Identifiers and Description

Gene Model Identifier

TTHERM_01099150

Standard Name

E2FL2 (E2F Like)

Aliases

PreTt20585 | 232.m00052

Description

Transcription factor E2F/dimerisation partner (TDP)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01920 ) Prefoldin subunit
  • ( PF08466 ) Inward rectifier potassium channel N-terminal
  • ( PF02319 ) Transcription factor E2F/dimerisation partner (TDP)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_01099150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19385.11.999126889527329e-167transcription factor Dp-1 (317
aa)
OxytrichaContig20893.0.g828.99768837233868e-29E2F/DP family winged-helix DNA
-binding domain
DictyBaseDDB_G02841293.999970367130025e-21e2f on chromosome: 4 position
1622284 to 1624946
WormBaseWBGene000011625.0013199114200274e-20locus:efl-2 status:Confirmed
UniProt:A5HWA6 protein_id
:CAN86629.1
Stentor CoeruleusSteCoe_230761.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27892792: Zhang J, Tian M, Yan GX, Shodhan A, Miao W (2017) E2fl1 is a meiosis-specific transcription factor in the protist Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 16(1):123-135

Sequences

>TTHERM_01099150(coding)
ATGAACGGTAAAAGAAAATAAGGAGCTCAAGTAGCATAAATAAATGCAACTTAGCGTGAT
AAGAAAAAAAAAATAGAATAGTAAATTGAAGAAAGCACTAATAATTCTTAAGCTAACTCT
TTCAACGATGAAGAAGAGGAGGAAGATGGTTTATCAAACGATAATCAATAATAGCAGTAG
GGAAATGGAAAAGAAAAGGTAAAGAGTCGTCAAGATAATTCGTTAAGCGTACTTACCAAA
AGATTTGTTCAGCTCATATAGAATTCGCCAAATTAAACAATTGATTTAAATGAAACAGTT
TCTAGTTTAAAAGTTTAAAAGCGTCGTATTTATGATATAACTAACGTACTCGAAGGTATT
GGATATATTGAAAAGATTCACAAAAATAAAATTAAGTGGGTTGGAGGAACAGAAGATCCT
GAACTCCAAACCGAAATTCAAAAAATGTAGGAAGAATTAGCTCATCTTGAAAAACAAGAA
TAATAAATGGATTCTTGGATAAAATATTTGCATGATTAACTAAAAAATACATTTAATAAT
AACGAAGAAGAGTCTAAATATGCTTATTTGACATAAGAAGATTTTAAAAAGTTATATAAA
TAATGTATGAATGATTCAGGCGAAACTATGTTTATTATTACTGCACCAAAAGGAACTACA
GTAGAAGCACCAATCCTAGAGTCAGAAATACAATATGAATACCCATACCAACTCTTCTTA
AATAGTTAAAAATTAGGAGAATTGGAAGTTTTCTTATGCTCAGATGAAAATGACCAATAA
GAAGTTAAACCTACAAAGTAATCTTAAAAGAAGATGAGAATCCCAGGTGAAGATGAAATG
GAGGAAGAAAATAACAATATTTTTAATCAAGCCATTCAATAATAATCAAAAATTAAAGCA
AATAATAAAAACAAAAAAGGAAACAACTAAAATATTTCTGATATGATTGAGTGA


>TTHERM_01099150(protein)
MNGKRKQGAQVAQINATQRDKKKKIEQQIEESTNNSQANSFNDEEEEEDGLSNDNQQQQQ
GNGKEKVKSRQDNSLSVLTKRFVQLIQNSPNQTIDLNETVSSLKVQKRRIYDITNVLEGI
GYIEKIHKNKIKWVGGTEDPELQTEIQKMQEELAHLEKQEQQMDSWIKYLHDQLKNTFNN
NEEESKYAYLTQEDFKKLYKQCMNDSGETMFIITAPKGTTVEAPILESEIQYEYPYQLFL
NSQKLGELEVFLCSDENDQQEVKPTKQSQKKMRIPGEDEMEEENNNIFNQAIQQQSKIKA
NNKNKKGNNQNISDMIE


>TTHERM_01099150(gene)
ATGAACGGTAAAAGAAAATAAGGAGCTCAAGTAGCATAAATAAATGCAACTTAGCGTGAT
AAGAAAAAAAAAATAGAATAGTAAATTGAAGAAAGCACTAATAATTCTTAAGCTAACTCT
TTCAACGATGAAGAAGAGGAGGAAGATGGTTTATCAAACGATAATCAATAATAGCAGTAG
GGAAATGGAAAAGGTAATATAATATTTCCTTTTTTCAAAATGCTTAAATTTATATTTTCC
TTACTTAAGTATCTACAATGTATTATTAACTCAATTAAATTTATAGAAAAGGTAAAGAGT
CGTCAAGATAATTCGTTAAGCGTACTTACCAAAAGATTTGTTCAGCTCATATAGAATTCG
CCAAATTAAACAATTGATTTAAATGAAACAGTTTCTAGTTTAAAAGTTTAAAAGCGTCGT
ATTTATGATATAACTAACGTACTCGAAGGTATTTACCATTTTTATTTAGTTTGAATTTAT
AAAATCTCAAATCATTAAATCACTGAAGGAAACAAACGATCGGCTACTTTCTTAAATTTA
TATAATTAAGAAGTATTCAAAATAATACAATTTTAAAAAAAAGTAACAAGATATTATTAA
AAGAATTTTAAAAAGCATTAAATACTATTTTTGCTTGATCTTTCTGTTAAAATGTTAATT
CCCTTCAAAAAGATATTTTACGATATTTGATCCAAAATTTAAAGGATTATTTTAAAAGTT
TAATTTAATTGAAATCCACTACCTTACACAAAAAGATATAGAAATAATTAATTTGATTAT
CTGTATGAATAAAAATGATTAAAACTTTCAATATACTTTAATTCAATTGCTTATTTTAAT
ATGATATTGAGATCACTTCTCAAAAAGATTTAGAATTTATTTCAAAAATAACAAAAAAAC
AACCAAATATTGTAAAATTTAATTTATTTTGCGGGAAAAAAACAGATAATTTAATTAATT
TAAAATTTCTTTTTGGAGGGTAAATATTATTAGAATTTATCAATAATTTATTTGATAGAA
TTTAAAATTAACAAAAATATTTAAAACTAAAAAATTATTAATTAATATGTGATTTAATTT
TATTCATATTCAGTTTATTTACCATTATTAGTGAAATTTTATCTTTTAATTGTAAAATAA
TATTTTAAATAAAGGTATTGGATATATTGAAAAGATTCACAAAAATAAAATTAAGTGGGT
TGGAGGAACAGAAGATCCTGAACTCCAAACCGAAATTCAAAAAATGTAGGAAGAATTAGC
TCATCTTGAAAAACAAGAATAATAAATGGATTCTTGGATAAAATATTTGCATGATTAACT
AAAAAATACATTTAATAATAACGAAGAAGAGTCTAAATATGCTTATTTGACATAAGAAGA
TTTTAAAAAGTTATATAAATAATGTATGAATGATTCAGGCGAAACTATGTTTATTATTAC
TGCACCAAAAGGAACTACAGTAGAAGCACCAATCCTAGAGTCAGAAATACAATATGAATA
CCCATACCAACTCTTCTTAAATAGTTAAAAATTAGGAGAATTGGAAGTTTTCTTATGCTC
AGATGAAAATGACCAATAAGAAGTTAAACCTACAAAGTAATCTTAAAAGAAGATGAGAAT
CCCAGGTGAAGATGAAATGGAGGAAGAAAATAACAATATTTTTAATCAAGCCATTCAATA
ATAATCAAAAATTAAAGCAAATAATAAAAACAAAAAAGGAAACAACTAAAATATTTCTGA
TATGATTGAGTGA