATAATCAAATGCATATCCCAGATTGCAAC
CAGCTCCTAATTCTATATCCAGACCTTGAATATAAAGTATTTAGTGGGTATGAAGACTTT
TAAGAGGTTAAGTTAACTGAAGATTAGTAAATTGAAATATAAGAACACAAAGCTTTAATG
CTTCTTGAGCTAAATGAAATAAGTTGTATCATCTGTAATTGTGTCATGAATGACAGTGAA
AAGAAAGATGAAGAAATCAAATTCTAAGATTAAAACGTAACTGACTGGAGATCAAAGCTT
GAGAAGCATATGAAAACAGAAGCCCATAAGTTGAATGAAGAAATCTTTTTAAAATCAACA
AGATCTCCAAATTACTTTTTCACAAATTGA


>TTHERM_00088150(protein)
MSNVNYKRPFQKMSVLIENASSEKTQSKAQDQDIQIINEPEKIKKIKLISDITKEYSKIN
PSSVQLSEKRNEKNQEKRNSFQINDVPKNTLFLNSGNRQDKFGEGQEDFMKFDEEIQISN
TIVKEEIVVEEDQNNSNNRNKKKVFYEFNEPISPEQEELPVHENRLSILETIKNNSVIVI
SGNTGCGKSTQIPKFIACDDTSTKIIVTQPRRVAAIALAERVSQELKSNLGQRVGYQIGQ
DSNFNRNTQILYVTIGIFLQKLINDPDQFLREYTHIILDEVHERGIESDFGLIALKTFLS
QHKNRNSIKLIVMSATLNKDIFLNYFSTTELNNLEKEIKEDQDCQEYYFDSSKFSEQLKI
TKQNDDYSNWGQQKAHQTWNDQDDHDDTYEKMQKMICRFNCKYESNQKNYVEIQVVQKYK
IQTVWLEDLKDTQKLCNKNYFNARKPELNEDLYKIVAKEIKRVQFQEEPMLRSYKKGDIL
VFLPGYNEIVKLHSILDQIMMEFKQTNQSIYNQNKYKIIELHSCLGDINTKELFGRNQDY
TKIILATNIAESSITIPNCFVVFDFCLTKEINYNPSSGIEKLELQWASKASITQRAGRTG
RNCNGVNIRLVPKQFFMAEIKDYQTPEILRCPIEKVILKIKILDEGESDYQKIHLSDDDD
VEQNNLIEEIIKEKQSEKSKKKRLNFSTDFDDIDYMKQFDTKPVFDGQDTAFLIAGPITK
NKSKKQQLENSQNLRLFEDPVRVLQRAIEAPDDYSICQSMENLMSVGALKLKKIQYTDTQ
KEKIKVKVTKLGRFYNDMPCDLKLAKFICFGYFFDCLIECITIASIYSQRKSFFNPFYKI
SGNLKQIDQFTDLIFRYDQGQESDMILELKIFQEWENEFFQSQLEFIKLRKESKMQSRQI
RQESEQNDFLSLDQSIPKILSEEQLKLPLSKQLELLKNSSNHPQNQDSSIAPTLSFQQYL
PDRSSEEKPLKGIIDRYFIEEFKKKRASREELQWCEKHFCDPKVLREILSTREDLKQRIP
KEAGSMYDIFEFKDLNDDSHLMKIKFCLAGAFNKYTLKSDIFDIKEMQKIRQYLLVEQMD
PFSTIIIENTVYGFQSLSINDKDIIIKKIIDGVNHFIKTKQLFKELDDPYENVEALNNNF
VSKIKLKYSSVYIEFKKFSKLPILLKQIMTFKKRYFNFIKLQDKDTNIKEISATIFLDKK
IDFDQIFIKQQNNFKYAYEAKLNISNQKLNRLVSLESDSINLVTLGDYNRHKYLVASELM
CRGHRVVAQGITVMPPNFPLFLAFAALIFGSQCYVNCDKDGKKYEGVNVDSVEIEIDHYM
LDNDIKEINDIRRELRACLDEDSFFNGQANLQLDLWNKVKRKLLSRVMMRHVDSEKWEDI
YSKEYLNGTFSVNVEEQNKQKVMKILNSIRTTNSSENCKTSECQNEEMDLEKNNNSLSIA
QQNQKKRNVKLLFQNHKRKNNQEKITHASEKGFMNQILQTKKQESNLVTLSEQENINLLQ
EYFENYNIWKQMKMRELKRFFLLHTIDEPIITCKACYHQLLFQVPLFKANKLQAQLEKFM
KLNFNGFTDNLYLKDIKIEQLLQEAEFNQDKTKYKTQQEKDLEQNADFIKELKYNFNQLN
SQNSDQIYSFKYYACQNGHLIGFTQDDNQLYNQMHIPDCNQLLILYPDLEYKVFSGYEDF
QEVKLTEDQQIEIQEHKALMLLELNEISCIICNCVMNDSEKKDEEIKFQDQNVTDWRSKL
EKHMKTEAHKLNEEIFLKSTRSPNYFFTN


>TTHERM_00088150(gene)
ATGAGCAATGTCAACTATAAGAGACCATTTTAGAAAATGAGTGTTCTCATAGAAAATGCT
AGCTCTGAGAAAACATAAAGCAAAGCTTAAGATTAAGATATCTAAATTATAAATGAACCA
GAAAAAATCAAAAAGATTAAGCTTATTTCTGATATAACAAAAGAGTATAGCAAAATAAAC
CCATCTTCTGTGCAACTTAGTGAAAAAAGAAATGAAAAAAATTAAGAAAAGAGGAATTCT
TTTTAAATAAACGATGTTCCTAAAAATACTCTCTTCCTAAATAGTGGGAATAGGCAAGAT
AAATTTGGAGAAGGATAAGAGGATTTTATGAAATTTGATGAGGAGATTTAGATTAGTAAC
ACTATAGTTAAAGAAGAGATAGTAGTTGAAGAGGATTAAAATAATAGCAATAATAGAAAT
AAGAAAAAAGTATTTTACGAATTTAATGAGCCGATTAGTCCTGAACAAGAAGAGCTTCCA
GTACATGAAAATAGGCTATCAATTTTAGAGACAATTAAAAATAACAGCGTGATTGTAATT
TCTGGAAATACAGGTTGTGGCAAAAGTACTTAAATCCCTAAATTTATTGCTTGTGATGAT
ACTTCTACTAAAATTATTGTAACTTAGCCAAGAAGAGTAGCTGCAATAGCTTTGGCAGAA
AGAGTATCATAAGAGTTAAAATCAAATCTTGGACAAAGAGTAGGCTATTAAATAGGTAAA
ATATTTTATTTAGAGACATTATAGTTACTTTTATGCAAAAATTTCTCTTAACTAAGTCAG
TCTTTGAAGATTTTATAGCAATTTTTCTTTGCTAAATAAGATTTTTGATACGATTTTATC
ATAAAATTTTGATCAATAATTAAAAAAGAAATTTAACAAAAAAAATAATTTTTAAAGAAA
TTTTTTTGATAAATAAACTTATTTTTCATTGCTTAATTTCGAAACACTTAAAATTATTTA
CATGAAAAAAAAATATTTAGTTTTATTTTAAAATTATTTAAAAGATTTATTTAAAATAAT
AGTTCATTGAATATTTTCATAAGTTTAATAAAAAAAAATATGAAAAAATTAAATTTAATT
AACTTTTAGTTAAACATTAAAATATTTCTTTTTTTAGAAAAATATTCTAAAATGAAAATA
TTTCATCAAAAAAACAAATTTACAACCGAATATAATTTGATTATTTCTGATTTATTTTCT
TCAAGTTCGATATTTGTTAATGGATTAAATTTTAAAAATGCTATTTATATTTATTTGAAA
TATAGGATAAGACTCTAACTTTAATAGAAATACATAAATACTCTATGTTACGATAGGTAT
ATTTTTATAGAAGTTAATTAATGATCCTGATTAATTTCTGAGAGAGTACACTCACATAAT
TCTAGATGAAGTCCACGAAAGAGGTATTGAGTCTGATTTTGGTTTAATTGCACTGAAGAC
GTTTTTATCTCAGCATAAGAATAGAAATTCTATCAAGCTTATTGTAATGAGTGCTACACT
GAATAAAGATATTTTTTTAAATTACTTTTCAACTACAGAACTTAATAATCTTGAAAAGGA
AATAAAGGAAGATTAGGATTGTCAAGAATATTATTTTGATAGCTCGAAGTTTTCTGAATA
GCTAAAAATTACTAAACAAGTAATATTAAATGAATTATATACTATTTTTATAATTTATCA
AACAAAAAAACAATAATAGAATGACGATTACAGTAATTGGGGACAGCAGAAAGCTCATCA
AACTTGGAATGATCAAGATGACCATGATGATACATATGAAAAAATGCAAAAAATGATTTG
CAGATTTAATTGCAAATATGAGTCAAATTAAAAAAATTATGTTGAGATCCAAGTAGTTTA
AAAATACAAAATTTAGACAGTATGGTTAGAGGATTTAAAAGATACTTAAAAGTTATGCAA
CAAGAATTATTTTAATGCTCGTAAACCTGAATTGAATGAAGATCTTTATAAAATAGTTGC
TAAAGAAATAAAAAGAGTGCAATTTTAGGAAGAACCTATGCTGAGATCATATAAGAAAGG
TGACATTCTTGTATTTCTTCCAGGTTACAACGAAATCGTCAAGCTTCATTCAATCTTAGA
TTAAATAATGATGGAATTCAAACAAACCAATTAGAGTATTTATAATTAAAATAAATATAA
AATCATAGAGTTGCACTCCTGTTTGGGAGACATCAATACTAAAGAACTTTTTGGGAGAAA
TTAAGATTACACAAAAATTATTCTAGCCACAAATATTGCAGAATCTTCTATTACTATCCC
AAACTGCTTTGTAGTGTTTGACTTTTGCTTGACTAAAGAAATAAATTATAATCCATCAAG
TGGAATTGAAAAGCTTGAACTATAATGGGCTTCAAAGGCTTCAATTACACAAAGAGCAGG
CAGAGTAAAAGAATAATTTTTTTTTATTAAATATTTACAATAATATAAAAAATTTAATTA
AATTAGACTGGCAGAAACTGCAATGGTGTAAATATTAGACTAGTTCCTAAACAATTTTTT
ATGGCAGAAATAAAAGATTATTAAACACCAGAAATATTAAGATGCCCAATTGAAAAGGTT
ATTTTAAAAATAAAAATTCTAGATGAAGGAGAAAGTGACTACCAAAAGATTCATCTTAGT
AAATGAATAAAAATTTAATATTAAATTAAAATGACTCTTTGATTTATTTTTGACATATTT
ATTTTATCTAATAAAAGGTGATGATGACGATGTTGAATAAAATAATTTGATAGAAGAGAT
AATTAAAGAGAAGTAAAGCGAGAAGTCGAAAAAAAAGAGATTAAATTTTAGCACTGATTT
TGATGATATAGATTATATGAAGTAATTTGATACAAAACCTGTTTTTGATGGGCAAGATAC
AGCTTTCCTTATAGCAGGACCTATTACTAAAAATAAATCTAAAAAGTAGTAATTAGAGAA
TTCATAAAATTTAAGATTGTTTGAAGACCCTGTGAGAGTTCTTTAAAGAGCAATAGAAGC
ACCTGATGATTATAGCATTTGCTAGTCTATGGAAAATTTGATGTCAGTAGGAGCTTTGAA
ACTAAAAAAAATACAATACACTGATACATAAAAAGAAAAAATAAAAGTAAAAGTTACTAA
ACTTGGTAGATTTTATAATGACATGCCTTGCGACCTGAAGCTTGCTAAATTCATATGCTT
TGGGTACTTTTTCGATTGTCTTATAGAATGTATCACTATTGCCAGCATCTACAGCTAGAG
AAAATCATTTTTTAATCCCTTTTACAAAATTAGTGGCAATTTAAAATAAATTGATTAATT
CACTGATTTGATATTTAGATATGATCAAGGCTAAGAATCTGACATGATATTAGAACTTAA
GATATTTTAAGAATGGGAAAATGAATTTTTTTAATCTTAGCTAGAGTTTATCAAGTTAAG
GAAAGAGTCTAAAATGCAGAGCAGGTAAATTAGGCAAGAATCAGAATAAAATGATTTTCT
TTCTTTGGATCAATCAATTCCTAAAATTTTGAGTGAAGAATAACTCAAATTACCTTTGTC
TAAGCAATTAGAATTATTAAAAAATTCTTCCAACCATCCTTAAAATTAAGATAGTTCTAT
TGCACCCACTCTTTCTTTTTAATAATATTTACCAGATAGGAGCAGTGAAGAAAAACCACT
AAAAGGAATAATAGATAGGTATTTTATAGAAGAATTTAAGAAGAAAAGAGCTTCTAGAGA
AGAACTACAATGGTGTGAAAAGCATTTTTGTGATCCTAAGGTAGTAAAATTTTTTAATAT
CTCATAAACATTTATTAATTAATTGATAAATAAAAGGTTTTGAGAGAAATTCTAAGTACG
AGAGAAGACCTGAAATAGAGAATACCAAAAGAAGCAGGAAGCATGTACGATATTTTTGAA
TTCAAAGATTTAAATGATGATAGTCATTTGATGAAAATAAAGTTTTGTTTGGCTGGAGCT
TTTAATAAATACACTTTAAAGTCAGACATATTTGATATAAAGGAAATGTAAAAAATCCGT
TAGTACCTTTTAGTAGAGTAGATGGATCCATTTAGCACTATAATTATAGAAAATACAGTT
TATGGATTTTAATCTCTCTCTATTAATGACAAAGATATTATAATTAAAAAAATAATAGAT
GGAGTCAACCATTTCATCAAAACAAAACAGCTATTTAAAGAGCTAGATGATCCATACGAA
AATGTAGAAGCTTTAAATAACAACTTCGTTTCAAAAATTAAGCTTAAATATTCATCAGTC
TACATAGAATTCAAAAAATTTTCAAAACTTCCTATCCTGTTAAAGCAAATTATGACTTTC
AAAAAAAGGTAATTAAATAATTAATCAATCTATTTTAAAATACTTTCCAACTTTCCCAAA
ATTAAACTTAAAATAAAACTTACTTTAATACTGTCCTATTAATCCATTAATTATTTAAGT
TAATTAAAATATATTTTGCATTATTGAATAAATTTAGCTTTTAAAAGCTAATTTTTAAAA
TTAATTTCAGTTTAAAAATTAATTAATTATTAAAATTTTTAAATAGGAAAAAGAGAGCTT
TAAAATTTTATTTTAAAAAAATGTAACATTTTTTTTAGTTTTTTTTAAATTCATTTATTA
TTTAAGTTAATTAAAATTATTTTGCATTGAGTAAATTTAACTTTTAAAAGAAATTTCTTT
AAATTACTTTCAGAATAAAAATTAATGATTAAAATTTTTAGATAGGAAAAAAATGAGAAC
TTAAAAATACAATTTTTTATTTTAAATTTTTTTTTAGTTTAATTTTAATTAATTGATTAT
TTAAGTTAAATAAAAACATTTTGCATCAAATAAATTTAATTTTTCAAAGAAATTACTTTA
AATTAATTTCACCAAAATACTTAATTTTTAAATTTTTAAAAGAAAAAAAAGACAACTTTA
AAGATAAATTATTTAAATTAGAAATATGCTTTTTAGGGTTATTTTTTATTTTATTTTAAA
TTTCAAAATTTTCACCAATTAAAATTAATATGATTTGATATTAATTAAATATTTTTTTTT
AATTTTTAGATACTTCAATTTCATTAAACTATAAGACAAAGACACTAACATTAAAGAAAT
ATCGGCTACAATTTTTTTAGATAAAAAAATTGACTTTGATTAAATCTTTATTAAGTAGTA
AAATAATTTTAAATATGCTTATGAAGCAAAATTGAATATTTCAAATTAAAAACTTAATCG
CCTTGTTTCTCTTGAGAGTGATTCTATAAATTTAGTTACACTAGGAGATTATAATAGGCA
TAAATACTTAGTCGCCTCAGAGTTAATGTGCAGAGGTCATAGGGTAGTTGCTTAAGGAAT
TACTGTTATGCCTCCAAACTTTCCTTTATTTTTGGCTTTTGCAGCTTTGATTTTTGGGTC
ATAATGTTATGTTAAGTAATATAAAATTTTTCCCATATATTGATTATAAAAGATATATTT
ATTAATAATAAATTATAAGTTGTGATAAAGATGGCAAGAAATACGAAGGAGTTAATGTGG
ATAGCGTTGAAATAGAAATAGACCATTATATGCTTGATAATGATATTAAAGAAATAAATG
ATATTAGAAGAGAACTTAGGGCTTGCTTAGATGAAGATAGTTTTTTCAATGGATAAGCTA
ATCTGCAGCTAGATTTATGGAATAAAGTAAAAAGAAAATTACTTTCTAGAGTAATGATGA
GACATGTTGATTCTGAGAAATGGGAAGACATATATAGCAAGGAATATCTAAATGGGACTT
TTTCTGTAAATGTTGAAGAATAAAACAAATAAAAGGTGATGAAAATACTGAATAGTATCA
GGACGACAAATAGTTCTGAAAATTGTAAAACAAGTGAATGTTAAAACGAAGAAATGGATT
TAGAAAAAAATAACAATTCATTATCAATTGCATAACAAAATTAAAAAAAGAGAAATGTTA
AGTTATTATTTTAGAATCATAAAAGAAAAAACAACTAAGAAAAAATAACTCATGCTTCTG
AGAAAGGATTTATGAATTAAATTCTTCAAACTAAGAAGTAGGAATCGAATCTTGTAACTC
TTTCTGAATAGGAAAATATCAATCTTTTATAGGAATACTTTGAGAATTACAATATTTGGA
AGCAAATGAAAATGAGAGAACTCAAGAGATTTTTCCTTCTTCATACCATAGATGAGCCAA
TTATAACTTGCAAAGCTTGCTATGTAACTTTAGATTAATCTAATAAGAATAAAAATAACA
ATTTTTTTTTTAAAAAAGCATTAACTGCTCTTTTAAGTGCCTTTGTTCAAAGCAAATAAA
TTGTAAGCCCAACTTGAAAAGTTTATGAAATTAAATTTTAATGGTTTTACAGATAATTTA
TATTTGAAGGACATTAAAATTGAATAGCTACTTCAAGAAGCAGAATTTAACCAAGATAAA
ACCAAATATAAAGTAAATTTTTTAATTAGTTCTCAGACCAACTTTAATTGTAAAATTTAA
AGACTTAATAGGAAAAAGATTTAGAACAAAATGCAGATTTTATCAAAGAATTGAAATATA
ATTTTAATTAACTCAATTCATAAAACTCAGATCAAATTTATAGCTTCAAATATTATGGTA
AATTTTTTCATTTAAATTATTTAAACAAATTAAATATAAATTTAACTTAAAGCCTGTTAA
AATGGCCATCTTATTGGATTTACTTAAGACGATAATTAGTTATATAATCAAATGCATATC
CCAGATTGCAACCAGCTCCTAATTCTATATCCAGACCTTGAATATAAAGTATTTAGTGGG
TATGAAGACTTTTAAGAGGTTAAGTTAACTGAAGATTAGTAAATTGAAATATAAGAACAC
AAAGCTTTAATGCTTCTTGAGCTAAATGAAATAAGTTGTATCATCTGTAATTGTGTCATG
AATGACAGTGAAAAGAAAGATGAAGAAATCAAATTCTAAGATTAAAACGTAACTGACTGG
AGATCAAAGCTTGAGAAGCATATGAAAACAGAAGCCCATAAGTTGAATGAAGAAATCTTT
TTAAAATCAACAAGATCTCCAAATTACTTTTTCACAAATTGA