Identifiers and Description

Gene Model Identifier

TTHERM_00695710

Standard Name

E2FL1 (E2F Like)

Aliases

PreTt17467 | 108.m00119 | 3818.m00656

Description

transcription factor E2F

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00695710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18068.13.999925618735366e-62hypothetical protein (320 aa)
OxytrichaContig20893.0.g824.998394530072393e-19E2F/DP family winged-helix DNA
-binding domain
WormBaseWBGene000011626.002144168983342e-19locus:efl-2 status:Confirmed
UniProt:A5HWA6 protein_id
:CAN86629.1
Stentor CoeruleusSteCoe_289570.000000000005109089028063325
DictyBaseDDB_G02841290.000000000040005666873964816e2f on chromosome: 4 position
1622284 to 1624946

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29417875: Zhang J, Yan G, Tian M, Ma Y, Xiong J, Miao W (2018) A DP-like transcription factor protein interacts with E2fl1 to regulate meiosis in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 17(5):634-642
  2. Ref:27892792: Zhang J, Tian M, Yan GX, Shodhan A, Miao W (2017) E2fl1 is a meiosis-specific transcription factor in the protist Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 16(1):123-135

Sequences

>TTHERM_00695710(coding)
ATGAGTAATAAAAATTTACAATTTGATAAAGATTCTTTAAAATAAATTATTAACATTCAA
TCTAACTAAAATGATAGCTAATATATCAACTAGAAAGATGTTCATCAATGCACTAATTTA
TCAAAGAAAGCCTTCAATTAGGAGCTTGAGCCTTGCCTGTTTAGGAAGAAAGCAGCTTTT
TAATACAAAAAATCAAAGGAAGATTTAAATTATAACATTGGTAAGAAAAGGAAGAATGTT
TATGATAGAAGTATAAATGTTAGGGAAAATTAAAAAAGGCAAGACAATTCCTTAAGCATT
CTTACTCGAAGATTCATGAAATAAATTCGATCTGAATAAAACTAAACAATAGATCTAAAC
TAAGTATCAATTGTTCTCGGAGTTTAAAAGAGGAGGATATATGATATCACGAACGTGCTA
GAGGGAATAAATTATGTCAAAAAAGTGTCAAAAAATAAACTCAAATGGATAGGACCACCT
AACTAAGAAGCAAAGGAGAATAGAATTATAGCTGAAGTTTAGCAATTAATCGCTGAAGAA
ATGATTTTAGACAAAGTAATATATGAGTTTAATGAAAAAATTTAAAATCTTCTGTAGTAA
AAAGAGGATTTTTGCTACTTCAACAGAATGGACATATAGCAATTAGGCAAAAATTAAAAA
CCAAATGAAAAAACTATAGTCATTCAACTACCGAAGAAAAGTATAATTTAAATCAAAGAT
TTTTAGAAAGAATAGAAAGAAATAAAATCAAATATGGAGATTTTAAAAGGTAATCAAAAA
TTTGAAAGTCTTAAAAGAATATGTATAACCTCTACCTCGATAGGGAAATTTCAAAAAGGT
AATACGCAATATTAATCACCCAAAAAAGATAATAATTAAATAAAGGTTTATCAAATTAGC
CAGATTTCAAAAGATCAGTGA


>TTHERM_00695710(protein)
MSNKNLQFDKDSLKQIINIQSNQNDSQYINQKDVHQCTNLSKKAFNQELEPCLFRKKAAF
QYKKSKEDLNYNIGKKRKNVYDRSINVRENQKRQDNSLSILTRRFMKQIRSEQNQTIDLN
QVSIVLGVQKRRIYDITNVLEGINYVKKVSKNKLKWIGPPNQEAKENRIIAEVQQLIAEE
MILDKVIYEFNEKIQNLLQQKEDFCYFNRMDIQQLGKNQKPNEKTIVIQLPKKSIIQIKD
FQKEQKEIKSNMEILKGNQKFESLKRICITSTSIGKFQKGNTQYQSPKKDNNQIKVYQIS
QISKDQ


>TTHERM_00695710(gene)
ATGAGTAATAAAAATTTACAATTTGATAAAGATTCTTTAAAATAAATTATTAACATTCAA
TCTAACTAAAATGATAGCTAATATATCAACTAGAAAGATGTTCATCAATGCACTAATTTA
TCAAAGAAAGCCTTCAATTAGGAGCTTGAGCCTTGCCTGTTTAGGAAGAAAGCAGCTTTT
TAATACAAAAAATCAAAGGAAGATTTAAATTATAACATTGGTAAGAAAAGGAAGAATGTT
TATGATAGAAGTATAAATGTTAGGGAAAATTAAAAAAGGCAAGACAATTCCTTAAGCATT
CTTACTCGAAGATTCATGAAATAAATTCGATCTGAATAAAACTAAACAATAGATCTAAAC
TAAGTATCAATTGTTCTCGGAGTTTAAAAGAGGAGGATATATGATATCACGAACGTGCTA
GAGGGTAATTTTATATGGAAAATTTTTTAGAGCTTTAATTATCCTTTTTAAAATTAATTG
AAACAATAAAGGGGGATTTATTATTTCTTCATCTAACATCAAAAGGAATAAATTATGTCA
AAAAAGTGTCAAAAAATAAACTCAAATGGATAGGACCACCTAACTAAGAAGCAAAGGAGA
ATAGAATTATAGCTGAAGTTTAGCAATTAATCGCTGAAGAAATGATTTTAGACAAAGTAA
TATATGAGTTTAATGAAAAAATTTAAAATCTTCTGTAGTAAAAAGAGGATTTTTGCTACT
TCAACAGAATGGACATATAGCAATTAGGCAAAAATTAAAAACCAAATGAAAAAACTATAG
TCATTCAACTACCGAAGAAAAGTATAATTTAAATCAAAGATTTTTAGAAAGAATAGAAAG
AAATAAAATCAAATATGGAGATTTTAAAAGGTAATCAAAAATTTGAAAGTCTTAAAAGAA
TATGTATAACCTCTACCTCGATAGGGAAATTTCAAAAAGGTAATACGCAATATTAATCAC
CCAAAAAAGATAATAATTAAATAAAGGTTTATCAAATTAGCCAGATTTCAAAAGATCAGT
GA