Identifiers and Description

Gene Model Identifier

TTHERM_00732590

Standard Name

EIF6 (Eukaryotic translation Initiation Factor 6)

Aliases

PreTt02780 | 119.m00105

Description

Translation initiation factor eIF-6, putative family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01912 ) eIF-6 family
  • ( PF07197 ) Protein of unknown function (DUF1409)
  • ( TIGR00323 ) translation initiation factor eIF-6, putative
  • ( PF00132 ) bacterial transferase hexapeptide (three repeats)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.4%

TetraMine Data

TTHERM_00732590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18476.11.9999987447608204e-178translation initiation factor
eIF-6, family protein (246 aa)
OxytrichaContig6289.0.g55.0000898401533074e-117eIF-6 family
SGDYPR016C2.9990203769197855e-115TIF6 Constituent of 66S pre-ri
bosomal particles, has similar
ity to human translation initi
ation factor 6 (eIF6); may be
involved in the biogenesis and
or stability of 60S ribosomal
subunits
DictyBaseDDB_G02764933.999582750711782e-108eIF6 on chromosome: 2 position
6856691 to 6857573
WormBaseWBGene000012342.999180586171967e-98locus:eif-6 Eukaryotic trans
lation initiation factor 6 s
tatus:Confirmed UniProt:O621
06 protein_id:CAB16860.1
Stentor CoeruleusSteCoe_243441.2806276389220833e-57

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00732590(coding)
ATGGCAAGAAGATGTTAATTTGAAAACTCCAACGACATCGGAGTCTTCTGCAAACTCACA
TCAGCATACTGTTTAGTTTCCGTTGGTGCATCTGAAAACTTCTATTCTGTTTTTGAATCT
GAATTGGTCCCCCATATTCCAGTTATTCATACATCAATAGGCGGTACTCGTATCGTAGGC
AGAGTAACTTGTGGTAACAAGAACGGTTTGTTGGTCCCTAACACTTGTAATGACAATGAA
TTGAGAAATATTAGAAATTCCCTTCCTGACAACGTCAGAGTAAGAAGAATCGAAGAAAAG
CTTTCAGCTTTAGGTAATTGTGTTGTTGCTAACGATTATGTTGCCTTGATCCACCCTGAT
TTGGACAGAGAAAGTGAAGAAATTATTGCTGACACACTCGGAGTTGAAGTCTTTAGAACT
ACTATTGCTAATAACGTTCTCGTTGGTACTTACTGTGTTATCAATAATAGAGGTGGTCTT
GTTCATCCTTTAGCTTCAGTTGAAGAGTTAGACGAACTTGCTAACCTCCTTTAAATCCCC
CTTTGTGCTGGTACAATTAACAGAGGTTCTGATGTTATTGGTGCTGGCCTCGTTGTAAAT
GATTGGGCTGCTTTTTGTGGTTTAGATACTACTTCTACTGAAATCAGTGTTGTTGAAAAT
ATATTTAAATTAAATGAAATGAAAGATGAAAATATGGATAATGAAATGAGAAAAGACTTC
GTTATGAACCTCGAGTGA


>TTHERM_00732590(protein)
MARRCQFENSNDIGVFCKLTSAYCLVSVGASENFYSVFESELVPHIPVIHTSIGGTRIVG
RVTCGNKNGLLVPNTCNDNELRNIRNSLPDNVRVRRIEEKLSALGNCVVANDYVALIHPD
LDRESEEIIADTLGVEVFRTTIANNVLVGTYCVINNRGGLVHPLASVEELDELANLLQIP
LCAGTINRGSDVIGAGLVVNDWAAFCGLDTTSTEISVVENIFKLNEMKDENMDNEMRKDF
VMNLE


>TTHERM_00732590(gene)
ATGGCAAGAAGATGTTAATTTGAAAACTCCAACGACATCGGAGTCTTCTGCAAACTCACA
TCAGCATACTGTTTAGTTTCCGTTGGTGCATCTGAAAACTTCTATTCTGTTTTTGAATCT
GAATTGGTCCCCCATATTCCAGTTATTCATACATCAATAGGCGGTACTCGTATCGTAGGC
AGAGTAACTTGTGGTAATAATTTTATTAATTTTATTTTTAATAAGTTCAAATTCAATAGG
AAATTCATTTTATTTTTTTGAGGAAAACATAATTTTTCGTTCAAGAAGAATTGAGATTTG
ATTATTCTTGATGTTTTAAAAATTATTTTTATTTTTCATTGCTTAATTTTATTATTTTTA
ACAAATTAAGGTAACAAGAACGGTTTGTTGGTCCCTAACACTTGTAATGACAATGAATTG
AGAAATATTAGAAATTCCCTTCCTGACAACGTCAGAGTAAGAAGAATCGAAGAAAAGCTT
TCAGCTTTAGGTAATTGTGTTGTTGCTAACGATTATGTTGCCTTGATCCACCCTGATTTG
GACAGAGAAAGTGAAGAAATTATTGCTGACACACTCGGAGTTGAAGTCTTTAGAACTACT
ATTGCTAATAACGTTCTCGTTGGTACTTACTGTGTTATCAATAATAGAGGTGGTCTTGTT
CATCCTTTAGCTTCAGTTGAAGAGTTAGACGAACTTGCTAACCTCCTTTAAATCCCCCTT
TGTGCTGGTACAATTAACAGAGGTTCTGATGTTATTGGTGCTGGCCTCGTTGTAAATGAT
TGGGCTGCTTTTTGTGGTAATAAACTTTATTTTTTTTAAAATCAAAACCCAAAAAATAGG
ACTAAAATTTTTGTCAAAAGAGACAAAATGAATGAATGCTTGCTCAGTTTTAATTCTGAG
TTTTGTCATCTTAAATATTTAGCTATTTGTTTGCAATGGTTTTTTGTAAAAGAAATAATC
AAAAGTAACTTTTTGTAAAGTAGCTAACAAAATTTAAGAAAAGCAAATAATCCAAGCAAT
TTAGATAAAAAAAAGAAAGATAGATAGATAGAGAGATATCTACCAATCCAAAAATTAATT
ATAAAATTTAAAAGACAAATATAATTCGAGAAACTTTAATTTGATTAGATTATTTTTTAA
TTTGAAACATTAAGCAGTTTTTGATAAAACAAAATTTAAACAAAATTATTATTAATAAAA
ATAGGTTTAGATACTACTTCTACTGAAATCAGTGTTGTTGAAAATATATTTAAATTAAAT
GAAATGAAAGATGAAAATATGGATAATGAAATGAGAAAAGACTTCGTTATGAACCTCGAG
TGA