Identifiers and Description

Gene Model Identifier

TTHERM_00721610

Standard Name

E2FL3 (E2F Like)

Aliases

PreTt18469 | 115.m00125 | E2F7

Description

transcription factor E2F/dimerisation partner (TDP)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03685 ) Uncharacterised protein family (UPF0147)
  • ( PF01978 ) Sugar-specific transcriptional regulator TrmB
  • ( PF02319 ) Transcription factor E2F/dimerisation partner (TDP)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00721610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17454.19.997093137033517e-262transcription factor Dp-1 (898
aa)
OxytrichaContig14878.0.g724.9988726541653934e-26E2F/DP family winged-helix DNA
-binding domain
WormBaseWBGene000098990.00000009004106436083642locus:efl-3 status:Confirmed
UniProt:Q20619 protein_id
:CAA91391.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27892792: Zhang J, Tian M, Yan GX, Shodhan A, Miao W (2017) E2fl1 is a meiosis-specific transcription factor in the protist Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 16(1):123-135

Sequences

>TTHERM_00721610(coding)
ATGTCCTTATATCAAAAAAATTCTGATTCCTTCGCTGTTTCCTCTGAACAAGATTCTCTC
GACAATATAGTAGTTGAAGATGACTACAATTAGCAAGACGATATTGATTCTTTCAAAAGT
TTCTCAAGTTTTGACGTAGAATCAGAAGAACAAGGTGATGAAGAAGCCTAAGTCTAAGAA
GGAGAAGAAGAAGAAAACGAAAATTACCCAGAGTCTAACTAACACATTCAAGATAAAGAT
TCTATGGTTGATGATGAGACTAATTCGGAAGAAGAGCAACAATAAACATAAGAAATGCTT
AAAAGAACTGATTAGATAATCTTGAATAAAATTAACTTAAAGAAAAGAAACATTTTCTAA
TTTGTGCACAGAAATTAAGTCAGCATGATCTAAGATAAATAAAATGGCTACATGTCCAAA
AAGAAAAACTAGATAGGTTCTAATAAATTAGCTCAAAATGGATAGTAAGGATAGGGTACT
CAAATATTAAAGAGAGAAATATTGAATTACAGTCGCAGAGAAAAGAGCTTAGAAGAATTA
TCAAAGAAATTCTTATCTCTCTTCTTAGACAAGGAAGAATCTATGTTGAGCTTGGATAAA
ATTACTAACTAATTAGGAGTTGAAAGAAGAAGAATTTATGACATTATCAACATTCTTGAA
AGCTTAAAGCTAGTCTCCCGCAAAGGAAAGAACAACTATAAATGGAATGGCTTCCAAAAA
ATTTATGAAACTATAACTCAATTCGACCAAAAATCCTTAACAAAGAAAGAAGAGCAAGAA
CTAACTCAAGAACCATAGAAAAGAGAGAAGTCTCTTGAAATGCTTTCTATTGGCTTTCTT
AAACTCTTCCTCCACTGGAAGAGCACCATGACTCTAGAAGAAGCAGCAAGAAAGCTTTCA
TCTAAGCAAATAGACGATCATAAAATTAAAACAAAAATTAGAAGACTCTATGATATTGCC
AACGTATTTAAGAGCTTAGGGTTAATCAAAAAGACTTCCCTTATAGAAACAAAGAAACCT
GCATTTGAATGGATAGGAATTGTAGGTCTCGATTCCTTTGCCTACAAAATTATGAGAGAA
AAGAAAAGTGGTGATGAAGAATAAAACTGTGAAGAAGATAGCTTAAATCAATCTCAATAA
ATGAGCTAATAAAATAGCTTTACAGAGCCTAAGTTAAGCAAAAAGAGATTCTCAAATGAT
AAAAATAGCAGCAAGATTGATTCATCAACAGGCTAGTAAAAGTAGTAACTTAAAAAATCT
TTTATTATTTAACAACAACTCAAAGAATAAAGAGAAAAAGAAAGATTGCTACTTGAATAA
AACTAAAAATAGTAACAAATATAATAAAGTAGCTTAAATAATAATATAAATAATTCAAAT
ATTACATAAAACTTGAGTTAATTATTGCAAACAATTCAAAAAAATATGAAAAGCCAAAAC
TAGGAAGCTCCTTAGTAAAATAATAACTCTTCCAACACTCCTTTATCATTGTTATCTTAA
TTATAAATTTTATCACGCCCAATCTAGTAGAATTTAGTTAGTAATCTCAGCAGCTTGATT
AATAACATCAATAATAATAACAATTAAAATAATTTAATTTAACAAGAAGAATAATAGTAA
AGTAGCAATAATAATTTAATTGGAAATCTTATGTTAAAATGCCTATAAAATGTTATTACT
AATTTTGTTAGTAAGAATACAAATAACACATAAAATAAATAGCAAGAAGAAAATTAGACT
AACTTATAATAAACTTTATTAGAATCACCAGAAAAGGTTCTAAAAATAAATAATTAAATT
AATTAAAATAACTCTTTGAGTTAAATGTCATCTAACACAAAAATGAACAACAATAGTAAT
TATAAATGTCTCTAATCTTCTTAAAAAAGTACAAGCAATTTAGGTGACTTTACTACAGCT
AAAAAATAGAAGCAAATAATTAATGATGAAAACATCCCTCTTTCTGGCGAAAAAGGCTTA
CATTAAGGCTTTAGCTCATAGAACACTAGTAGCTTAAAGACACCTATATTAAAACGCACA
TTGACAATAATCTAACCTAAGCTAGATGAGTGTGATGACATTACACCAACTCCACCCACT
TGCAAAAGAAGTTTTTCTGCTTGCTTATCTTCTTCAAATAACAATAATATTAACAATAAT
ACTTAAACCTTATTTTAAAATTTAATTTAATAAAATTAAAACCAAGTCTATCCTAATCCA
TTCAGCGATAGAACTAATTTGAATAACAACAAACAATAAATTTTCAATAATTTACTCGGA
TTTCAATAATAATAATAACAACAATAATAACAAGTATCTTCTTCTTCATTTAAAAAAATA
AGAAAACTGACATATGAGAACAATTCCTTATAGGGATCAGACAATAAATAAAACGATATG
GACTCTAAAAATATAAAGAAATCAATTTCATGTGAAAATTAAATAAATTTTAATACTTTA
ATTTAAACTTCATAATAATTACTTAAAAATTCAAATCTTTAATAAAATCTGAACAATCTT
CAATAAGTTTAAAACAATGATGTCAACTAAAACAATTAATTATTTAATCAATTAAAAGAA
TTAAAAATTAACTAGATTAATAATATATAAAACATAAGAGTTCTTGAGCATTACTTCTGA


>TTHERM_00721610(protein)
MSLYQKNSDSFAVSSEQDSLDNIVVEDDYNQQDDIDSFKSFSSFDVESEEQGDEEAQVQE
GEEEENENYPESNQHIQDKDSMVDDETNSEEEQQQTQEMLKRTDQIILNKINLKKRNIFQ
FVHRNQVSMIQDKQNGYMSKKKNQIGSNKLAQNGQQGQGTQILKREILNYSRREKSLEEL
SKKFLSLFLDKEESMLSLDKITNQLGVERRRIYDIINILESLKLVSRKGKNNYKWNGFQK
IYETITQFDQKSLTKKEEQELTQEPQKREKSLEMLSIGFLKLFLHWKSTMTLEEAARKLS
SKQIDDHKIKTKIRRLYDIANVFKSLGLIKKTSLIETKKPAFEWIGIVGLDSFAYKIMRE
KKSGDEEQNCEEDSLNQSQQMSQQNSFTEPKLSKKRFSNDKNSSKIDSSTGQQKQQLKKS
FIIQQQLKEQREKERLLLEQNQKQQQIQQSSLNNNINNSNITQNLSQLLQTIQKNMKSQN
QEAPQQNNNSSNTPLSLLSQLQILSRPIQQNLVSNLSSLINNINNNNNQNNLIQQEEQQQ
SSNNNLIGNLMLKCLQNVITNFVSKNTNNTQNKQQEENQTNLQQTLLESPEKVLKINNQI
NQNNSLSQMSSNTKMNNNSNYKCLQSSQKSTSNLGDFTTAKKQKQIINDENIPLSGEKGL
HQGFSSQNTSSLKTPILKRTLTIIQPKLDECDDITPTPPTCKRSFSACLSSSNNNNINNN
TQTLFQNLIQQNQNQVYPNPFSDRTNLNNNKQQIFNNLLGFQQQQQQQQQQVSSSSFKKI
RKLTYENNSLQGSDNKQNDMDSKNIKKSISCENQINFNTLIQTSQQLLKNSNLQQNLNNL
QQVQNNDVNQNNQLFNQLKELKINQINNIQNIRVLEHYF


>TTHERM_00721610(gene)
AACATTGCAAATCAAACTCTGCATTTTTATTATTTTTTTATTATCACTAAAAAGCGCAAA
ATAAAATAAATAAAAAACAAAAAAGCAACAAACAACTCTTTAATTGTTTTTTCATTTGTT
TTTGATACAAAATACAAAAGCAATCAAGTAGGTAAAAGCTTCTTACAGTCAAACTGCAAA
CAAAGCCATAGCTTTAACGATACATATTATTTTTTAAGTTTCTACAAACATCTTTAAACC
ACATTAAAAATGTCCTTATATCAAAAAAATTCTGATTCCTTCGCTGTTTCCTCTGAACAA
GGTAACATTTTTAATCAAAAAATGTGCATTTCCTAACAATATTGTTATTGGCGCGTTATT
CTAAAAAGATTCTCTCGACAATATAGTAGTTGAAGATGACTACAATTAGCAAGACGATAT
TGATTCTTTCAAAAGTTTCTCAAGTTTTGACGTAGAATCAGAAGAACAAGGTGATGAAGA
AGCCTAAGTCTAAGAAGGAGAAGAAGAAGAAAACGAAAATTACCCAGAGTCTAACTAACA
CATTCAAGATAAAGATTCTATGGTTGATGATGAGACTAATTCGGAAGAAGAGCAACAATA
AACATAAGAAATGCTTAAAAGAACTGATTAGATAATCTTGAATAAAATTAACTTAAAGAA
AAGAAACATTTTCTAATTTGTGCACAGAAATTAAGTCAGGTAAATCCTATAAACTTGCAT
ATGCATTAGGGTTATTTGATTTTTAATTAGATAGATAATAAAAGATCACTAAGACTCAAA
TCATTTAATTAATTATCAATCCCTAAGCATTTCTTTTTTTTTTTTTTTTTTGAAATTAAG
AAAATCCGGGAATTTATTTTCAGTGGATAATAAATAAGATATTTTTCTTTACAAAATATC
CTAACCAATACAATTTTAAAATAATAGCATGATCTAAGATAAATAAAATGGCTACATGTC
CAAAAAGAAAAACTAGATAGGTTCTAATAAATTAGCTCAAAATGGATAGTAAGGATAGGG
TACTCAAATATTAAAGAGAGAAATATTGAATTACAGTCGCAGAGAAAAGAGCTTAGAAGA
ATTATCAAAGAAATTCTTATCTCTCTTCTTAGACAAGGAAGAATCTATGTTGAGCTTGGA
TAAAATTACTAACTAATTAGGTATTTATTAAACATTTGATTATAAATATATTTTTTGCTT
AATATCATTTCTAAACATATTCAGGAGTTGAAAGAAGAAGAATTTATGACATTATCAACA
TTCTTGAAAGCTTAAAGCTAGTCTCCCGCAAAGGAAAGAACAACTATAAATGGAATGGCT
TCCAAAAAATTTATGAAACTATAACTCAAGTAAGAATTAACTTTATTTTGTTTACTTTTA
AAATTGCTTAGAATTTATTTTAGAATTTTGTTTTTCTCTTTAAAATAAATAAAGTATCTT
GTTTGATAGATAGATAGAAGAATTAAAAATTAATTTTTATAAAATTTTCAAATAATTGCG
CAATTTTTCCAAATTTGAAACGAACTTATTAACTATCTTTTTATTCAATTAATTTGGTGT
TTATTTTTTCATTTCAGAATTTAATAGATAAATTCGAAATTAAAATTATCTATTTAAATT
TCAAATAGTTCGACCAAAAATCCTTAACAAAGAAAGAAGAGCAAGAACTAACTCAAGAAC
CATAGAAAAGAGAGAAGTCTCTTGAAATGCTTTCTATTGGCTTTCTTAAACTCTTCCTCC
ACTGGAAGAGCACCATGACTCTAGAAGAAGCAGCAAGAAAGCTTTCATCTAAGCAAATAG
ACGATCATAAAATTAAAACAAAAGTAGAACTTTATTTTTTATTTTTAAATATGTTGCCTT
TTGATTTATTTTCTTTAAATTATATTAATTAAATAAAATTATATTTAAAATAGATTAGAA
GACTCTATGATATTGCCAACGTATTTAAGAGCTTAGGGTTAATCAAAAAGACTTCCCTTA
TAGAAACAAAGAAACCTGCATTTGAATGGATAGGAATTGTAGGTCTCGATTCCTTTGCCT
ACAAAATTATGAGAGAAAAGAAAAGTGGTGATGAAGAATAAAACTGTGAAGAAGATAGCT
TAAATCAATCTCAATAAATGAGCTAATAAAATAGCTTTACAGAGCCTAAGTTAAGCAAAA
AGAGATTCTCAAATGATAAAAATAGCAGCAAGATTGATTCATCAACAGGCTAGTAAAAGT
AGTAACTTAAAAAATCTTTTATTATTTAACAACAACTCAAAGAATAAAGAGAAAAAGAAA
GATTGCTACTTGAATAAAACTAAAAATAGTAACAAATATAATAAAGTAGCTTAAATAATA
ATATAAATAATTCAAATATTACATAAAACTTGAGTTAATTATTGCAAACAATTCAAAAAA
ATATGAAAAGCCAAAACTAGGAAGCTCCTTAGTAAAATAATAACTCTTCCAACACTCCTT
TATCATTGTTATCTTAATTATAAATTTTATCACGCCCAATCTAGTAGAATTTAGTTAGTA
ATCTCAGCAGCTTGATTAATAACATCAATAATAATAACAATTAAAATAATTTAATTTAAC
AAGAAGAATAATAGTAAAGTAGCAATAATAATTTAATTGGAAATCTTATGTTAAAATGCC
TATAAAATGTTATTACTAATTTTGTTAGTAAGAATACAAATAACACATAAAATAAATAGC
AAGAAGAAAATTAGACTAACTTATAATAAACTTTATTAGAATCACCAGAAAAGGTTCTAA
AAATAAATAATTAAATTAATTAAAATAACTCTTTGAGTTAAATGTCATCTAACACAAAAA
TGAACAACAATAGTAATTATAAATGTCTCTAATCTTCTTAAAAAAGTACAAGCAATTTAG
GTGACTTTACTACAGCTAAAAAATAGAAGCAAATAATTAATGATGAAAACATCCCTCTTT
CTGGCGAAAAAGGCTTACATTAAGGCTTTAGCTCATAGAACACTAGTAGCTTAAAGACAC
CTATATTAAAACGCACATTGACAATAATCTAACCTAAGCTAGATGAGTGTGATGACATTA
CACCAACTCCACCCACTTGCAAAAGAAGTTTTTCTGCTTGCTTATCTTCTTCAAATAACA
ATAATATTAACAATAATACTTAAACCTTATTTTAAAATTTAATTTAATAAAATTAAAACC
AAGTCTATCCTAATCCATTCAGCGATAGAACTAATTTGAATAACAACAAACAATAAATTT
TCAATAATTTACTCGGATTTCAATAATAATAATAACAACAATAATAACAAGTATCTTCTT
CTTCATTTAAAAAAATAAGAAAACTGACATATGAGAACAATTCCTTATAGGGATCAGACA
ATAAATAAAACGATATGGACTCTAAAAATATAAAGAAATCAATTTCATGTGAAAATTAAA
TAAATTTTAATACTTTAATTTAAACTTCATAATAATTACTTAAAAATTCAAATCTTTAAT
AAAATCTGAACAATCTTCAATAAGTTTAAAACAATGATGTCAACTAAAACAATTAATTAT
TTAATCAATTAAAAGAATTAAAAATTAACTAGATTAATAATATATAAAACATAAGAGTTC
TTGAGCATTACTTCTGA