Identifiers and Description

Gene Model Identifier

TTHERM_00348940

Standard Name

DYRK4 (homolog to human protein DYRK4)

Aliases

PreTt05306 | 36.m00270 | 3703.m00132

Description

Protein kinase domain containing protein. Sequence similarity to the DYRK2 protein kinase subfamily (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00348940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09799.19.997093137033517e-262hypothetical protein (1083 aa)
OxytrichaContig21921.0.g122.998986826334339e-156Protein kinase domain
WormBaseWBGene000031508.998537725811687e-130locus:mbk-2 Dual specificity
tyrosine-phosphorylation-regu
lated kinase mbk-2 status:Co
nfirmed UniProt:Q9XTF3 pro
tein_id:CAB54254.2
DictyBaseDDB_G02937509.997006461365152e-115dyrk2 on chromosome: 6 positio
n 3272270 to 3275238
SGDYJL141C5.999266750653237e-78YAK1 Serine-threonine protein
kinase; component of a glucose
-sensing system that inhibits
growth in response to glucose
availability; upon nutrient de
privation Yak1p phosphorylates
Pop2p to regulate mRNA deaden
ylation, the co-repressor Crf1
p to inhibit transcription of
ribosomal genes, and the stres
s-responsive transcription fac
tors Hsf1p and Msn2p; nuclear
localization negatively regula
ted by the Ras/PKA signaling p
athway in the presence of gluc
ose
Stentor CoeruleusSteCoe_267871.4411565509640892e-64

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00348940(coding)
ATGAATGCATATAAGCCAAAATTTCATAAAAAGTTAATGATTTCGCCTAAAAATGCGTCT
TATGATCTCAATTTTAGAGGATTCAGCTAAGGCTCAGCTGTCATCACTCCATAAGCAGAA
AAGGTTTAATCTACCAGAAATTCTTTTGCTATTGATTAAAAAAATAAAGACTCAATTTTG
TAAAGCAATATCAGCTAACCTGAATCAACCAAGTAGAATCATTTTGGATATCAAAATTAG
CTTGCTCACTAGCAAATACAGCAATAATAGCTTTAACAACAGCAACAATCTCTATAGTAA
ATGTAGCAGTAATAATAGTAGATGACATTATAGCAGTCATAGAATTAACTTAATCAATAA
CATTAATAGCAGTTAATTATGATGATTTAGCAATAATAGTAGTAGCAACATGGTTAGTAG
TTGCCAAATTAGACTTCTTCTAAGAAGAGTAATTAGTAGTAGTAAATGTAGTAAAACCAA
ATATAATAGTCTTAGTATTCGAATGTTTTGAATCTTCTTATGCAATAGTAGCCTACATAA
CCTCCATAATAACATTAGCAAATTTACTAAAATTTGAACAATTCCCAACAATATACCACC
ATGCAGTAATCTTCAGGATAAAATTATTCTAACTAATCTTTTACCACAAATCGTTAAAAC
TCAAACGCTAATTATTTATACCATTAACTTAACCCTCCTCAATCAACAAAAGCTGCTGAT
TCGAATAGGAGACAAAATAATCCTTTCAGTGGAACATATTCAACAAAGAATACTTCTGCG
CCTTAATAGTTATTAAAAGATATTTTGTCTAAAATTAACAAAGAATAAGTATAACAACAA
TTACCTTATCAATAAAATTAGTAAGTACTTAGATCATCTCATATGATGAATAACAGCTAG
AATAATAGCAACAGTAATGTAGTTATATTAAACAACAACACGCAAAATGCAAATAATTAA
AATATTTATTCTTCTAACTACGTAAATACCAATCCTGATCTTAGTAATATATATAATCCT
AATAATCTTGCTGCTATGAACCCATAACCTTCATCAACAAAATCTAATCGTATTCATTCA
CATTACTTCCCTGCAACAACTAAGAATAAAAGCAACAGAAATCCAAGTCTCGATAAATTG
AATGATTCTTCTTTTTTAAGATTAAAAAATGTCCAATCACCAAAACAAAGAACAATTAGA
ACAATAATGCCTGGTAGTAATAGAGATAATTCTGTTGGGAATAATTCTTCAATAAATAGA
AACGGATATTTCTAACGCGAATATAGTGAAAGTGGTGTAGATGCTAGTAATTAATATATT
CTCCCAGCAAGTTTATTGCAATAAAAAACAAAGAGAAGTGGCAACAGTATTACTGGAGGA
GTAAATAATGTTATTGCAAATAATAATAACAGCTATAACAATGGATCATATAGCAAAATA
TAACCTCACTTACCTTAAAACTAAACAAGATAAAATGGCACGCCATATGTAAAGAAAGAT
TTAACAATAAAAACAGGTAACTCAATAGAGACTCTAAAAGATATTTTATCACCTACAAAT
AACAATGCAAACCCTAAAACTACAACTGCTACTAAAGACTCTAAGAAGCACTTGAATAGC
AATACTCTACCTATACAAAGTTACACTACTACACATGCGCAATAAATACATCAATAAAAA
AGATTGCTCCAAAAGCGAGATGATCAAAAAAATAAATCAAATTTTATAAATTCTTCTTTC
TAATATATTATGGCTAGTGAAAACAATAGCGTGGAAAACACAAATCGTTTTTCCTATAAC
GTGATGAATAATATGGTAGCTAATAATTAAGGACAAAAATTGCTAAAAAATAAAAATAAT
TCGATGGAAAACTAGCAATTCAAGAATTTATCATTCACATAACCTCTGAATGATTAGTTC
AAATAAACAAAAGAAAATAACAACACACAAAACTCAAATAATAAAATTCTTACAGTTAAG
TAGTAACAGTAAAAGCAATAATTGTAATTTATACAAAAGGGACTAGGTTAAAACTCAAGC
AAATAAAATTAATCTTCTATCTAAACCAGCGAAGGAAATGAAAACAAATCTGAATCTAAC
TATGAAAGCTAAGGATAAAATTTAGATAACTTTGATCAACATAAGATAGATTTGTCAACA
GCAAGCTAGACTCCTTTTAGAAATGGCAATTCTACAAATGAGAAAAAAACTTTAGATGAT
AATAACACAAGGAATACAGAGAGAGATGAAAAAAAAGAAGAACCTTTAGATTGGGAAAAA
GTGAAAGTACCAATAACTCCTTTAGAAGTATTAGCTAAGTACTAAAAGTATTTAACACCT
TAGGAAAAAGCAGAAATATTAGAGTTCAAAAGAATATATTTTATTGGCCATAATGCAAAC
AAAGCTGCTTAAGAAAATGGTAATAATGATGATACTAAAGGAGATTATTAGTATAATGTT
AATGATCACATCGCTTACAGATATGAGATTAAAGAGTTTTTAGGTAAGGGATCCTTTGGA
TAAGTTCTAAAAGTTTTTGACCATAAGAGAAAGGAGTATGCAGCTCTTAAAGTTATTAGA
AACAAATAAAAGTTCCATGAATAGGCCTTAATTGAGTTGAATATTTTACACTACATCAAA
GAAAAAGATTATGATAACTAAACAAACATCGTTAAAATTAGAGATTTTGTTATTTTTAGA
AATCATGTGTGTTTGGTGTTTGAGTTGTTAAGTATTAACTTGTATGATTTACTCAGAAAT
AATAAATTCTAGGGTTTATCTTTGGAGCTTATTAGAAGATTTGCAATTCAATTATTAAAT
GCAATATCTTTTTTGAAAGAAAATAGGATCATTCACTGTGATTTGAAACCTGAAAATGTC
CTATTAAAACAACCAAATAAAAGTGGTATTAAAATAGCTGATTTTGGTTCAAGCTGTTTC
GATGACTAAGTCATGTATACTTATATATAATCAAGATATTATCGTTCTCCAGAAGTCATT
CTCGGAATACCTTATGGTACTGAAATAGATATGTGGAGTTTTGGATGCATTATAGCTGAA
CTATTTTTGGGATACCCAATTTTCCCAGGAGAAGATGAAAATGAATAAATGGGATATATA
ATGGAATTATTAGGTGCTCCAGATTCAGAATTTTTAAAAAAATGCTCAAGAAAGAAATAT
TTCTTTGATCAAAATGATTAACCTCTTTAAATTCCTAACAGCAGAGGTAAAATTAGAATG
CCAAACAGTAAAAATTGGAAAAGTGTAATCGGATGCACTGATGATAACTTTATTGACTTC
ATTAAAAAGTGCTTAGTTTGGGAGCCTTCTTAAAGATTGACTCCTCGTGATGCTCTCCTT
CACCCTTGGATATTAGATGGACTACCTGAAGATATTCGTGTGCAGCACATAAAATTCTTG
AAAGATAAATCCTTTGAAACAGCTTCAGAAAAAGAATTCCATAAATAAAGTTGCCTGTAA
GCATAATATAACGCGGATGCTTAAAGTGCAGCAATGGCTTTGGCTCTACAAAAGATTTAT
AAGTACAATAATAAAAAAAGAATTTTAGAAAAAAAATCTACAACATAAGGAACTGTCTCT
GAAGAAACTAGAAACTCTGTCATGGAGGAAAAAAAATAGACTGCAGAAGTGAGCCAAATG
TTTAATAACTTTTTTATTCAGCCTGAAAGCACAAAAAATAATAATAAAAATAATTAGAAT
TCTTTCAACAACAATACAAATAATTCCTAAAATTTTAGTAACGGAAACCCTATGAACGAC
ACAAATAAATCAAATAGTTTAAATCAAAATAATTTTTCTAACAATAACAATAATATATAA
AATTAAAATAACTTCATTATTCTCACCAACCCAAATAAAATTAAAATTCCAAATGCAAAT
AGTAATAGTCTAACTTAAAAGAAGAAAATAACAGCTTAAATCCTACAAGATCAGCAGAAC
CAACACTCTTTTTAAGCTAATTAAAACTCATAATAAACTCAACAAAAATTGACTCTATAA
TAACAACAAGTCTAATTATAACTGTAGCTACAAAAAATAGCTTAGTAATAAAAATTATAA
AAACTTTAGTGA


>TTHERM_00348940(protein)
MNAYKPKFHKKLMISPKNASYDLNFRGFSQGSAVITPQAEKVQSTRNSFAIDQKNKDSIL
QSNISQPESTKQNHFGYQNQLAHQQIQQQQLQQQQQSLQQMQQQQQQMTLQQSQNQLNQQ
HQQQLIMMIQQQQQQQHGQQLPNQTSSKKSNQQQQMQQNQIQQSQYSNVLNLLMQQQPTQ
PPQQHQQIYQNLNNSQQYTTMQQSSGQNYSNQSFTTNRQNSNANYLYHQLNPPQSTKAAD
SNRRQNNPFSGTYSTKNTSAPQQLLKDILSKINKEQVQQQLPYQQNQQVLRSSHMMNNSQ
NNSNSNVVILNNNTQNANNQNIYSSNYVNTNPDLSNIYNPNNLAAMNPQPSSTKSNRIHS
HYFPATTKNKSNRNPSLDKLNDSSFLRLKNVQSPKQRTIRTIMPGSNRDNSVGNNSSINR
NGYFQREYSESGVDASNQYILPASLLQQKTKRSGNSITGGVNNVIANNNNSYNNGSYSKI
QPHLPQNQTRQNGTPYVKKDLTIKTGNSIETLKDILSPTNNNANPKTTTATKDSKKHLNS
NTLPIQSYTTTHAQQIHQQKRLLQKRDDQKNKSNFINSSFQYIMASENNSVENTNRFSYN
VMNNMVANNQGQKLLKNKNNSMENQQFKNLSFTQPLNDQFKQTKENNNTQNSNNKILTVK
QQQQKQQLQFIQKGLGQNSSKQNQSSIQTSEGNENKSESNYESQGQNLDNFDQHKIDLST
ASQTPFRNGNSTNEKKTLDDNNTRNTERDEKKEEPLDWEKVKVPITPLEVLAKYQKYLTP
QEKAEILEFKRIYFIGHNANKAAQENGNNDDTKGDYQYNVNDHIAYRYEIKEFLGKGSFG
QVLKVFDHKRKEYAALKVIRNKQKFHEQALIELNILHYIKEKDYDNQTNIVKIRDFVIFR
NHVCLVFELLSINLYDLLRNNKFQGLSLELIRRFAIQLLNAISFLKENRIIHCDLKPENV
LLKQPNKSGIKIADFGSSCFDDQVMYTYIQSRYYRSPEVILGIPYGTEIDMWSFGCIIAE
LFLGYPIFPGEDENEQMGYIMELLGAPDSEFLKKCSRKKYFFDQNDQPLQIPNSRGKIRM
PNSKNWKSVIGCTDDNFIDFIKKCLVWEPSQRLTPRDALLHPWILDGLPEDIRVQHIKFL
KDKSFETASEKEFHKQSCLQAQYNADAQSAAMALALQKIYKYNNKKRILEKKSTTQGTVS
EETRNSVMEEKKQTAEVSQMFNNFFIQPESTKNNNKNNQNSFNNNTNNSQNFSNGNPMND
TNKSNSLNQNNFSNNNNNIQNQNNFIILTNPNKIKIPNANSNSLTQKKKITAQILQDQQN
QHSFQANQNSQQTQQKLTLQQQQVQLQLQLQKIAQQQKLQKLQ


>TTHERM_00348940(gene)
ATGAATGCATATAAGCCAAAATTTCATAAAAAGTTAATGATTTCGCCTAAAGTACTTTCA
TTTTACCTTATATTAACTTCCAGACTTATCTTTCTCAAAACGATTTATATTCGTTGATTA
TAGTTGTTTATTTTATCTAATTAACATTATAAATAAGAATGCGTCTTATGATCTCAATTT
TAGAGGATTCAGCTAAGGCTCAGCTGTCATCACTCCATGTAATTAGATTATGTATATTTT
TAATACGTTTATTCAATTTTGTTCTTAAACAAAAGAAGCAGAAAAGGTTTAATCTACCAG
AAATTCTTTTGCTATTGATTAAAAAAATAAAGACTCAATTTTGTAAAGCAATATCAGCTA
ACCTGAATCAACCAAGGTAATATAAAAAAAATATGTTTTAGATAGATGAAGATTTTTTTT
TAATTTATTTTGAATGGTTTCATGCTAAATAAATTAATTTTATATTGTTATAAAGTAGAA
TCATTTTGGATATCAAAATTAGCTTGCTCACTAGCAAATACAGCAATAATAGCTTTAACA
ACAGCAACAATCTCTATAGTAAATGTAGCAGTAATAATAGTAGATGACATTATAGCAGTC
ATAGAATTAACTTAATCAATAACATTAATAGCAGTTAATTATGATGATTTAGCAATAATA
GTAGTAGCAACATGGTTAGTAGTTGCCAAATTAGACTTCTTCTAAGAAGAGTAATTAGTA
GTAGTAAATGTAGTAAAACCAAATATAATAGTCTTAGTATTCGAATGTTTTGAATCTTCT
TATGCAATAGTAGCCTACATAACCTCCATAATAACATTAGCAAATTTACTAAAATTTGAA
CAATTCCCAACAATATACCACCATGCAGTAATCTTCAGGATAAAATTATTCTAACTAATC
TTTTACCACAAATCGTTAAAACTCAAACGCTAATTATTTATACCATTAACTTAACCCTCC
TCAATCAACAAAAGCTGCTGATTCGAATAGGAGACAAAATAATCCTTTCAGTGGAACATA
TTCAACAAAGAATACTTCTGCGCCTTAATAGTTATTAAAAGATATTTTGTCTAAAATTAA
CAAAGAATAAGTATAACAACAATTACCTTATCAATAAAATTAGTAAGTACTTAGATCATC
TCATATGATGAATAACAGCTAGAATAATAGCAACAGTAATGTAGTTATATTAAACAACAA
CACGCAAAATGCAAATAATTAAAATATTTATTCTTCTAACTACGTAAATACCAATCCTGA
TCTTAGTAATATATATAATCCTAATAATCTTGCTGCTATGAACCCATAACCTTCATCAAC
AAAATCTAATCGTATTCATTCACATTACTTCCCTGCAACAACTAAGAATAAAAGCAACAG
AAATCCAAGTCTCGATAAATTGAATGATTCTTCTTTTTTAAGATTAAAAAATGTCCAATC
ACCAAAACAAGTAAAAAATTATCTATTTTCAAGCTTTTGATTTTAGTTTGATAAAAAACC
AACTTAGAGTGTGTTAAATAATTTTTTTTATTTTAAAATAGAGAACAATTAGAACAATAA
TGCCTGGTAGTAATAGAGATAATTCTGTTGGGAATAATTCTTCAATAAATAGAAACGGAT
ATTTCTAACGCGAATATAGTGAAAGTGGTGTAGATGCTAGTAATTAATATATTCTCCCAG
CAAGTTTATTGCAATAAAAAACAAAGAGAAGTGGCAACAGTATTACTGGAGGAGTAAATA
ATGTTATTGCAAATAATAATAACAGCTATAACAATGGATCATATAGCAAAATATAACCTC
ACTTACCTTAAAACTAAACAAGATAAAATGGCACGCCATATGTAAAGAAAGATTTAACAA
TAAAAACAGGTAACTCAATAGAGACTCTAAAAGGTATTATTAAATTATTTTCTTAATCTC
AAACTTTTTCTTTAAATTAAAAATTAATAAAATAGATATTTTATCACCTACAAATAACAA
TGCAAACCCTAAAACTACAACTGCTACTAAAGACTCTAAGAAGCACTTGAATAGCAATAC
TCTACCTATACAAAGTTACACTACTACACATGCGCAATAAATACATCAATAAAAAAGATT
GCTCCAAAAGCGAGATGATCAAAAAAATAAATCAAATTTTATAAATTCTTCTTTCTAATA
TATTATGGCTAGTGAAAACAATAGCGTGGAAAACACAAATCGTTTTTCCTATAACGTGAT
GAATAATATGGTAGCTAATAATTAAGGACAAAAATTGCTAAAAAATAAAAATAATTCGAT
GGAAAACTAGCAATTCAAGAATTTATCATTCACATAACCTCTGAATGATTAGTTCAAATA
AACAAAAGAAAATAACAACACACAAAACTCAAATAATAAAATTCTTACAGTTAAGTAGTA
ACAGTAAAAGCAATAATTGTAATTTATACAAAAGGGACTAGGTTAAAACTCAAGCAAATA
AAATTAATCTTCTATCTAAACCAGCGAAGGAAATGAAAACAAATCTGAATCTAACTATGA
AAGCTAAGGATAAAATTTAGATAACTTTGATCAACATAAGATAGATTTGTCAACAGCAAG
CTAGACTCCTTTTAGAAATGGCAATTCTACAAATGAGAAAAAAACTTTAGATGTAATAAA
TACATTAATTATTAAAAAAATTTATTAAATTATTTATTGGTTGTATTTCTTAAAGGATAA
TAACACAAGGAATACAGAGAGAGATGAAAAAAAAGAAGAACCTTTAGATTGGGAAAAAGT
GGTAAGAATACTTTTCTTTAATGTCAGATGCTTCATTTTTTTTAATTTAATAATAGAAAG
TACCAATAACTCCTTTAGAAGTATTAGCTAAGTACTAAAAGTATTTAACACCTTAGGAAA
AAGCAGAAATATTAGAGTTCAAAAGAGTAATAATTAATAAATAAATTTATTTTTAAGATT
ATTAATTTTTATATTTAAAAAAAGATATATTTTATTGGCCATAATGCAAACAAAGCTGCT
TAAGAAAATGGTAATAATGATGATACTAAAGGAGATTATTAGTATAATGTTAATGATCAC
ATCGCTTACAGATATGAGATTAAAGAGTTTTTAGGTAAGGGATCCTTTGGATAAGTTCTA
AAAGTTTTTGACCATAAGAGAAAGGAGTATGCAGCTCTTAAAGTTATTAGAAACAAATAA
AAGTTCCATGAATAGGCCTTAATTGAGTTGAATATTTTACACTACATCAAAGAAAAAGAT
TATGATAACTAAACAAACATCGTTAAAATTAGAGATTTTGTTATTTTTAGAAATCATGTG
GTAATTAAAAAAAAATAAACTTTAAGAAAACAAAGACTTAAAATTTTTTTATTTATACAA
ATAAATAGTGTTTGGTGTTTGAGTTGTTAAGTATTAACTTGTATGATTTACTCAGAAATA
ATAAATTCTAGGGTTTATCTTTGGAGCTTATTAGAAGATTTGCAATTCAATTATTAAATG
CAATATCTTTTTTGAAAGAAAATAGGATCATTCACTGTGATTTGAAACCTGAAAATGTCC
TATTAAAACAACCAAATAAAAGTGGTATTAAAATAGCTGATTTTGGTTCAAGCTGTTTCG
ATGACTAAGTCATGTATACTTATATATAATCAAGATATTATCGTTCTCCAGAAGTCATTC
TCGGAATACCTTATGGTACTGAAATAGATATGTGGAGTTTTGGATGCATTATAGCTGAAC
TATTTTTGGGATACCCAATTTTCCCAGGAGAAGATGAAAATGAATAAATGGGATATATAA
TGGAATTATTAGGTGCTCCAGATTCAGAATTTTTAAAAGTAAAAAAATTTACATTTATTA
TAAGTTAAAAAATAATTTTTTTTGCTTTTTTAATAAACAGAAATGCTCAAGAAAGAAATA
TTTCTTTGATCAAAATGATTAACCTCTTTAAATTCCTAACAGCAGAGGTAAAATTAGAAT
GCCAAACAGTAAAAATTGGAAAAGTGTAATCGGATGCACTGATGATAACTTTATTGACTT
CATTAAAAAGTGCTTAGTTTGGGAGCCTTCTTAAAGATTGACTCCTCGTGATGCTCTCCT
TCACCCTTGGATATTAGATGGACTACCTGAAGATATTCGTGTGCAGCACATAAAATTCTT
GAAAGATAAATCCTTTGAAACAGCTTCAGAAAAAGAATTCCATAAATAAAGTTGCCTGTA
AGCATAATATAACGCGGATGCTTAAAGTGCAGCAATGGCTTTGGCTCTACAAAAGATTTA
TAAGTACAATAATAAAAAAAGAATTTTAGAAAAAAAATCTACAACATAAGGAACTGTCTC
TGAAGAAACTAGAAACTCTGTCGTAAATTGAACATTCTAAATTACTTCTAGTTCTTTTGA
AATAAAATCAATAACATCTTTTTAATTAATCATTCATTTGTTAAAATTCAGATGGAGGAA
AAAAAATAGACTGCAGAAGTGAGCCAAATGTTTAATAACTTTTTTATTCAGCCTGAAAGC
ACAAAAAATAATAATAAAAATAATTAGAATTCTTTCAACAACAATACAAATAATTCCTAA
AATTTTAGTAACGGAAACCCTATGAACGACACAAATAAATCAAATAGTTTAAATCAAAAT
AATTTTTCTAACAATAACAATAATATATAAAATTAAAATAACTTCATTATTCTCACCAAC
CCAAATAAAATTAAAATTCCAAATGCAAATAGTAATAGTCTAACTTAAAAGAAGAAAATA
ACAGCTTAAATCCTACAAGATCAGCAGAACCAACACTCTTTTTAAGCTAATTAAAACTCA
TAATAAACTCAACAAAAATTGACTCTATAATAACAACAAGTCTAATTATAACTGTAGCTA
CAAAAAATAGCTTAGTAATAAAAATTATAAAAACTTTAGTGA