Identifiers and Description

Gene Model Identifier

TTHERM_01076950

Standard Name

E2FL4 (E2F Like)

Aliases

PreTt08234 | 220.m00036

Description

transcription factor E2F/dimerisation partner (TDP)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01978 ) Sugar-specific transcriptional regulator TrmB
  • ( PF02319 ) Transcription factor E2F/dimerisation partner (TDP)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01076950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10506.11.999745369828301e-106hypothetical protein (1095 aa)
OxytrichaContig14878.0.g727.000924640675686e-24E2F/DP family winged-helix DNA
-binding domain
WormBaseWBGene000098990.000000005997038937208364locus:efl-3 status:Confirmed
UniProt:Q20619 protein_id
:CAA91391.2
DictyBaseDDB_G02841290.00000030014504373857585e2f on chromosome: 4 position
1622284 to 1624946

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27892792: Zhang J, Tian M, Yan GX, Shodhan A, Miao W (2017) E2fl1 is a meiosis-specific transcription factor in the protist Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 16(1):123-135

Sequences

>TTHERM_01076950(coding)
ATGGACTCTGCTGAATAGCTTAGCTAAGAAGCAAATGATAATGAAAACTGCCAAAGTAGC
AGCTCGAATTTAAATGCTACTCATAACGACATATTAGGTAAAATCAAGACAAAAAGAAAG
TAGATTTTTAAGTTAATGAAACGCCAGAATACAAAAAAAAAATGCTCAAGTTACTCAGGC
CCAACTCACAATAGAAAAGGCTAAAATGAAGGCCACTAAATTGATATCCGTTAACATTCA
AACTCAATATTGAACTTGCCTTAAAATTTAAGCTTGGAGTAAAAGGATTCATCAATAAAT
AACAATCCATCTTAAAATAACTTGGAAGATGACGAATTATTCTCTTTAAACGGCTCCTTC
TGCTAGTCACCGCCTTTTTAGCACATAAAAGATTTCGCTGATAATATTCAAATAACAGAA
AAGCTCTCAGATATGAAAATATCCAGTCATACTCCTCCACTAAATCCTCAGAGATTATAT
AATTTAAATATGAATCCCTTGAATTTTAATGAAGATGATGACTAAAATTCAAATGAAGAT
AGCAAATATAGAGAAGAAAATTATATTTTGCCACAAAAGAAAATAAAAACTTAAAATAAC
AGAAATTATGAATAAAAAAGATAAGCACAAACTAATAATTTGAGAAATGCTTACAAATTA
AAATAAAGTGAATCGGAAAATTAAGAAGACCTTCATAATATAGGATTTGATCAAGAGCTT
TCGCACTCTGTATTTGACACTGAGTCTATATAAAATAATAATATAGACAATAAAACATAA
AATTAAGAAATAGATGCTGATGATAATGAAATTAATTTATCTCCTGCAGCAAATGCAGAA
GGTTGCAGCAATGCGTAAAGTATTATGAATTCACATGAAAAAAAATAAATGCAACAATAA
TCATAGTAATATAGTAGAAGAGAAAAAAGTTTAGAAGAATTATCCAAAAAATTCTTAACT
ATATTTTTATAGAAAGAGTAAATGCTGATAAGTCTTGATAAAATCACTTAGTAGCTAGAT
GTTGAAAGGAGAAGAATATATGATATTATAAACATCCTTGAGAGTCTTAAGCTCGTTACA
AGGAGAGGTAAAAATAACTACAAATGGAATGGGTTTGAGCAGATCTTTGACACAATACAA
TTTTTTAGCACTCAAAGTGACAAACAAGAAGTTAATTTAGTTGCAGCAGAGCAAAATGAG
AAGAAAGAAAAATCGTTAGAAATACTTTCGATTGGATTTTTGAAGTTATTTTTAAATTTC
AAGTAAACTCTTTCTTTAGAGGAGGCAGCAAGAAAACTATCTCCAAATAACAGTGAGAAC
TAAAAGATAAAAACAAAAATAAGAAGATTGTATGATATTGCTAATGTATTTAAATCTTTG
GGACTTATTAAGAAAGTCTAATTAAATGAAACTAAGAAGCCTGCTTTTTAGTGGATTGGG
ATTACAGGGCTGCAAGATTTTTACAACTCTTCGAAAGATAAAGAAGGCCTTGGAAGCTAT
TAAGAGCTAGATGAAACAAATAAGAGCTAAAAAATAAATAAAAAAGAATAATAAATTTAA
TAAAGAACTCTTTCTAACTCTTTAGTTAATTTATAAAATTAAAATGATTAAAATATATAA
GATACCACGAAAACAGACTTTATGAATTGCAAGGACTTCAATTAATTCTTTTAGTCCATA
GAAAATAATAATAACTCTTTATAATAAAATTTAATTGCTCCCTTTTAATAAGAAAAAGTT
ATAGCAGCTGAAGATCCTGATAAAGATGATGATTTTTCTGCTTCAAAAAATACTTGCTTT
TTCTCAAATTCAAAAAATAGTGCTTTTAAAAGGGTCAGCAAAAGCTTATCTTAAACGACA
TAATAAAATGCTTAAATTAATCCAAACAATAGATTAATTTGCTTGGAAAATTTAGTTAGA
AATTCAATTTTCTAAAATAATTAACTAACCAATTCCCTTAATATAAGTTAAAAACTTACT
TAGCTGTTTGAGCAAAAAGGAAGGCCAAACATATTTTCAAATATAGTCAACGATCAAAAT
ATACTAAATAACTAGAATAATACCACTGAAAATTAATAAAGAAAGTAGTCAATACAAAGC
GAAAATAAAAAAGAATACAGCTATTCCTGGTACTGA


>TTHERM_01076950(protein)
MDSAEQLSQEANDNENCQSSSSNLNATHNDILGKIKTKRKQIFKLMKRQNTKKKCSSYSG
PTHNRKGQNEGHQIDIRQHSNSILNLPQNLSLEQKDSSINNNPSQNNLEDDELFSLNGSF
CQSPPFQHIKDFADNIQITEKLSDMKISSHTPPLNPQRLYNLNMNPLNFNEDDDQNSNED
SKYREENYILPQKKIKTQNNRNYEQKRQAQTNNLRNAYKLKQSESENQEDLHNIGFDQEL
SHSVFDTESIQNNNIDNKTQNQEIDADDNEINLSPAANAEGCSNAQSIMNSHEKKQMQQQ
SQQYSRREKSLEELSKKFLTIFLQKEQMLISLDKITQQLDVERRRIYDIINILESLKLVT
RRGKNNYKWNGFEQIFDTIQFFSTQSDKQEVNLVAAEQNEKKEKSLEILSIGFLKLFLNF
KQTLSLEEAARKLSPNNSENQKIKTKIRRLYDIANVFKSLGLIKKVQLNETKKPAFQWIG
ITGLQDFYNSSKDKEGLGSYQELDETNKSQKINKKEQQIQQRTLSNSLVNLQNQNDQNIQ
DTTKTDFMNCKDFNQFFQSIENNNNSLQQNLIAPFQQEKVIAAEDPDKDDDFSASKNTCF
FSNSKNSAFKRVSKSLSQTTQQNAQINPNNRLICLENLVRNSIFQNNQLTNSLNISQKLT
QLFEQKGRPNIFSNIVNDQNILNNQNNTTENQQRKQSIQSENKKEYSYSWY


>TTHERM_01076950(gene)
ATGGACTCTGCTGAATAGCTTAGCTAAGAAGCAAATGATAATGAAAACTGCCAAAGTAGC
AGCTCGAATTTAAATGCTACTCATAACGACATATTAGGTAAAATCAAGACAAAAAGAAAG
TAGATTTTTAAGTTAATGAAACGCCAGAATACAAAGTAAGTAGCATTCAACATTAAATTT
AACTTCATTTAGTTAGCATTTTTTTCTAAAATTTTTATGATGGAAAAGCTTGCTTTAATT
TTGATAACTACATAAAAAATCCATTTATAAGCTAATTGAAACTTTGTTAAATTCCACAAA
ATCCTCAGTTTAAAGTGTTTATCATTATCACACTTTAGCTATGCAGCTTATTTTTAACCA
TGTATGCCTAAATATCAATTAGTACTTACTATTCGTTTTATTAATTGCTTCTATCTCCTC
AAAAAGAAATATACAAAATAAAGAAATATTAAATGCAATAATGAATTTGTTTAATCTTAT
TAATTAAATAATTAATTAACAAATAAATTAATTAATTAATAAATAAATAATATGCATTTT
TCATCAAATATTTGAATATCAGTCCCATAGTTTATAGATTGTTTGTTTGCTTAATAATCA
TTCATTCAATTATAATTAATATTAATAAACCCCTTTTTTTTTTGATAAAGCAGACTAATT
TAAAATTTTTTATAATGACAATCAATAATTCATTCATTCATTCGTAGGCTATTGCACCTA
TCCATTCATAGATTATTGATTTCCTTTCAAATTATTTTTGATTATTTCTTAATCAGCTGA
CTTTTTTATTTCTTACCAAAAATTGCGGAATTAGATCCACTTCTTCCTATTCATTCATTT
ATTTATTTTTGATTTTATTTATACTTTAAATCTATTAGATCACATTTATCATAACTTAAT
TTTGAAAGCATATCCATAATATTTTTAGATGAATATTAAATAAATGCTAATTAATCTTTT
AGCTTCTCTATATTTTTGCATTTTACATTAATCATTTAAAAATTAGAAATTAATTTCATA
TTTTCTACACCAATTTAAATTTTATCTTTGTATTTTCTTTTTTTCATTCTTTTAAATATT
TAATATATTAAAGTAGAAAAAAATGCTCAAGTTACTCAGGCCCAACTCACAATAGAAAAG
GCTAAAATGAAGGCCACTAAATTGATATCCGTTAACATTCAAACTCAATATTGAACTTGC
CTTAAAATTTAAGCTTGGAGTAAAAGGATTCATCAATAAATAACAATCCATCTTAAAATA
ACTTGGAAGATGACGAATTATTCTCTTTAAACGGCTCCTTCTGCTAGTCACCGCCTTTTT
AGCACATAAAAGATTTCGCTGATAATATTCAAATAACAGAAAAGCTCTCAGATATGAAAA
TATCCAGTCATACTCCTCCACTAAATCCTCAGAGATTATATAATTTAAATATGAATCCCT
TGAATTTTAATGAAGATGATGACTAAAATTCAAATGAAGATAGCAAATATAGAGAAGAAA
ATTATATTTTGCCACAAAAGAAAATAAAAACTTAAAATAACAGAAATTATGAATAAAAAA
GATAAGCACAAACTAATAATTTGAGAAATGCTTACAAATTAAAATAAAGTGAATCGGAAA
ATTAAGAAGACCTTCATAATATAGGATTTGATCAAGAGCTTTCGCACTCTGTATTTGACA
CTGAGTCTATATAAAATAATAATATAGACAATAAAACATAAAATTAAGAAATAGATGCTG
ATGATAATGAAATTAATTTATCTCCTGCAGCAAATGCAGAAGGTTGCAGCAATGCGTAAA
GTATTATGAATTCACATGAAAAAAAATAAATGCAACAATAATCATAGTAATATAGTAGAA
GAGAAAAAAGTTTAGAAGAATTATCCAAAAAATTCTTAACTATATTTTTATAGAAAGAGT
AAATGCTGATAAGTCTTGATAAAATCACTTAGTAGCTAGGTAAATAAACACTTAAAAACT
AAATAATAATTAATTTTTTTAAAGATGTTGAAAGGAGAAGAATATATGATATTATAAACA
TCCTTGAGAGTCTTAAGCTCGTTACAAGGAGAGGTAAAAATAACTACAAATGGAATGGGT
TTGAGCAGATCTTTGACACAATACAATTTGTAAAAAGTTTTTTAGAATTTGAATATTTTA
TATTTTAATTTAACTTAAAAAACAAACAATTGTTTTCTATTAAATAAGAAATAAAACAAA
CAACATTTAAAATGCTAATTTCATTAAAAAAAAAGACATTAAAATTTATAAATTAAATAA
ATAAAAAATACAGTTTAGCACTCAAAGTGACAAACAAGAAGTTAATTTAGTTGCAGCAGA
GCAAAATGAGAAGAAAGAAAAATCGTTAGAAATACTTTCGATTGGATTTTTGAAGTTATT
TTTAAATTTCAAGTAAACTCTTTCTTTAGAGGAGGCAGCAAGAAAACTATCTCCAAATAA
CAGTGAGAACTAAAAGATAAAAACAAAAGTAAATTATTTAGTAAGAATTAATTATTTAAA
TTCAATTCATTTTTAAATAACATAGATAAGAAGATTGTATGATATTGCTAATGTATTTAA
ATCTTTGGGACTTATTAAGAAAGTCTAATTAAATGAAACTAAGAAGCCTGCTTTTTAGTG
GATTGGGATTACAGGGCTGCAAGATTTTTACAACTCTTCGAAAGATAAAGAAGGCCTTGG
AAGCTATTAAGAGCTAGATGAAACAAATAAGAGCTAAAAAATAAATAAAAAAGAATAATA
AATTTAATAAAGAACTCTTTCTAACTCTTTAGTTAATTTATAAAATTAAAATGATTAAAA
TATATAAGATACCACGAAAACAGACTTTATGAATTGCAAGGACTTCAATTAATTCTTTTA
GTCCATAGAAAATAATAATAACTCTTTATAATAAAATTTAATTGCTCCCTTTTAATAAGA
AAAAGTTATAGCAGCTGAAGATCCTGATAAAGATGATGATTTTTCTGCTTCAAAAAATAC
TTGCTTTTTCTCAAATTCAAAAAATAGTGCTTTTAAAAGGGTCAGCAAAAGCTTATCTTA
AACGACATAATAAAATGCTTAAATTAATCCAAACAATAGATTAATTTGCTTGGAAAATTT
AGTTAGAAATTCAATTTTCTAAAATAATTAACTAACCAATTCCCTTAATATAAGTTAAAA
ACTTACTTAGCTGTTTGAGCAAAAAGGAAGGCCAAACATATTTTCAAATATAGTCAACGA
TCAAAATATACTAAATAACTAGAATAATACCACTGAAAATTAATAAAGAAAGTAGTCAAT
ACAAAGCGAAAATAAAAAAGAATACAGCTATTCCTGGTACTGA