Identifiers and Description

Gene Model Identifier

TTHERM_00024050

Standard Name

ELP1 (ELongation Protein 1)

Aliases

PreTt12018 | 1.m01066

Description

RNA polymerase II elongator complex subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00024050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13868.19.997093137033517e-262hypothetical protein (1315 aa)
OxytrichaContig9231.0.g152.0001055857497602e-161IKI3 family
DictyBaseDDB_G02840753.000969471571755e-58elp1 on chromosome: 4 position
1525708 to 1529993
SGDYLR384C9.995951036711152e-55IKI3 Subunit of Elongator comp
lex, which is required for mod
ification of wobble nucleoside
s in tRNA; maintains structura
l integrity of Elongator; homo
log of human IKAP, mutations i
n which cause familial dysauto
nomia (FD)
Stentor CoeruleusSteCoe_17422.3802664086944007e-26
WormBaseWBGene000224634.999617891954556e-16locus:elpc-1 status:Partiall
y_confirmed UniProt:Q9N595
protein_id:CCD66208.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00024050(coding)
ATGAGAAACATTTTATTATCTGATTATTACAAGTTTAATATTGAAGAATTAGCCGATATT
GAGGCTTTTGATTTCGAAGAATTCTCATACACTCTCTACATTATCACCAAGTCAAAAATT
TTGTATGCAATCAAGATTGAGAGCTTAGAGAGTCACGAAATCATTTTTAAAGCTGATTTG
AGCAATGATATCTGCGATGTAGAAAAGGTTTTGGGAATCAAGTATATTTTAGAATTAGAA
AGTGTCATTATCATTTAACAAAGTGGAGAAATTATGAAATTCAGCATTTCTGATAAATCT
TGTGAAAGTGTTGGATGCATCGAAAACGGAATTTTAGGTTTTTCATATTCTCCTAACTAG
GAATAACTTATTGTGGCTACTGGAAATCATACATTAATATCTTTTGATAATAACTTCGAC
GTTTCAAAAGAAGTTCATATTGATGAAGATGCTAATTCATTTAAGGCTCCTTCATCTCCT
TAGCCTGTTTACTTTGCATGGAAGGCAGATGCTAAGTTCTTTGCTTGCAATTTTGCAGTT
GAAGGTGGACGTAAAAGTTTAACCAGAAGCACTGAACTCGAAGTATTTAAGTCAGCTGCT
CAACCTGATCCAGATGGTCAAAATGTAGTATCAGTTTCTGAAGAACCAACTGAGAATTTG
TAAGGACCCATCAGCTGGTAGCCTACTGGTAACTTTATTGCTGGTGTTGATAGAAAGCCT
TCAAAGCAAGATAAATCAAAAACTTTAACTAGAGTTATTTTCTGGGAAAAGAATGGTTTG
AGACATTTGGAGTTTAATTTACCAAATTTAAAGGACTCCTTAAACACTGATTCTAACTTA
ATAGAAGTAATCAACTTATAATATAACAAGGAATCTGAAATATTAGCTGTCCATGTCAAA
GAAGAGGAATCTCAAGAAAGCATTTTGCTCTATCACAGAAGCAATTACAGATGGTACTTA
AAAAAAGTTGTTTAATGTTTAGATGGTATTAAAATCAATGGATTAATTTGGTGTCTCCAA
AACAGTAAGAGACTTGTTATTGTTTATGAATAAAACTTTATTGAAGTTCTCGACTTATCT
CTTGTCCATTCTTAAAACATTCATGACACTGCTCATGAAAATAATCTCTCTCTTATACCT
TCTGTAGATAACAACAAGATACTCACTACAGTCTTTAAAAGAACCATTATGCCTCCTCCT
ATGTCTAACTTCGAGTTAGCCCTCCCTAATCCAGTCTTAGGATTCTCAGCAGGAAACAAC
TATATTTGTGCTGCTTGTGAGAATAGCTTTGAAATTTTCACTGTTGACAATAATTTGGGA
TTGAAGTAAAAGACAATTAAAAACGAAGTCAGTAAATAGAGCAATAGACTCAGATAATTC
TTAATGGTTCCCTATGAAGATAAATACTCTATTTTCTTTGTTCATAATAAAGGAGAATCT
AAATTTATAGTAGAAATAGTACTAGATAGCAACATGAATGTTATAAACACTTTCGAGAAG
AGCATTAAGAACTCTCTTACTGCTACTTGTGTATCAGGTTATTTGTATACCTAAACAACT
AAAGGAGGTCAAAAATCAGACGATAATGATGATGAAGAAGAGGAATATGGATTTTAAGAT
AAATCTAGTGGAAATTACTTGTTCATTTAAAACTCCAAAGGCACCGTCTTCAAGTATTTC
TTAAATGATGACTCTAAAATTGAAAAACACTCCACTTTTGAAATTCCTGCTTCTAAAATC
CAAGCCACTGTTTTGAATGGAATGGAATATCTCTTTGGTCTTTCTCATAACTACAGATTT
ATGCTTGGCTCTAAAATTATTTCTTCACAAGCTACTTCATTTGCTCTTTATGATTCATTT
GTTTTGTTTACTTAAAATACTCTCGGTATGTACTAATGCATGTATGTCTACGATTTGAGT
GATCCTAAGAATCCTTTAGCTGGTCTTTCTGATTCAGTTGTTCTTCCTTCTCCAGAAAGC
AAGAGCTTGAATGTTAGAAACATTGAAAGAGGTAGCATCATTGTTTCTGTTGCAAATGAC
AAACTTGTATTTTAATTACCTAGAGGAAATTTAGAAACTATAAATCATAGAATTATTTTC
TTAAGAAAAGTTAAAAAGTTAATCGATTAAGATTAATATAACACTGCCTTCGAGTTATGT
AGAACTAATAAGCTCGATATTAATGTTATCTTTGATATCAACCCCAAAAAGTTTATTGAA
AATGCCTAATCAATTTTAACTAAATTCAAAAAAACTGACTATATCAACCTATTGATAGCC
TAAGTTAAGAATGAACTTTCAGATGAAATTCAATACTGTATCTATGATGAAGAACTATAA
GAACTTAAAAACTATCACACAACTCATCTAAGTAAAAAAGTTAACACTTTCTGTGATTCT
ATTATCAAAGCACTTGAAGCAACCAAAAACGAAAAGTATTTGTATTCTTAATTTACTGCT
CATATTAGAAAGGAGCCCAGCGAACTTGAATTTGTTCTTAACACTATTAAATAAATGAAA
GATGAAGAAGCTGAACATATTCCTGAAAATTATCCTCCTCATTTAAATCCTGCAAATAAC
AAAAGATTTGAACATAAAAGGCTTGTTACTGCTAGAAGCTTACTTGAATATGTTTGCTGG
TTAGCTGATGCTGAAAAAATATACGAAGTATCTTTAGGTACTTATGATTTAGATTTAGTT
GCTATGGCTGCTCAATTCACTCAAAAAGATCCTAAGGAATACGTTCCTTACTTAGAAAAA
TTGAAAGCTATGACTGATTTAGTTGAAAGAAAGTATGTTATTAACATGGATTTAAAGAAA
TACGATCGTGCTGTGGTTGTTCTTTCTTAGGGCAATGCTGATTAAAAGAAAAGAGCTATT
AGCTTAATCAAGCAACATAACCTTTTCAATGTTGGTCTCAAGACTTTTAAGTCTGAACCA
TAGATTATTCGTGAAGTTAAAGTTTATATGGGTGAATATTTGGCTTCTAAAAAAGAATTC
TAGCAAGCACTTCTTGCCTTTGAATCAGTTCATGCATTTGAAGAAGCCTTGTCTGTTTGC
AAGAAATCAGGTGAAGTCAAGAGAGCTCTCTATTATGCTAACAAACTCAAAAAAAATGAA
GAAGAAAAGCAAACTATTCTTAAAGAAATTCTTCACGAACTCCTCCTTAACGAAAACCAT
TCTTAGGCTGGTAAGGTTTACCACTAGTTAGGAGACAATAAGACTGCTTTAGAGCATTTT
GTTAAGGGTTCAGATTGGGCTGCTTGCACAAAAACTCTTCTTAAAATGGAAGAAGATCAT
GATGTCATCAAAGCAGAAATCATTGTACCAGGATTAGAACTTGCTTCAAATCTTAAGGCT
AACCTTTTAAGACAATACAGATAAACTTTCAGTAGTAAATATGCTAGACTTAAAGTTGTT
TAATAGGAAAAGAAAATGAGACCTCAATTATTGGGAGAATTAGGTGCAGGACAGTTTAGT
AATCAAGAAGCTGATATGATTTCAGACATATCTGAATCAACTCAAAAGACTACTACCACA
CATACTTCATATACATTCTCTATTACAACTGGTATGAGAAAGAAGAAGGACAAAAAACCT
AAGAATCTCCTCAAGAGAAATATCAAAGAAGGCTCTCCCATAGAAGAAGAGTACATAGTT
GATTTCTTAACTGAAATGCAAGGCTAAATGGGAATCTTCACCGATTGCAAGAATTTAATA
CAATATTTAATTTATTACGACTTGATTGATGCTGCCGAAGAGCTAAACAAAGAAATGAAG
CTATACGAAGAAGAAATTAACATAAAAGTAAAGTCTCTCAAACAATCTCTTTTCGAAGAA
CAAAATCCTCAATTAGCAGAATTGTATCCTAACATTAAACAATTCGATAACAAAGTTAGT
AAAGCCTTTGATGTCTTCTTAAATAACTTTGATCACGTTTTAGTTTGA


>TTHERM_00024050(protein)
MRNILLSDYYKFNIEELADIEAFDFEEFSYTLYIITKSKILYAIKIESLESHEIIFKADL
SNDICDVEKVLGIKYILELESVIIIQQSGEIMKFSISDKSCESVGCIENGILGFSYSPNQ
EQLIVATGNHTLISFDNNFDVSKEVHIDEDANSFKAPSSPQPVYFAWKADAKFFACNFAV
EGGRKSLTRSTELEVFKSAAQPDPDGQNVVSVSEEPTENLQGPISWQPTGNFIAGVDRKP
SKQDKSKTLTRVIFWEKNGLRHLEFNLPNLKDSLNTDSNLIEVINLQYNKESEILAVHVK
EEESQESILLYHRSNYRWYLKKVVQCLDGIKINGLIWCLQNSKRLVIVYEQNFIEVLDLS
LVHSQNIHDTAHENNLSLIPSVDNNKILTTVFKRTIMPPPMSNFELALPNPVLGFSAGNN
YICAACENSFEIFTVDNNLGLKQKTIKNEVSKQSNRLRQFLMVPYEDKYSIFFVHNKGES
KFIVEIVLDSNMNVINTFEKSIKNSLTATCVSGYLYTQTTKGGQKSDDNDDEEEEYGFQD
KSSGNYLFIQNSKGTVFKYFLNDDSKIEKHSTFEIPASKIQATVLNGMEYLFGLSHNYRF
MLGSKIISSQATSFALYDSFVLFTQNTLGMYQCMYVYDLSDPKNPLAGLSDSVVLPSPES
KSLNVRNIERGSIIVSVANDKLVFQLPRGNLETINHRIIFLRKVKKLIDQDQYNTAFELC
RTNKLDINVIFDINPKKFIENAQSILTKFKKTDYINLLIAQVKNELSDEIQYCIYDEELQ
ELKNYHTTHLSKKVNTFCDSIIKALEATKNEKYLYSQFTAHIRKEPSELEFVLNTIKQMK
DEEAEHIPENYPPHLNPANNKRFEHKRLVTARSLLEYVCWLADAEKIYEVSLGTYDLDLV
AMAAQFTQKDPKEYVPYLEKLKAMTDLVERKYVINMDLKKYDRAVVVLSQGNADQKKRAI
SLIKQHNLFNVGLKTFKSEPQIIREVKVYMGEYLASKKEFQQALLAFESVHAFEEALSVC
KKSGEVKRALYYANKLKKNEEEKQTILKEILHELLLNENHSQAGKVYHQLGDNKTALEHF
VKGSDWAACTKTLLKMEEDHDVIKAEIIVPGLELASNLKANLLRQYRQTFSSKYARLKVV
QQEKKMRPQLLGELGAGQFSNQEADMISDISESTQKTTTTHTSYTFSITTGMRKKKDKKP
KNLLKRNIKEGSPIEEEYIVDFLTEMQGQMGIFTDCKNLIQYLIYYDLIDAAEELNKEMK
LYEEEINIKVKSLKQSLFEEQNPQLAELYPNIKQFDNKVSKAFDVFLNNFDHVLV


>TTHERM_00024050(gene)
ATGAGAAACATTTTATTATCTGATTATTACAAGTAAAAAATATTTATTAAAATAATAAGA
TATTCTTTGTGTATAAAACAAGTATATTTCATTTCTTTTTCTCATTAAATCAGGTTTAAT
ATTGAAGAATTAGCCGATATTGAGGCTTTTGATTTCGAAGAATTCTCATACACTCTCTAC
ATTATCACCAAGTCAAAAATTTTGTATGCAATCAAGATTGAGAGCTTAGAGAGTCACGAA
GTAATTTAATTAAATGATTGGAATATGTGTTAAAACACACAAGCTATTTTTATTCCAAAT
ATAAACTTATTGGCTTGTTTTAGCTAAATTTACAATAATTCAAAATAGATCATTTTTAAA
GCTGATTTGAGCAATGATATCTGCGATGTAGAAAAGGTTTTGGGAATCAAGTATATTTTA
GAATTAGAAAGTGTCATTATCATTTAACAAAGTGGAGAAATTATGAAATTCAGCATTTCT
GATAAATCTTGTGAAAGTGTTGGATGCATCGAAAACGGAATTTTAGGTTTTTCATATTCT
CCTAACTAGGAATAACTTATTGTGGCTACTGGAAATCATACATTAATATCTTTTGATAAT
AACTTCGACGTTTCAAAAGAAGTTCATATTGATGAAGATGCTAATTCATTTAAGGCTCCT
TCATCTCCTTAGCCTGTTTACTTTGCATGGAAGGCAGATGCTAAGGTAAAAAATGAACAT
TCTATTATTAAACAAATAAAAAGCTAAGATATATATTATTTAATTATGTTTAATGTGCAA
ATATAACAAATAAATAAATAAATAATTGATTGATTGATCAATAATATCAATAAAAAAATC
TATATTTATTCTGAAGTATTTTATTAAGTACGTTATTAACTGGTCTATTTTTATCTATAA
AAGTTCTTTGCTTGCAATTTTGCAGTTGAAGGTGGACGTAAAAGTTTAACCAGAAGCACT
GAACTCGAAGTATTTAAGTCAGCTGCTCAACCTGATCCAGATGGTCAAAATGTAGTATCA
GTTTCTGAAGAACCAACTGAGAGTAAAAATAAATTAAATTATTTCAAGTAAAATTAAATG
AAAATGATAAATTTATGATAATAATTCAAAAGATTTGTAAGGACCCATCAGCTGGTAGCC
TACTGGTAACTTTATTGCTGGTGTTGATAGAAAGCCTTCAAAGCAAGATAAATCAAAAAC
TTTAACTAGAGTTATTTTCTGGGAAAAGAATGGTTTGAGACATTTGGAGTTTAATTTACC
AAATTTAAAGGACTCCTTAAACACTGATTCTAACTTAATAGAAGTAATCAACTTATAATA
TAACAAGGAATCTGAAATATTAGCTGTCCATGTCAAGTAATTTATCAATTTATATTGAAA
AGTTTGTTGCTAAATATTTAAAATGACCATTTAAATAGAGAAGAGGAATCTCAAGAAAGC
ATTTTGCTCTATCACAGAAGCAATTACAGATGGTACTTAAAAAAAGTTGTTTAATGTTTA
GATGGTATTAAAATCAATGGATTAATTTGGTGTCTCCAAAACAGTAAGAGACTTGTTATT
GTTTATGAATAAAACTTTATTGAAGTTCTCGACTTATCTCTTGTCCATTCTTAAAACATT
CATGACACTGCTCATGAAAATAATCTCTCTCTTATACCTTCTGTAGATAACAACAAGATA
CTCACTACAGTCTTTAAAAGAACCATTATGCCTCCTCCTATGTCTAACTTCGAGTTAGCC
CTCCCTAATCCAGTCTTAGGATTCTCAGCAGGAAACAGTAAAATTTTATAAATTTAAAAA
ATAAAATACTCAAATCAGTCTATTAAATGACATTAAGTTTGGTTAACATTCACATAAAAT
TAATATAAACAAAAATATAACTAATTATTAAAATAAAATACTAAAGAGTAATTCTCATTC
ACTAGGTTAAACTAATATAAACACGATGCAACATAAATATTGTTATAAACAAATATAAAG
TAATTCTTACTAAGTTAAAAATAATTAGCAATTAAATCAGTTTAGAAAAACGAATAATCA
GTTTTTACTATTAAAATATATTAAATTCATTAAATAATTTATAGAAAAAAGAAAAAAAAT
ATATTACAATTCAAATTTACTTCAAAAATTACATCAAATTAATAAATAATATGGATTAAT
TAATTAAAAATCACATGAACTAAATTGAAATGATATTTCTGATTAACCTCCGTAGTAAGT
AACATTAACTAAATAAATAAATAAATAAATAAGATTAATTAGCAATTTTTTTAGAAAAAA
TAATTTACGATTAATTTTAGAAGAATTTTAATTAAGTAAAAACAAAAATTATATTTTAAA
TAATAAGTATTTGGTTAATAATAAAAGTAGTTTGTTTTTAATTTTAAATGGAAAATTTTA
AATGATAAAACTATTTTTTTTAATTTATTATAAATTGAAAAAAGAAAGATAGATATTGAT
TGCTTGATTTTGATTGGTTTAATATTAAATAATTTATAATTTTAATTAGACTATATTTGT
GCTGCTTGTGAGAATAGCTTTGAAATTTTCACTGTTGACAATAATTTGGGATTGAAGTAA
AAGACAATTAAAAACGAAGTCAGTAAATAGAGCAATAGACTCAGATAATTCTTAATGGTT
CCCTATGAAGATAAATACTCTATTTTCTTTGTTCATAATAAAGGAGAATCTAAATTTATA
GTAGAAATAGTACTAGATAGCAACATGAATGTTATAAACACTTTCGAGAAGAGCATTAAG
AACTCTCTTACTGCTACTTGTGTATCAGGTTATTTGTATACCTAAACAACTAAAGGAGGT
CAAAAATCAGACGATAATGATGATGAAGAAGAGGAATATGGATTTTAAGATAAATCTAGT
GGAAATTACTTGTTCATTTAAAACTCCAAAGGCACCGTCTTCAAGTATTTCTTAAATGAT
GACTCTAAAATTGAAAAACACTCCACTTTTGAAATTCCTGCTTCTAAAATCCAAGCCACT
GTTTTGAATGGAATGGAATATCTCTTTGGTCTTTCTCATAACTACAGATTTATGCTTGGC
TCTAAAATTATTTCTTCACAAGCTACTTCATTTGCTCTTTATGATTCATTTGTTTTGTTT
ACTTAAAATACTCTCGGTATGTACTAATGCATGTATGTCTACGATTTGAGTGATCCTAAG
AATCCTTTAGCTGGTCTTTCTGATTCAGTTGTTCTTCCTTCTCCAGTAAAAATAAATCTA
TTTATTTTACATTTCATTTTATATTAATTTAATTACATCTAAAAATAGGAAAGCAAGAGC
TTGAATGTTAGAAACATTGAAAGAGGTAGCATCATTGTTTCTGTTGCAAATGACAAACTT
GTATTTTAATTACCTAGAGGAAATTTAGAAACTATAAATCATAGAATTATTTTCTTAAGA
AAAGTTAAAAAGTTAATCGATTAAGATTAATATAACACTGCCTTCGAGTTATGTAGAACT
AATAAGCTCGATATTAATGTTATCTTTGATATCAACCCCAAAAAGTTTATTGAAAATGCC
TAATCAATTTTAACTAAATTCAAAAAAACTGACTATATCAACCTATTGATAGCCTAAGTT
AAGAATGAACTTTCAGATGAAATTCAATACTGTATCTATGATGAAGAACTATAAGAACTT
AAAAACTATCACACAACTCATCTAAGTAAAAAAGTTAACACTTTCTGTGATTCTATTATC
AAAGCACTTGAAGCAACCAAAAAGTAATTTATCAATTAAAAAACATTTTATTTACATTTA
AAAAATCCTAAAAAATAAAATAAGAAATCAATTCAATTTTTACTTTGCAAAAAAGTACTA
TTTTCATAAAAAAATATTGATTTTTTAAATATAAATATACCTTAAAATATCATTTAAAAA
TAAATGATGAAAATTTTAATAAAAACAAACTATCATGAATTATCTCTTTAAGATAAAATA
AAATAAAATTTTAAAATTATTACAAATAAATGAAAATGTAAAGTAACTTGAAATTGAAAT
TGATTATTTATTTTATTCAATTCACCTTTTTAAAAAATAAATAAATAAATAAATTTATTT
TACATATTTAAATAATAGCGAAAAGTATTTGTATTCTTAATTTACTGCTCATATTAGAAA
GGAGCCCAGCGAACTTGAATTTGTTCTTAACACTATTAAATAAATGAAAGATGAAGAAGC
TGAACATATTCCTGAAAATTATCCTCCTCATTTAAATCCTGCAAGTAATTCAAAAACTTT
ATTAAAAAAAATAAAATTAATTTGATTTTTTAAAGATAACAAAAGATTTGAACATAAAAG
GCTTGTTACTGCTAGAAGCTTACTTGAATATGTTTGCTGGTTAGCTGATGCTGAAAAAAT
ATACGAAGTATCTTTAGGTACTTATGATTTAGATTTAGTTGCTATGGCTGCTCAATTCAC
TCAAAAAGATCCTAAGGAATACGTTCCTTACTTAGAAAAATTGAAAGCTATGACTGATTT
AGTTGAAAGAAAGTATGTTATTAACATGGATTTAAAGAAATACGATCGTGCTGTGGTTGT
TCTTTCTTAGGGCAATGCTGATTAAAAGAAAAGAGCTATTAGCTTAATCAAGCAACATAA
CCTTTTCAATGTTGGTCTCAAGACTTTTAAGTCTGAACCATAGATTATTCGTGAAGTTAA
AGTTTATATGGGTGAATATTTGGCTTCTAAAAAAGAATTCTAGCAAGCACTTCTTGCCTT
TGAATCAGTTCATGCATTTGAAGAAGCCTTGTCTGTTTGCAAGAAATCAGGTGAAGTCAA
GAGAGCTCTCTATTATGCTAACAAACTCAAAAAAAATGAAGAAGAAAAGCAAACTATTCT
TAAAGAAATTCTTCACGAACTCCTCCTTAACGAAAACCATTCTTAGGCTGGTAAGGTTTA
CCACTAGTTAGGAGACAATAAGACTGCTTTAGAGCATTTTGTTAAGGGTTCAGATTGGGC
TGCTTGCACAAAAACTCTTCTTAAAATGGAAGAAGATCATGATGTCATCAAAGCAGAAAT
CATTGTACCAGGATTAGAACTTGCTTCAAATCTTAAGGCTAACCTTTTAAGACAATACAG
ATAAACTTTCAGTAGTAAATATGCTAGACTTAAAGTTGTTTAATAGGAAAAGGTAATAAA
TAAATAATATAAAAATCAATAAGTAATTGTTTTTTAAATGAATTCTAATAATAAAGAAAA
TGAGACCTCAATTATTGGGAGAATTAGGTGCAGGACAGTTTAGTAATCAAGAAGCTGATA
TGATTTCAGACATATCTGAATCAACTCAAAAGACTACTACCACACATACTTCATATACAT
TGTAATTAGTTTTTTAAAATTTGTAATTATTTAAGTAAAATTTGGTTTGTTTTATTAATT
TAGCTCTATTACAACTGGTATGAGAAAGAAGAAGGACAAAAAACCTAAGAATCTCCTCAA
GAGAAATATCAAAGAAGGCTCTCCCATAGAAGAAGAGTACATAGTTGATTTCTTAACTGA
AATGCAAGGCTAAATGGGAATCTTCAGTAATTATTATTGCAATTATATTCCAGAATAAAT
AATTTTTATTCTTTAAAAATAGCCGATTGCAAGAATTTAATACAATATTTAATTTATTAC
GACTTGATTGATGCTGCCGAAGAGCTAAACAAAGAAATGAAGCTATACGAAGAAGAAATT
AACATAAAAGTAAAGTCTCTCAAACAATCTCTTTTCGAAGAACAAAATCCTCAATTAGCA
GAATTGTATCCTAACATTAAACAATTCGATAACAAAGTTAGTAAAGCCTTTGATGTCTTC
TTAAATAACTTTGATCACGTTTTAGTTTGA