Identifiers and Description

Gene Model Identifier

TTHERM_00538910

Standard Name

EIF1 (Eukaryotic translation initiation factor 1)

Aliases

PreTt12148 | 70.m00144 | 3728.m00043

Description

Translation initiation factor SUI1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01253 ) Translation initiation factor SUI1
  • ( TIGR01160 ) translation initiation factor SUI1
  • ( TIGR01158 ) putative translation initiation factor SUI1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00538910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18202.11.0000099287337047e-53translation initiation factor
SUI1 family protein (101 aa)
OxytrichaContig4801.0.g311.0004572433669413e-23Translation initiation factor
SUI1
WormBaseWBGene000208689.997019043202629e-21locus:eif-1 status:Confirmed
UniProt:Q967F1 protein_id
:CCD72092.1
SGDYNL244C8.002082816694397e-20SUI1 Translation initiation fa
ctor eIF1; component of a comp
lex involved in recognition of
the initiator codon; modulate
s translation accuracy at the
initiation phase
DictyBaseDDB_G02742392.000769134519826e-18eIF1 on chromosome: 2 position
4232211 to 4232806

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23851459: Weisser M, Voigts-Hoffmann F, Rabl J, Leibundgut M, Ban N (2013) The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A. Nature structural & molecular biology 20(8):1015-7

Sequences

>TTHERM_00538910(coding)
ATGATAGAATAGAGTTAAATTATTAAATAAATAAATTAGTTTTTAAGTGGAGCAAGAAAG
AAAGATAAATTAGACAAATCAGAAGAACTTCTTTCTTTGTTTTAGTATGTATGTATATTT
TTTACAAGAAAAGAAGAAAAAAGGAATATATTAATAAATCAAAACAAATATAAAAATATA
CAGAAAAAAACTAGAGACTAAATATATAAAAAATTAAAAATGAACGACAACGACTTTTAG
TTTGAAAATAATATTGATGATTTCCAAACCCATATTCACATTAGAGTCGAATAAAGAAGA
GGTAGAAAGTGTTTCACCACTGTAGAAGGTATTCCTCCTGAGTTTGATTATGAAAAGATT
ATGAAATACTGGAAAAAGTGGTTGTCTTGTAACGCTACTATTGTTGAAGAAGATGAAGGA
AAAAAAGTAATTAAGCTTAATGGTGACCACAGAAATTAAATCCAATAATTCTTGAGTGAA
GAAGGTATTGCTGCTGTTGATAACATTACTATCCACGGTATCTGA


>TTHERM_00538910(protein)
MIEQSQIIKQINQFLSGARKKDKLDKSEELLSLFQYVCIFFTRKEEKRNILINQNKYKNI
QKKTRDQIYKKLKMNDNDFQFENNIDDFQTHIHIRVEQRRGRKCFTTVEGIPPEFDYEKI
MKYWKKWLSCNATIVEEDEGKKVIKLNGDHRNQIQQFLSEEGIAAVDNITIHGI


>TTHERM_00538910(gene)
ATGATAGAATAGAGTTAAATTATTAAATAAATAAATTAGTTTTTAAGTGGAGCAAGAAAG
AAAGATAAATTAGACAAATCAGAAGAACTTCTTTCTTTGTTTTAGTATGTATGTATATTT
TTTACAAGAAAAGAAGAAAAAAGGAATATATTAATAAATCAAAACAAATATAAAAATATA
CAGAAAAAAACTAGAGACTAAATATATAAAAAATTAAAAATGAACGACAACGACTTTTAG
TTTGAAAATAATATTGATGATTTCCAAACCCATATTCGTAAAGAATTATTTTTTTTAAGT
TTCAAGCAAGAAGCAAATAGAAAATCATTTTAATTCAAAGGAAAGACCAATTTAAATATT
TAACTATAGGATTTTAGTGAGAAATAGCTGCGATTTGAATTATTTTAATTTGTTAAATTT
ATGAAATAAAATAATTTTTAATCAATTAAATAACATAAAAAGACATTAGAGTCGAATAAA
GAAGAGGTAGAAAGTGTTTCACCACTGTAGAAGGTATTCCTCCTGAGTTTGATTATGAAA
AGATTATGAAATACTGGAAAAAGGTAAATAAATATTGATAATTTAAAAACATTACATAAA
TGCACATAACAAACGAGTGGATTAATCTAATGATAAAAAAAATAGATAAAAAACATATTT
TGCAACTTTTAAAATTGCTTTTGATCACAAATTAGCAGAATTTAATTGAATTTATTTATA
AAAAAGTGGTTGTCTTGTAACGCTACTATTGTTGAAGAAGATGAAGGAAAAAAAGTAATT
AAGCTTAATGGTGACCACAGAAATTAAATCCAATAATTCTTGAGTGAAGAAGGTATTGCT
GCTGTTGATAACATTACTATCCACGGTATCTGA