Identifiers and Description

Gene Model Identifier

TTHERM_00637650

Standard Name

ELP3 (ELongator Protein 3)

Aliases

PreTt19768 | 91.m00183 | KAT9

Description

Histone acetyltransferase; ELP3 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04055 ) radical SAM domain protein
  • ( PF00583 ) acetyltransferase, GNAT family
  • ( TIGR01212 ) radical SAM protein, TIGR01212 family
  • ( TIGR01211 ) histone acetyltransferase, ELP3 family
  • ( TIGR01210 ) conserved hypothetical protein TIGR01210
  • ( TIGR01638 ) Arabidopsis thaliana cystatin-related protein
  • ( TIGR00539 ) putative oxygen-independent coproporphyrinogen III oxidase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00637650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_262440
WormBaseWBGene000141239.997093137033517e-262locus:elpc-3 Probable elonga
tor complex protein 3 status
:Confirmed UniProt:Q23651
protein_id:CAB01454.2
Tetrahymena borealisEI9_03582.19.997093137033517e-262histone acetyltransferase, ELP
3 family protein (571 aa)
DictyBaseDDB_G02901039.997093137033517e-262elp3 on chromosome: 5 position
3656306 to 3658157
OxytrichaContig23083.0.g1029.997093137033517e-262Radical SAM superfamily
SGDYPL086C9.997093137033517e-262ELP3 Subunit of Elongator comp
lex, which is required for mod
ification of wobble nucleoside
s in tRNA; exhibits histone ac
etyltransferase activity that
is directed to histones H3 and
H4; disruption confers resist
ance to K. lactis zymotoxin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00637650(coding)
ATGCCTAATAAAGATAAAATAGAAAATAAGGCTACTATTGAAAAGTAGAAGAAGCCTGGT
AAAATTAGTGGCGATGATCCCGTAGCAGTTTTAAAGACTATCTCAGAAATTGTCTCCGAA
TTAATCAATGCATATGAAAAGAATGAAAAAATTAATTTAACCAAGGTTAAGAGTGAACTC
TCTAGAAAGAATAAATTAAGCGGTACTCCTAAAATTGTTGACATTATTGCAGCCATCCCT
GAAAAATATAAGAATACTTTAATTCCTATTTTGAAAGTAAAGCCAGTAAGAACTGCTAGT
GGTATTGCTGTCGTTGCTGTCATGTGTAAGCCACATAGATGTCCTCATATAGCCACTACA
GGAAATATTTGTGTTTACTGTCCAGGAGGTCCTGACTCTGATTTTGAATATTCCACATAG
AGTTACACTGGTTATGAACCTACTTCTATGAGAGCTATTAGAGCTAGATATAATCCCTAC
ATTTAAACTAGAGATCGTGTAGAATAATTAAAGAAATTAGGTCATGATGTTGATAAAGTA
GAATTCATTATTATGGGTGGTACATTTATGTCATTAGATGCAAGCTATAGAGATTATTTC
ATTCGTAACTTGCACGATGCCTTGAGTGGTCATAGATCTCACAATGTTGCTGAAGCAATT
AAATTTTCTGATGAAAGTAGAGCTAAATGTATTGGTATTACTATTGAAACAAGACCTGAT
TTTTGTTATTAACCTCATCTTTCTGACATGCTTCTATATGGATGCACCCGTATTGAGGTT
GGTGTCTAATCAATTTATGAAGACGTTGCAAGAGATACTAATAGAGGTCATACAATTGAA
GCCGTCAAAAAATGCTTTAGACTTTCCAAGGATGCAGGCTTCAAAGTAGTTTCACATTTA
ATGCCTGATCTTCCAAATATGGGTATTGAGAGAGATCTCGAATCATTTAAAGAATTCTTT
GAAAATCCTGATTTCCGTACTGACGGTTTGAAGATTTATCCCACTTTGGTTATTCGTGGC
ACAGGTTTATACGAGCTTTGGAAAAATGGAAAATACAGAAACTATAATCCCAATGCATTG
GTAGAAATTGTAGCTAAATTGTTAGCTTTGGTTCCTCCATGGACTAGAGTTTACAGAATA
TAAAGAGATATTCCTATGCCTCTTGTTACAAGTGGTGTAGATAATGGTAATTTAAGAGAG
TTGGCTTTGTAAAAAATGAGAGACATGAACATTCCATGCAGAGATGTAAGAACTCGTGAA
GTAGGTATTAAGGAAGTTCACTTCAAAATTAAGCCTGAGTAAATCGAATTTATAAGAAGA
GACTACTTTGCTAACGATGGTTGGGAATCTTTCCTCGCATATGAAGATCCCATCTAAGAT
ACATTGGTAGGTCTGCTTAGACTTAGAAAATGTGGAGCTTCAACTTTTAGACCTGAATTA
ACTGGAAATTGCTCAATTGTAAGAGAATTACACGTTTATGGCTCAATTGTGCCAATTCAC
TCAAGAAATCCCTAAAAATTCTAGCATCAAGGTTATGGTACTATGTTAATGGAAGAAGCC
GAAAGAATATCAAGAGATGAACACGGTTCTATAAAATTGGCTGTTATTGCTGGTGTTGGT
ACTCGTCATTATTATAGAAAGCTTGGTTACCACCTCGAAGGCCCTTACATGGTTAAATAT
TTAGATGGAAGAGAGTAATACGTTGATTGA


>TTHERM_00637650(protein)
MPNKDKIENKATIEKQKKPGKISGDDPVAVLKTISEIVSELINAYEKNEKINLTKVKSEL
SRKNKLSGTPKIVDIIAAIPEKYKNTLIPILKVKPVRTASGIAVVAVMCKPHRCPHIATT
GNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYIQTRDRVEQLKKLGHDVDKV
EFIIMGGTFMSLDASYRDYFIRNLHDALSGHRSHNVAEAIKFSDESRAKCIGITIETRPD
FCYQPHLSDMLLYGCTRIEVGVQSIYEDVARDTNRGHTIEAVKKCFRLSKDAGFKVVSHL
MPDLPNMGIERDLESFKEFFENPDFRTDGLKIYPTLVIRGTGLYELWKNGKYRNYNPNAL
VEIVAKLLALVPPWTRVYRIQRDIPMPLVTSGVDNGNLRELALQKMRDMNIPCRDVRTRE
VGIKEVHFKIKPEQIEFIRRDYFANDGWESFLAYEDPIQDTLVGLLRLRKCGASTFRPEL
TGNCSIVRELHVYGSIVPIHSRNPQKFQHQGYGTMLMEEAERISRDEHGSIKLAVIAGVG
TRHYYRKLGYHLEGPYMVKYLDGREQYVD


>TTHERM_00637650(gene)
ATGCCTAATAAAGATAAAATAGAAAATAAGGCTACTATTGAAAAGTAGAAGAAGCCTGGT
AAAATTAGTGGCGATGATCCCGTAGCAGTTTTAAAGACTATCTCAGAAATTGTCTCCGAA
TTAATCAATGCATATGAAAAGAATGAAAAAATTAATTTAACCAAGGTATATTAAATATGA
AGATTTAGCTATACTTTTTAGGTTTAATTCAATTCAGAAAGGTAAACACCTTATTTAACT
AAAATAGGTTAAGAGTGAACTCTCTAGAAAGAATAAATTAAGCGGTACTCCTAAAATTGT
TGACATTATTGCAGCCATCCCTGAAAAATATAAGAATACTTTAATTCCTATTTTGAAAGT
AAAGCCAGTAAGAACTGCTAGTGGTATTGCTGTCGTTGCTGTCATGTGTAAGCCACATAG
ATGTCCTCATATAGCCACTACAGGAAATATTTGTGTTTACTGTCCAGGAGTAATTATTTA
TTCTTAAACTTTAAATAGCAAAGAGCGAAAAAATTGATCATTTATTTGGAAAGAAAAAAA
ATGAAAATGCAAGATTTTAGCAATCTTTAAATAGGATTTAATCAAAATTAATGTAAATTT
TATTATTGAAAAGGGTCCTGACTCTGATTTTGAATATTCCACATAGAGTTACACTGGTTA
TGAACCTACTTCTATGAGAGCTATTAGAGCTAGGTAAGAGAATTTAATTATCATTCAATA
GAAAAATATATAGTGTCTATGTTGTAAAAGTTATTTGCATAGAAAGAGTTTTCAGATTAA
TCCCAAGAAATTTCTTAATTTTTTTTTATTGAATGGTTTGTAAAAGTAGAAAGAATCATC
AAGCATATACCTTAAATTAAATTGAATAAAATATTTTAATACTAAGTCTAAATTATTTAA
TAAAATATAGATATAATCCCTACATTTAAACTAGAGATCGTGTAGAATAATTAAAGAAAT
TAGGTCATGATGTTGATAAAGTAGAATTCATTATTATGGGTGGTACATTTATGTCATTAG
ATGCAAGCTATAGAGATTATTTCATTCGTAACTTGCACGATGCCTTGAGTGGTCATAGAT
CTCACAATGTTGCTGAAGCAATTAAATTTTCTGATGAAAGTAGAGCTAAATGTATTGGTA
TTACTATTGAAACAAGACCTGATTTTTGTTATTAACCTCATCTTTCTGACATGCTTCTAT
ATGGATGCACCCGTATTGAGGTTGGTGTCTAATCAATTTATGAAGACGTTGCAAGAGATA
CTAATAGAGGTCATACAATTGAAGCCGTCAAAAAATGCTTTAGACTTTCCAAGGATGCAG
GCTTCAAAGTAGTTTCACATTTAATGCCTGATCTTCCAAATATGGGTAATTTTACTAATA
ATTTTATAAATTTTAAATGTAAAAATATTAAATTAAACAGGTATTGAGAGAGATCTCGAA
TCATTTAAAGAATTCTTTGAAAATCCTGATTTCCGTACTGACGGTTTGAAGATTTATCCC
ACTTTGGTTATTCGTGGCACAGGTTTATACGAGCTTTGGAAAAATGGAAAATACAGAAAC
TATAATCCCAGTAAATTGAATTTATTTGTAGTTGTTAGATTATTAAATAAATAAATATAA
ATAGATGCATTGGTAGAAATTGTAGCTAAATTGTTAGCTTTGGTTCCTCCATGGACTAGA
GTTTACAGAATATAAAGAGATATTCCTATGCCTCTTGTTACAAGTGGTGTAGATAATGGT
AATTTAAGAGAGTTGGCTTTGTAAAAAATGAGAGACATGAACATTCCATGCAGAGATGTA
AGAACTCGTGAAGTAGGTATTAAGGAAGTTCACTTCAAAATTAAGCCTGAGTAAATCGAA
TTTATAAGAAGAGACTACTTTGCTAACGATGGTTGGGAATCTTTCCTCGCATATGAAGAT
CCCATCTAAGATACATTGGTAGGTCTGCTTAGACTTAGAAAATGTGGAGCTTCAACTTTT
AGACCTGAATTAACTGGAAAGTATATATAATATTTTTAAATGGTTTTTTTTTTAAATTTA
TTTTAATTAAAAGTTGCTCAATTGTAAGAGAATTACACGTTTATGGCTCAATTGTGCCAA
TTCACTCAAGAAATCCCTAAAAATTCTAGCATCAAGTATTTCATCAATTAAATATTGCTT
TTATATTAATCTAACTAATAAAATAGGGTTATGGTACTATGTTAATGGAAGAAGCCGAAA
GAATATCAAGAGATGAACACGGTTCTATAAAATTGGCTGTTATTGCTGGTGTTGGTACTC
GTCATTATTATAGAAAGCTTGGTTACCACCTCGAAGGCCCTTACATGGTTAAATATTTAG
ATGGAAGAGAGTAATACGTTGATTGA