Identifiers and Description

Gene Model Identifier

TTHERM_00516370

Standard Name

EFR1 (Elongation Factor 2 Related )

Aliases

PreTt10729 | 64.m00209 | 3723.m00065

Description

Elongation factor 2 related protein; expressed only during conjugation, significant amino acid identity to EF-2 from other eukaryotes but with differences at some residues that are typically post-translational regulation sites

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR01393 ) GTP-binding protein LepA
  • ( PF03144 ) Elongation factor Tu domain 2
  • ( PF00679 ) Elongation factor G C-terminus
  • ( PF03764 ) Elongation factor G, domain IV
  • ( TIGR01394 ) GTP-binding protein TypA/BipA
  • ( TIGR00503 ) peptide chain release factor 3
  • ( TIGR00484 ) translation elongation factor G
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00485 ) translation elongation factor Tu
  • ( TIGR00490 ) translation elongation factor aEF-2
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR02034 ) sulfate adenylyltransferase, large subunit
  • ( TIGR00483 ) translation elongation factor EF-1, subunit
  • ( TIGR00475 ) selenocysteine-specific translation elongation factor

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00516370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_78520
WormBaseWBGene000011679.997093137033517e-262locus:eef-2 Elongation facto
r 2 status:Confirmed UniPr
ot:P29691 protein_id:CAB0298
5.1
Tetrahymena borealisEI9_08465.19.997093137033517e-262elongation factor G, domain IV
family protein (842 aa)
DictyBaseDDB_G02876859.997093137033517e-262cinC on chromosome: 5 position
689907 to 692602
OxytrichaContig22552.0.g519.997093137033517e-262Elongation factor Tu GTP bindi
ng domain
SGDYOR133W9.997093137033517e-262EFT1 Elongation factor 2 (EF-2
), also encoded by EFT2; catal
yzes ribosomal translocation d
uring protein synthesis; conta
ins diphthamide, the unique po
sttranslationally modified his
tidine residue specifically AD
P-ribosylated by diphtheria to
xin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14729267: Malavé TM, Forney JD (2004) Identification of a developmentally regulated translation elongation factor 2 in Tetrahymena thermophila. Gene 326( ):97-105
  2. Ref:12673598: Ueno H, Gonda K, Takeda T, Numata O (2003) Identification of elongation factor-1alpha as a Ca2+/calmodulin-binding protein in Tetrahymena cilia. Cell motility and the cytoskeleton 55(1):51-60
  3. Ref:10731666: Numata O, Kurasawa Y, Gonda K, Watanabe Y (2000) Tetrahymena elongation factor-1 alpha is localized with calmodulin in the division furrow. Journal of biochemistry 127(1):51-6
  4. Ref:11129794: Gonda K, Komatsu M, Numata O (2000) Calmodulin and Ca2+/calmodulin-binding proteins are involved in Tetrahymena thermophila phagocytosis. Cell structure and function 25(4):243-51
  5. Ref:10816251: Numata O, Gonda K, Watanabe A, Kurasawa Y (2000) Cytokinesis in Tetrahymena: determination of division plane and organization of contractile ring. Microscopy research and technique 49(2):127-35
  6. Ref:9019273: Kurasawa Y, Watanabe Y, Numata O (1996) Characterization of F-actin bundling activity of Tetrahymena elongation factor 1 alpha investigated with rabbit skeletal muscle actin. Zoological science 13(3):371-5
  7. Ref:8575889: Numata O (1996) Multifunctional proteins in Tetrahymena: 14-nm filament protein/citrate synthase and translation elongation factor-1 alpha. International review of cytology 164( ):1-35
  8. Ref:8743583: Kurasawa Y, Hanyu K, Watanabe Y, Numata O (1996) F-actin bundling activity of Tetrahymena elongation factor 1 alpha is regulated by Ca2+/calmodulin. Journal of biochemistry 119(4):791-8

Sequences

>TTHERM_00516370(coding)
ATGAAGACTCTCTAAATTGAGAAGATAAGAGAACTCATGATGAACCCTAACCAAATCAGA
AATATGTCTGTCATAGCCCACGTTGATCATGGTAAGACTACTTTAACTGATTCCTTATTA
GCTAGAGCTGGTATCATATCTGAAAACAACGCTGGTAAAGCATGTTTGATGGATACTGAC
CCTAAGGAGTAAGAAATGGGCATCACCATTAAGTCTACTGGAGTTTCCTTATACTATCAA
AATACTGTGACCAAGTAGGAGAGTATCATTAATTTGATTGATTCTCCTGGTCATATTGAC
TTTTCTGGTGAAGTCACTGCTGCTTTAAGAGTTACTGATGGAGCTCTTGTAGTAGTGGAT
GCTGTTGAAGGTGTTGCTGTTCAGACAGAAACAGTTCTAAGGCAGGCTTGCCAAGAGCGA
ATACGACCCGTTCTTGTAATTAATAAGCTAGACAGGCTTTTTAGTGAACTTAAGGATGAT
TATGAAAATATTTATCAAAGACTTGTTAAGATTATAGCAAAAGTTAATTCCATCTTAGAG
ATGCATGAAAACGATTCTATCAGAGGTTACACTTTAGATCCTTCACTAGGTAACGTTGCC
TTCTCTTCTGGTAAGTAGTGTTGGGGATTCACCTTAAAAACTTTTGCAAGAATTTACAGC
CAAAAATTCTCAACCAAGGAGGAAACCTTAATGGCTAAGTTATGGGGAGATAACTACTTT
AACTCTCAAACCAAATCATTCACCTCAGAAATAACCAAAATTAATAACTAAAACAAGAAA
GCTTTGCGCTCTTTCATTGAATTCGTTTTAGTTCCTTTAGATAAGTACTACTCTGCTTCT
TCAAGCGCAGATGTAGAAGTTCTATCTAAGATGGTTGAAAAGCTCAACCTCTCTACTATT
TTAACTACAGCTGAATTAGAAAGACTCAAACAAGTTGATGTTCAAGAGAGAATCAAAAGA
ACTATGAGAGCTTGGTTACCTTTAGCAGATGCTATACTTGAAATGGTCTAAGATCACCTT
CCTTCGCCTAAAGAAGCTATGAAGTATCGTAGTTTGTATCTCTACGAAGGGCCTGCAGAT
GATGAGGCTTGCACAGCCATGAGAGAATGTAATTCTGAGGGACCTCTTATGCTTTATGTT
TCAAAAATGGTCCCAACTGCAGATCTCAGCAGATTTTATGCTTTCGGTAGAGTATTCAGT
GGTACAATTTCTCAAGGAATGAAAGTTAGAGTTCAAGGCCCTGATTACAAGCCAGGAAGT
AAGGAAGGTCTCTTTATCAAAACTATCTAGAGAACCTTTTTGATGATGGGTAAATAACAC
GAACCTATCGAATCAGTACCAGCTGGAGGTACTGTCCTCATTTTAGGTGTTGATAATGCA
CTTACTAAGACAGGCACTCTTACAACTTCTGAAACAGCACATAATATCAGAAACATGAAA
TATACGATTTCACCTATATTGAGAGTTGCTGTTAATACTCCCAACTAGCAAGATCTTCCA
CGTCTTCTTGAAGGTCTTAAGATGCTTCAAAAGTATGACCCTCTTGTTTAAGTAGAAGTT
GATGAAAATACAGGTTCTTATGTTGTTGCTGGTGGTGGAGAGCTACACGTCCAAATTTGT
CTAGAAAAGCTCAATGATTTCACCCACAATTCTATCAATATCGTCGCTTCTCAGCCCACT
GTATCGTATAGAGAAACCATAGGTGATAAGAGTTCTTAAATGTGCCTTGCTAAGACTGCA
AATAAGTTGAATCGTTTATATGGTACTTGCGAACCTCTAGATGAAGAATTAGGATCAGCT
ATTGTAAGCAACAAAATAAATATACAGGAAATCAATAGTTAAGAAACAATCAACAGTTTG
GTGAATGATTACTCATGGGAAAGAGAAGATGCAAAGCGTATATGGTGCTTCGGTCCTCTA
GAAAAGGAATCAACTAATTGCATCGTAAACCAAACAGTTGGTATATAAGGTATGCCTGCC
ATTCAGCCTTCAATCATAACAGCTTTCGAATGGTGTACAAAGGAAGGTCTTTTATGTGAT
GAACCCCTAAGAAATATTCGTTTTAACATTATGGATGCAGTAATACATGTAGATCCAGCT
CACCATCGTAGCAATTAAATAACACCAGCTGCTAGAAGATTATTTAAGGCTTGCCAATAT
GTGAGTGAACCTAAAATTCTGGAGCCATTTTACTTATGCGACATTAGAATTCCAGACGAA
AGCAAAGGCCCTATATATGCAGTCTTAAACAAGAGAAGAGGTATAGTTGTTGGAGAAGAA
TATGAAGATACACTCTCTGTGATATAAGCCCACATCCCTGTATCTGAAAGCTTTGGACTA
GACTAAGCCCTGAAGTCAGCCACTCAAGGTAAGGCTATACCTGCTCTCTCATTCAGTCAC
TGGCAAGTAGTTTAAGGCAATCCACTTGACCCAGAATCAAAATCAGGTAAGATCGTCAAT
GAAATAAGAATTAGAAAAGGTTTGAATGCTAAAATACCAGAACTCAACAACTATCTTGAT
AAACTTTGA


>TTHERM_00516370(protein)
MKTLQIEKIRELMMNPNQIRNMSVIAHVDHGKTTLTDSLLARAGIISENNAGKACLMDTD
PKEQEMGITIKSTGVSLYYQNTVTKQESIINLIDSPGHIDFSGEVTAALRVTDGALVVVD
AVEGVAVQTETVLRQACQERIRPVLVINKLDRLFSELKDDYENIYQRLVKIIAKVNSILE
MHENDSIRGYTLDPSLGNVAFSSGKQCWGFTLKTFARIYSQKFSTKEETLMAKLWGDNYF
NSQTKSFTSEITKINNQNKKALRSFIEFVLVPLDKYYSASSSADVEVLSKMVEKLNLSTI
LTTAELERLKQVDVQERIKRTMRAWLPLADAILEMVQDHLPSPKEAMKYRSLYLYEGPAD
DEACTAMRECNSEGPLMLYVSKMVPTADLSRFYAFGRVFSGTISQGMKVRVQGPDYKPGS
KEGLFIKTIQRTFLMMGKQHEPIESVPAGGTVLILGVDNALTKTGTLTTSETAHNIRNMK
YTISPILRVAVNTPNQQDLPRLLEGLKMLQKYDPLVQVEVDENTGSYVVAGGGELHVQIC
LEKLNDFTHNSINIVASQPTVSYRETIGDKSSQMCLAKTANKLNRLYGTCEPLDEELGSA
IVSNKINIQEINSQETINSLVNDYSWEREDAKRIWCFGPLEKESTNCIVNQTVGIQGMPA
IQPSIITAFEWCTKEGLLCDEPLRNIRFNIMDAVIHVDPAHHRSNQITPAARRLFKACQY
VSEPKILEPFYLCDIRIPDESKGPIYAVLNKRRGIVVGEEYEDTLSVIQAHIPVSESFGL
DQALKSATQGKAIPALSFSHWQVVQGNPLDPESKSGKIVNEIRIRKGLNAKIPELNNYLD
KL


>TTHERM_00516370(gene)
ATGAAGACTCTCTAAATTGAGAAGATAAGAGAACTCATGATGAACCCTAACCAAATCAGA
AATATGTCTGTCATAGCCCACGTTGATCATGGTAAGACTACTTTAACTGATTCCTTATTA
GCTAGAGCTGGTATCATATCTGAAAACAACGCTGGTAAAGCATGTTTGATGGATACTGAC
CCTAAGGAGTAAGAAATGGGCATCACCATTAAGTCTACTGGAGTTTCCTTATACTATCAA
AATACTGTGACCAAGTAGGAGAGTATCATTAATTTGATTGATTCTCCTGGTCATATTGAC
TTTTCTGGTGAAGTCACTGCTGCTTTAAGAGTTACTGATGGAGCTCTTGTAGTAGTGGAT
GCTGTTGAAGGTGTTGCTGTTCAGACAGAAACAGTTCTAAGGCAGGCTTGCCAAGAGCGA
ATACGACCCGTTCTTGTAATTAATAAGCTAGACAGGCTTTTTAGTGAACTTAAGGATGAT
TATGAAAATATTTATCAAAGACTTGTTAAGATTATAGCAAAAGTTAATTCCATCTTAGAG
ATGCATGAAAACGATTCTATCAGAGGTTACACTTTAGATCCTTCACTAGGTAACGTTGCC
TTCTCTTCTGGTAAGTAGTGTTGGGGATTCACCTTAAAAACTTTTGCAAGAATTTACAGC
CAAAAATTCTCAACCAAGGAGGAAACCTTAATGGCTAAGTTATGGGGAGATAACTACTTT
AACTCTCAAACCAAATCATTCACCTCAGAAATAACCAAAATTAATAACTAAAACAAGAAA
GCTTTGCGCTCTTTCATTGAATTCGTTTTAGTTCCTTTAGATAAGTACTACTCTGCTTCT
TCAAGCGCAGATGTAGAAGTTCTATCTAAGATGGTTGAAAAGCTCAACCTCTCTACTATT
TTAACTACAGCTGAATTAGAAAGACTCAAACAAGTTGATGTTCAAGAGAGAATCAAAAGA
ACTATGAGAGCTTGGTTACCTTTAGCAGATGCTATACTTGAAATGGTCTAAGATCACCTT
CCTTCGCCTAAAGAAGCTATGAAGTATCGTAGTTTGTATCTCTACGAAGGGCCTGCAGAT
GATGAGGCTTGCACAGCCATGAGAGAATGTAATTCTGAGGGACCTCTTATGCTTTATGTT
TCAAAAATGGTCCCAACTGCAGATCTCAGCAGATTTTATGCTTTCGGTAGAGTATTCAGT
GGTACAATTTCTCAAGGAATGAAAGTTAGAGTTCAAGGCCCTGATTACAAGCCAGGAAGT
AAGGAAGGTCTCTTTATCAAAACTATCTAGAGAACCTTTTTGATGATGGGTAAATAACAC
GAACCTATCGAATCAGTACCAGCTGGAGGTACTGTCCTCATTTTAGGTGTTGATAATGCA
CTTACTAAGACAGGCACTCTTACAACTTCTGAAACAGCACATAATATCAGAAACATGAAA
TATACGATTTCACCTATATTGAGAGTTGCTGTTAATACTCCCAACTAGCAAGATCTTCCA
CGTCTTCTTGAAGGTCTTAAGATGCTTCAAAAGTATGACCCTCTTGTTTAAGTAGAAGTT
GATGAAAATACAGGTTCTTATGTTGTTGCTGGTGGTGGAGAGCTACACGTCCAAATTTGT
CTAGAAAAGCTCAATGATTTCACCCACAATTCTATCAATATCGTCGCTTCTCAGCCCACT
GTATCGTATAGAGAAACCATAGGTGATAAGAGTTCTTAAATGTGCCTTGCTAAGACTGCA
AATAAGTTGAATCGTTTATATGGTACTTGCGAACCTCTAGATGAAGAATTAGGATCAGCT
ATTGTAAGCAACAAAATAAATATACAGGAAATCAATAGTTAAGAAACAATCAACAGTTTG
GTGAATGATTACTCATGGGAAAGAGAAGATGCAAAGCGTATATGGTGCTTCGGTCCTCTA
GAAAAGGAATCAACTAATTGCATCGTAAACCAAACAGTTGGTATATAAGGTATGCCTGCC
ATTCAGCCTTCAATCATAACAGCTTTCGAATGGTGTACAAAGGAAGGTCTTTTATGTGAT
GAACCCCTAAGAAATATTCGTTTTAACATTATGGATGCAGTAATACATGTAGATCCAGCT
CACCATCGTAGCAATTAAATAACACCAGCTGCTAGAAGATTATTTAAGGCTTGCCAATAT
GTGAGTGAACCTAAAATTCTGGAGCCATTTTACTTATGCGACATTAGAATTCCAGACGAA
AGCAAAGGCCCTATATATGCAGTCTTAAACAAGAGAAGAGGTATAGTTGTTGGAGAAGAA
TATGAAGATACACTCTCTGTGATATAAGCCCACATCCCTGTATCTGAAAGCTTTGGACTA
GACTAAGCCCTGAAGTCAGCCACTCAAGGTAAGGCTATACCTGCTCTCTCATTCAGTCAC
TGGCAAGTAGTTTAAGGCAATCCACTTGACCCAGAATCAAAATCAGGTAAGATCGTCAAT
GAAATAAGAATTAGAAAAGGTTTGAATGCTAAAATACCAGAACTCAACAACTATCTTGAT
AAACTTTGA