Identifiers and Description

Gene Model Identifier

TTHERM_00938820

Standard Name

EEF2 (Eukaryotic translation Elongation Factor )

Aliases

PreTt03732 | 170.m00104

Description

Translation elongation factor 2; catalyzes ribosomal translocation during protein synthesis; mRNA is expressed during vegetative growth; high amino acid identity with EF-2 in other eukaryotes

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR01393 ) GTP-binding protein LepA
  • ( PF03144 ) Elongation factor Tu domain 2
  • ( PF00679 ) Elongation factor G C-terminus
  • ( PF03764 ) Elongation factor G, domain IV
  • ( TIGR01394 ) GTP-binding protein TypA/BipA
  • ( TIGR00503 ) peptide chain release factor 3
  • ( TIGR00484 ) translation elongation factor G
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00485 ) translation elongation factor Tu
  • ( TIGR00490 ) translation elongation factor aEF-2
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR00483 ) translation elongation factor EF-1, subunit
  • ( TIGR00475 ) selenocysteine-specific translation elongation factor

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00938820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_78520
WormBaseWBGene000011679.997093137033517e-262locus:eef-2 Elongation facto
r 2 status:Confirmed UniPr
ot:P29691 protein_id:CAB0298
5.1
Tetrahymena borealisEI9_19363.19.997093137033517e-262elongation factor G, domain IV
family protein (839 aa)
DictyBaseDDB_G02883739.997093137033517e-262efbA on chromosome: 5 position
1470619 to 1473138
OxytrichaContig22552.0.g519.997093137033517e-262Elongation factor Tu GTP bindi
ng domain
SGDYOR133W9.997093137033517e-262EFT1 Elongation factor 2 (EF-2
), also encoded by EFT2; catal
yzes ribosomal translocation d
uring protein synthesis; conta
ins diphthamide, the unique po
sttranslationally modified his
tidine residue specifically AD
P-ribosylated by diphtheria to
xin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00938820(coding)
ATGGTTAACTTCACTGTTGAATAAATTAGATAGATTATGGATAACTAAGACAATATCCGT
AATATGTCAGTTATTGCTCACGTCGATCACGGTAAATCCACCCTTACCGATTCCTTGATT
TGCAAGGCCGGTATTATTTCTTCTAAGGCTGCTGGTGAAGCTAGATACACCGATACCAGA
GATGATGAAAAGGAAAGAGGTATTACCATTAAGTCCACTGGTGTCTCTATGTATTACGAA
TATGATTTGAACGAAACTGGTAAGTAAGAACCTTACTTGTTGAACTTGATCGATTCTCCG
GGACACGTCGATTTCTCCTCTGAAGTTACTGCTGCTTTGAGAGTTACTGATGGTGCTTTG
GTCGTCGTCGATTGCGTTGAAGGTGTTTGCGTCCAAACCGAAACCGTCTTAAGACAAGCC
ATGCAAGAAAAGATTAAGCCCGTCCTTATCGTTAACAAGATTGATAGATCTATCTTGGAA
TTAAAGCACGATGGTGAAACCATGTATCAAAATTTCATTAGAGTTATTGATATGGTCAAC
GTTATCATCGATACTTACAACCAAGAAGATATGGGTCCCCTCCTCGTTCAACCCGATGAA
GGTTCCGTCGCTTTCGGTTCTGGTAAGGAATGTTGGGCTTTCACTTTGACCAAGTTCTCC
AGAATCTATGCCAAGAAGTTCGGTATTGATAAAAATAAAATGATGAAGAAGTTGTGGGGT
GACAATTTCTTCGATGCTGCTTCCAAGAAGTGGACCAACAACAACGTTAGTGACAATGGT
ACTCCCTTGAAGAGAGCTTTCGCTTAATTCATTATGGATCCCATTTGCAAGCTTGCTAAC
GCCGTTATGGATAACGATATGGAATTGATGGACAAGATGCTCAAGACTCTCGAACTCACT
CTTACTCAAGAAGACAGAGACCTCAAGGGTAAGCACCTCCTCAAGGCTGTCATGTCTAAG
TGGTTGAACGCTGCTGATACTATCTTAGAAATGATGGTTATCCATTTACCCTCCCCCAGA
AAAGCTTAATAATACAGAACTTCTTATCTTTACGAAGGTCCCCAAGATGATGATATCGCC
AAGGCCATGAAGGCTTGCGATCCCAAGGGTCCTCTTATGATGTACGTCTCTAAGATGGTT
CCCACCGCTGATAAGGGTAGATTCGTCGCTTTCGGTAGAGTTTTCTCTGGTACTATTGCT
ACCTCCCAAAAGGTTAGAATCCTTGGTCCCAACTATCAACCTGGTAAGAAGGAAGATCTC
CACGAAAAGACCCTCCAAAGAACTCTTATTATGTAAGGTAGAACTACCGAATACATTCCC
GATGTTCCTTGCGGTAACACCGTCGGTTTGGTTGGTGTCGATCAATTCATCTTGAAGACC
GGTACCATTACTGATCACCCCGATGCTCACACCATCAGATCCATGAAATACTCCGTCTCT
CCTGTCGTCAGAGTTGCCGTTAATGTTAAAAACGCTGGTGATCTTCCCAAGCTCGTCGAT
GGTTTGAAGAAGCTCTCCAAGTCTGATCCTTTAGTCATCTGTACCACTGAAGAATCTACT
GGTCAACACATTATTGCTGGTTGCGGTGAATTGCACATTGAAATTTGCTTAAAGGATCTT
GAAGAAGATTACGCTAACTGCCCCATCATTAAATCCGACCCCGTCGTCACCTATAAGGAA
ACTGTTACTGCTGAATCTAACATTACTTGTATGTCCAAGTCTGCTAACAAGCACAACAGA
ATCTACGCTAAGGGTGCTCCTCTTGAAGATGGTCTCGCTGAAGACATCGAAAAGGGTACC
ATTAACCCCAAGGACGATCCTAAGGACAGAGCTAAACTCTTAAACGAAAAATACAATTGG
GACAGAACTGAAGCCGGTACTAAGCTCTGGTCTTTCGGTCCTGAAAACGTTGGTCCTAAC
TTGGTTGTTGATCAAACTAAGGGTATCCAATACGTCAACGAAATTAAGGACTCCGTTGAA
TCTGCCTGGTAATGGGCCTCCAAGGAAGCTGTCATGACTGAAGAAGGTATGAGAGGTGTC
AGAATGAACCTCCTCGATTGCGTTCTCCACGCTGATGCTATCCACAGAGGTGCTGGTCAA
ATTCTCCCCACCGCTAGAAGACTCTTCTACGCTTGTGAACTTACTGCTGAACCCAGACTC
CAAGAACCCATCTTCACTGCTGAAATTACTGCTCCTCAAGATGCTATGGGTGGTGTTTAC
AACTGTCTCAACTAGAGAAGAGGTATCATCAACGAAGAAGAATAAGTTTAGGGTACTCCT
ATGGCTATTGTCAAGGCTTACTTACCTGTCGCTGAATCCTTCGGTTTCACCGCTCACTTA
AGAGGTCTTACTCAAGGTCAAGCTTTCCCTCAATGTTTCTTCGATCATTGGGCCACCATT
AGTGGTTCTCCCTTCGAAGCTAACTCCAAGGCTGCTGACATCGTTAATAACATCAGAAAG
AGAAAGGGTCTTAAGGAAGGTATCCCTGATCTTAACAACTACTTGGATAAGCTATGA


>TTHERM_00938820(protein)
MVNFTVEQIRQIMDNQDNIRNMSVIAHVDHGKSTLTDSLICKAGIISSKAAGEARYTDTR
DDEKERGITIKSTGVSMYYEYDLNETGKQEPYLLNLIDSPGHVDFSSEVTAALRVTDGAL
VVVDCVEGVCVQTETVLRQAMQEKIKPVLIVNKIDRSILELKHDGETMYQNFIRVIDMVN
VIIDTYNQEDMGPLLVQPDEGSVAFGSGKECWAFTLTKFSRIYAKKFGIDKNKMMKKLWG
DNFFDAASKKWTNNNVSDNGTPLKRAFAQFIMDPICKLANAVMDNDMELMDKMLKTLELT
LTQEDRDLKGKHLLKAVMSKWLNAADTILEMMVIHLPSPRKAQQYRTSYLYEGPQDDDIA
KAMKACDPKGPLMMYVSKMVPTADKGRFVAFGRVFSGTIATSQKVRILGPNYQPGKKEDL
HEKTLQRTLIMQGRTTEYIPDVPCGNTVGLVGVDQFILKTGTITDHPDAHTIRSMKYSVS
PVVRVAVNVKNAGDLPKLVDGLKKLSKSDPLVICTTEESTGQHIIAGCGELHIEICLKDL
EEDYANCPIIKSDPVVTYKETVTAESNITCMSKSANKHNRIYAKGAPLEDGLAEDIEKGT
INPKDDPKDRAKLLNEKYNWDRTEAGTKLWSFGPENVGPNLVVDQTKGIQYVNEIKDSVE
SAWQWASKEAVMTEEGMRGVRMNLLDCVLHADAIHRGAGQILPTARRLFYACELTAEPRL
QEPIFTAEITAPQDAMGGVYNCLNQRRGIINEEEQVQGTPMAIVKAYLPVAESFGFTAHL
RGLTQGQAFPQCFFDHWATISGSPFEANSKAADIVNNIRKRKGLKEGIPDLNNYLDKL


>TTHERM_00938820(gene)
ATGGTTAACTTCACTGTTGAATAAATTAGATAGATTATGGATAACTAAGACAATATCCGT
AATATGTCAGTTATTGCTCACGTCGATCACGGTAAATCCACCCTTACCGATTCCTTGATT
TGCAAGGCCGGTATTATTTCTTCTAAGGCTGCTGGTGAAGCTAGATACACCGATACCAGA
GATGATGAAAAGGAAAGAGGTATTACCATTAAGTCCACTGGTGTCTCTATGTATTACGAA
TATGATTTGAACGAAACTGGTAAGTAAGAACCTTACTTGTTGAACTTGATCGATTCTCCG
GGACACGTCGATTTCTCCTCTGAAGTTACTGCTGCTTTGAGAGTTACTGATGGTGCTTTG
GTCGTCGTCGATTGCGTTGAAGGTGTTTGCGTCCAAACCGAAACCGTCTTAAGACAAGCC
ATGCAAGAAAAGATTAAGCCCGTCCTTATCGTTAACAAGATTGATAGATCTATCTTGGAA
TTAAAGCACGATGGTGAAACCATGTATCAAAATTTCATTAGAGTTATTGATATGGTCAAC
GTTATCATCGATACTTACAACCAAGAAGATATGGGTCCCCTCCTCGTTCAACCCGATGAA
GGTTCCGTCGCTTTCGGTTCTGGTAAGGAATGTTGGGCTTTCACTTTGACCAAGTTCTCC
AGAATCTATGCCAAGAAGTTCGGTATTGATAAAAATAAAATGATGAAGAAGTTGTGGGGT
GACAATTTCTTCGATGCTGCTTCCAAGAAGTGGACCAACAACAACGTTAGTGACAATGGT
ACTCCCTTGAAGAGAGCTTTCGCTTAATTCATTATGGATCCCATTTGCAAGCTTGCTAAC
GCCGTTATGGATAACGATATGGAATTGATGGACAAGATGCTCAAGACTCTCGAACTCACT
CTTACTCAAGAAGACAGAGACCTCAAGGGTAAGCACCTCCTCAAGGCTGTCATGTCTAAG
TGGTTGAACGCTGCTGATACTATCTTAGAAATGATGGTTATCCATTTACCCTCCCCCAGA
AAAGCTTAATAATACAGAACTTCTTATCTTTACGAAGGTCCCCAAGATGATGATATCGCC
AAGGCCATGAAGGCTTGCGATCCCAAGGGTCCTCTTATGATGTACGTCTCTAAGATGGTT
CCCACCGCTGATAAGGGTAGATTCGTCGCTTTCGGTAGAGTTTTCTCTGGTACTATTGCT
ACCTCCCAAAAGGTTAGAATCCTTGGTCCCAACTATCAACCTGGTAAGAAGGAAGATCTC
CACGAAAAGACCCTCCAAAGAACTCTTATTATGTAAGGTAGAACTACCGAATACATTCCC
GATGTTCCTTGCGGTAACACCGTCGGTTTGGTTGGTGTCGATCAATTCATCTTGAAGACC
GGTACCATTACTGATCACCCCGATGCTCACACCATCAGATCCATGAAATACTCCGTCTCT
CCTGTCGTCAGAGTTGCCGTTAATGTTAAAAACGCTGGTGATCTTCCCAAGCTCGTCGAT
GGTTTGAAGAAGCTCTCCAAGTCTGATCCTTTAGTCATCTGTACCACTGAAGAATCTACT
GGTCAACACATTATTGCTGGTTGCGGTGAATTGCACATTGAAATTTGCTTAAAGGATCTT
GAAGAAGATTACGCTAACTGCCCCATCATTAAATCCGACCCCGTCGTCACCTATAAGGAA
ACTGTTACTGCTGAATCTAACATTACTTGTATGTCCAAGTCTGCTAACAAGCACAACAGA
ATCTACGCTAAGGGTGCTCCTCTTGAAGATGGTCTCGCTGAAGACATCGAAAAGGGTACC
ATTAACCCCAAGGACGATCCTAAGGACAGAGCTAAACTCTTAAACGAAAAATACAATTGG
GACAGAACTGAAGCCGGTACTAAGCTCTGGTCTTTCGGTCCTGAAAACGTTGGTCCTAAC
TTGGTTGTTGATCAAACTAAGGGTATCCAATACGTCAACGAAATTAAGGACTCCGTTGAA
TCTGCCTGGTAATGGGCCTCCAAGGAAGCTGTCATGACTGAAGAAGGTATGAGAGGTGTC
AGAATGAACCTCCTCGATTGCGTTCTCCACGCTGATGCTATCCACAGAGGTGCTGGTCAA
ATTCTCCCCACCGCTAGAAGACTCTTCTACGCTTGTGAACTTACTGCTGAACCCAGACTC
CAAGAACCCATCTTCACTGCTGAAATTACTGCTCCTCAAGATGCTATGGGTGGTGTTTAC
AACTGTCTCAACTAGAGAAGAGGTATCATCAACGAAGAAGAATAAGTTTAGGGTACTCCT
ATGGCTATTGTAACAATTTATTTCCCTTTTCTATCAAAATTTTAAAAATTCAATTTACTC
TCAATAAACAATTTATTTAAATATATTTTTTAATTCTATAGGTCAAGGCTTACTTACCTG
TCGCTGAATCCTTCGGTTTCACCGCTCACTTAAGAGGTCTTACTCAAGGTCAAGCTTTCC
CTCAATGTTTCTTCGATCATTGGGCCACCATTAGTGGTTCTCCCTTCGAAGCTAACTCCA
AGGCTGCTGACATCGTTAATAACATCAGAAAGAGAAAGGGTCTTAAGGAAGGTATCCCTG
ATCTTAACAACTACTTGGATAAGCTATGA