Identifiers and Description

Gene Model Identifier

TTHERM_00859260

Standard Name

EF1BL1 (Elongation Factor 1 Beta Like 1)

Aliases

PreTt09088 | 152.m00108

Description

EF-1 guanine nucleotide exchange domain containing protein; involved in guanine nucleotide exchange to activate EF1A from its inactive (GDP) form to its active (GTP) form so that it can readily associate with an aminoacyl-tRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00736 ) EF-1 guanine nucleotide exchange domain
  • ( TIGR00489 ) translation elongation factor aEF-1 beta

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.5%

TetraMine Data

TTHERM_00859260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07206.12.0005752503420762e-105EF-1 guanine nucleotide exchan
ge domain-containing protein (
226 aa)
OxytrichaContig19220.0.g569.001422350855153e-28EF-1 guanine nucleotide exchan
ge domain
WormBaseWBGene000188463.0002687256732656e-20locus:eef-1B.1 Probable elon
gation factor 1-beta/1-delta 1
status:Confirmed UniProt:
P34460 protein_id:CCD63459.1
DictyBaseDDB_G02840350.000000000000001999258566166494efa1B on chromosome: 4 positio
n 1535647 to 1536451
SGDYAL003W0.0000000000000030004923591262316EFB1 Translation elongation fa
ctor 1 beta; stimulates nucleo
tide exchange to regenerate EF
-1 alpha-GTP for the next elon
gation cycle; part of the EF-1
complex, which facilitates bi
nding of aminoacyl-tRNA to the
ribosomal A site
Stentor CoeruleusSteCoe_136810.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000376

Sequences

>TTHERM_00859260(coding)
ATGAATAAAGAAATAGTATATTTATAATATGAGATGGATTGGTTGCTTGGTTGCTTGTTT
AATAGATTGATAGAAACTTAAAAAACTATAAATTTCTTTTTAAGTCAATTCCTTCTTTTT
TTCCATTCGATAAACAAATATCTTTTTTTTTTTGAGACAATCAAAAAAATATATATATTT
TTGTTTGTTTGCTTTTTTAGATTATTTTTAGATTTGCATTTGTACGTATTTTTAATATAC
ATTAAAAAATAAATTCTCTGGGAAAAGATATATAAAGTAAATTTAATAAATTATTATCAA
AAACTAAAAAACAAAAAGCAAAAAACAAACCAATTCTCTAAAATGACTTTCTCTGCTACC
GACCTCCCCACCCTCGAAAAGCACTTAGCTGCCCACACCTACCTTTCCGGTACTGATAAG
CCCGCTAAGATTGATGCTTAAATTGCCACCGAACTCAAGGATAAGAAGGTTGCCCTCAAC
GCCGCCACCCACCCCAACGTCTATGCCTGGTTCAGCTTCATCGGTTTATTCACCCCCGAA
GCTCAAAATACCTGGGCTGATGTTGCTCCCGTCGCCGTCCCCGTTGCTGCCAAGAAGGAA
GCCAAGAAGGAAACCAAGACCGACGATGTCGATCTTTTCGGTGATGATGATGAAGAAGAT
GCTGAAGCTGAAGCTTTGAGAGAAAAGAAGAGACTCGAAGCCGTCGCTGCCAAGGAAGCT
AGAGATGGTAAGAAGAAGAAGGCTATTGCCAAGACTATCCTCGTCTTCAACGTCAAGGTC
TTCGAAGCTGAATAAGACTTAGACGCTTTGGCCAAGAAGATCTACGAAACCATCCAACTC
GACGGTTTGGTCTGGAACAAGGAACACAAGAAGATCCCCGTTGCCTTCGGTGTCTTCATG
CTCCAAATGGGTTGCATCATTGAAGACGATAAGGTCAACACCGACAGTATCTTCGAACCC
ATCCAATCTTGGGAAGATGAAGTCCAATCCGTTGATGTTGAAACCATGCAAAAACTTTGA


>TTHERM_00859260(protein)
MNKEIVYLQYEMDWLLGCLFNRLIETQKTINFFLSQFLLFFHSINKYLFFFETIKKIYIF
LFVCFFRLFLDLHLYVFLIYIKKQILWEKIYKVNLINYYQKLKNKKQKTNQFSKMTFSAT
DLPTLEKHLAAHTYLSGTDKPAKIDAQIATELKDKKVALNAATHPNVYAWFSFIGLFTPE
AQNTWADVAPVAVPVAAKKEAKKETKTDDVDLFGDDDEEDAEAEALREKKRLEAVAAKEA
RDGKKKKAIAKTILVFNVKVFEAEQDLDALAKKIYETIQLDGLVWNKEHKKIPVAFGVFM
LQMGCIIEDDKVNTDSIFEPIQSWEDEVQSVDVETMQKL


>TTHERM_00859260(gene)
ATGAATAAAGAAATAGTATATTTATAATATGAGATGGATTGGTTGCTTGGTTGCTTGTTT
AATAGATTGATAGAAACTTAAAAAACTATAAATTTCTTTTTAAGTCAATTCCTTCTTTTT
TTCCATTCGATAAACAAATATCTTTTTTTTTTTGAGACAATCAAAAAAATATATATATTT
TTGTTTGTTTGCTTTTTTAGATTATTTTTAGATTTGCATTTGTACGTATTTTTAATATAC
ATTAAAAAATAAATTCTCTGGGAAAAGATATATAAAGTAAATTTAATAAATTATTATCAA
AAACTAAAAAACAAAAAGCAAAAAACAAACCAATTCTCTAAAATGACTTTCTCTGCTACC
GACCTCCCCACCCTCGAAAAGCACTTAGCTGCCCACACCTACCTTTCCGGTACTGATAAG
CCCGCTAAGATTGATGCTTAAATTGCCACCGAACTCAAGGGTAACTTATTTATTTACTAA
TCATTATCTCCCTCACATCCATCCATCCATTCACTTACTTACTCATTCACTCATTATTCG
GTGATCTCTTCCACTTAGACTTTTTTCTCTTAGAAAATTTTAAAATAATGGATTGAAGAA
AATAAACTTCTTTGAAATTTTTTAGTCAATATTGCTCTCTTAAAACACACTCAAGTTTTC
ATTAATAATTTATTAATATTATTTTAAATATATAGATAAGAAGGTTGCCCTCAACGCCGC
CACCCACCCCAACGTCTATGCCTGGTTCAGCTTCATCGGTTTATTCACCCCCGAAGCTCA
AAATACCTGGGCTGATGTTGCTCCCGTCGCCGTCCCCGTTGCTGCCAAGAAGGAAGCCAA
GAAGGAAACCAAGACCGTAAGAAATTTTTCTTTTATCAAGCAATAACAACAATGGAAATC
ATTTTAATTCTACCCATAACTCCTATAGCTTATTTACTTACTAACTTACAAAAGATAAAA
TGAATAAAAATAAATTTTCTTGATATATAAATAAATACCTATTCCCCCTTTGATATATAT
ATCGGAAAACATGCAAGCGACAAGCAAAGATAGGATTTTCATTGACCATAGAACCATTTT
TCTAAATTATTGTTGTATATAAATAGGACGATGTCGATCTTTTCGGTGATGATGATGAAG
AAGATGCTGAAGCTGAAGCTTTGAGAGAAAAGAAGAGACTCGAAGCCGTCGCTGCCAAGG
AAGCTAGAGATGGTAAGAAGAAGAAGGCTATTGCCAAGACTATCCTCGTCTTCAACGTCA
AGGTCTTCGAAGCTGAATAAGACTTAGACGCTTTGGCCAAGAAGATCTACGAAACCATCC
AACTCGACGGTTTGGTCTGGAACAAGGAACACAAGAAGATCCCCGTTGCCTTCGGTGTCT
TCATGCTCCAAATGGGTTGCATCATTGAAGACGATAAGGTCAACACCGACAGTATCTTCG
AACCCATCCAATCTTGGGAAGATGAAGTCCAATCCGTTGATGTTGAAACCATGCAAAAAC
TTTGA