Identifiers and Description

Gene Model Identifier

TTHERM_00912290

Standard Name

DYH7 (DYnein Heavy chain )

Aliases

PreTt23736 | 162.m00065

Description

Heavy chain subunit of ciliary two-headed inner arm dynein (IAD) complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08598 ) Sds3-like
  • ( TIGR01612 ) rhoptry protein
  • ( PF03028 ) Dynein heavy chain
  • ( TIGR01257 ) rim ABC transporter
  • ( PF06246 ) Isy1-like splicing family
  • ( PF01926 ) GTPase of unknown function
  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF03002 ) Somatostatin/Cortistatin family
  • ( TIGR00020 ) peptide chain release factor 2
  • ( TIGR01847 ) bacteriocin-type signal sequence
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( TIGR00088 ) tRNA (guanine-N1)-methyltransferase
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( PF02841 ) Guanylate-binding protein, C-terminal domain
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00912290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_245980
WormBaseWBGene000004859.997093137033517e-262locus:che-3 Cytoplasmic dyne
in 2 heavy chain 1 status:Pa
rtially_confirmed UniProt:Q1
9542 protein_id:CAA99830.2
Tetrahymena borealisEI9_10480.19.997093137033517e-262dynein heavy chain family prot
ein (4756 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig14590.0.g699.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17684060: Wood CR, Hard R, Hennessey TM (2007) Targeted gene disruption of dynein heavy chain 7 of Tetrahymena thermophila results in altered ciliary waveform and reduced swim speed. Journal of cell science 120(Pt 17):3075-85
  2. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  3. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  4. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  5. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_00912290(coding)
ATGAGTGATAACGAAAATAATCATCAACAAGATGATAATAATTAAGAATAAGTGGACTAA
AATTAGTCTTAAAATGGTATGGAAACCAATACAAATGGTAATTAGGTAAATGGCAACCAT
GCAAACGGAGAAGAAAATGAAGGCAATAAAGAATAATACGAAGATGTAGAAGAAGAAGTA
GAAGAAAATATTCCTGCAGAAGAGCTTGAAGAGTTGAGAAAAGAAGCTGAAAAGAATGGA
AAAGACCCTTCTGAAGTTCCTTCTGTAAGAGTAGTTACAAAAATGGTAAAGAGATAAGTA
GTTAAATAATAATCTCAAGATAGCAGCCAGCAAGACCAACAAAACAAAAGAGGAGTTTAA
TAAATTTCTTAAGAAACAAGGGAGAAAATAACCTGGGTAATGGAGTAATTGGAAAAAGGT
TTAAATGCATTTGATGAGAAGCTATGGAATGAAGAACTTGACTACCAAATCAGCTAATTT
TTTGGAGATTAATAACACAAGAATATTTATTTCTGGGTAGAAAAAGATGGACTCAAGTAT
AACTTTGTAGATCCTCCTATTTTAACTGAAGAATCTTATGATCCTGATTTTTATTTCTTC
ACTAAATACCAAAATGAACATATTGTCAATTTTGAAGTTGGTAATATTGATGATTTTATC
ACTCATGGGTCAGTTTAATAAAATCACATCTAGAGTCTTCTTAAATTGATGGATGATGTC
TACAATCCTTAAATCTACACTGACACTGCTTGGCCAGAAAATGTCAAGAAGGAGTTCATT
GCCTAACTTCACAAATTTATGGCTACTCTCACCGAGGCTTCCTAATAAAATGAAGGCTAC
ACAAAACTTTATATTCCTAAAGAAGATCTCAGTGATACTTAGGCTACCTCTTTAGATAAA
GATTTAATTTAAAGATTAGAAACTACTTTGATTTATTGGTACAGATAAATTAAAGAAATT
GTTAACAATTAAGACTCCTAACAAGATAATGAAAATGCAGGACCTCAAGATGAAATTATT
TACTGGAGAAGAAGAAAAAATAATTTATAAAATATTTAAAGACAATTGGTTAATCCTGAT
TTACAACGCATCATACAAATATTAAAAATAGTTGATAGTTCTTATGTACCTTCCTTTGAA
GAATTAACTAAAAACATAAACTCAGGATCAGTTGAAGCAGAAAACAACTTAGATTTCTTG
AATTCTCTTTTTGATTCATGCCGTTAACTTGAAAAGGCTACTCCTCGTGAAATTCCATCT
ATTCTACCCTCTCTATTGAACAGAGTTCGTATGATTTGGGAACATTCTGATTATTACAAT
TCATAGGAGCGTATTTCAGGTTTATTGCACAAAATTTCTAACGAAATCATTAAACGTTGC
AAGTCTTAGATCAACATATCTGATATGCTAGACGGAGATGTAGAGAAGTGCATTTAAGAT
CTAAAAGACTCTATTGAGTGTGGTAAAAAATGGAAAAAAATTTATGAACGCACATCTGCC
TTGATAAACAAGAAAAGAAAGGAAAATGCTTCTAAGAGAGCTTGGGATTTCAATCACAAT
TCAATTTTCGCTCAAATGGAAGCCTTTGTTTAAAGATGCTCTGAACTTACTGAAATTTGT
GAAGGTTAATTATAATTCGCTGCAAAAGGATCTAACAGCTAAATTCCTTAATTTGGTGGT
TCAATTGGTCCAGAAATTGAAAATATTTTAGAAGAAATCAAAGAAAGCTTTAAGAAGCAC
ATAGATAAAATTAGAGCAACAGACAAAGACAAAATTTTAGATGTTAAAGCATCTAACTGG
CATGACTTATTCAATATGTTCAAGAATGGCATGAAAGATCTTGATATTATGTATTAAAAT
ATTATCAATACTGGTTTTGAACAAGTCTCCACTGTTTAGCAAGGTGTTGAAATGCTTGAA
GCATTTGATTACTTAGCTAAAAGAGAAAGTATTAAAATGGCTGTCAAAAAGAAAGCCACT
GAAGTCATCAACATGTTCCTATCCGAACTTGATAAAGCTAAATTAGAATATGATAATATG
AAGAAAAATATGCCTCTTTTAAACTTCCCCTTTCACCATGGTAAGTACTCTGGCTAAGCA
ATTTGGGTCAGAGCTTAAATTCACAGAATCCAAAAGATGAAAGACTCTATTGACAGACTC
TTTTTCATTGATGAAGGAACAAAGAGAATTGCATAAGAAAAATATGAAGCCATTCATCTT
ACTTTTAAATAATTTATCATTAATGTTAAGTTCAAAGAGTGGAAAGAAGAAAACAAAGAA
CTTGAAGAAAAGTCTTTGGGACATGAATTCTTGGATAAGCCAGTCCTTTACATGCCTGAA
CCTGACTATCCAGAACTTAAATATAAGGAGAATTTGAGAAGTAAAGAAGGTCACCTTGAG
TCTAAATTTAACAGATAGCTCGAGAAGTTAATGAGCGAAGTAGTGGCTTGGAAGAAATTG
ATTAACTTTGGTATTGTTGTTCCTTCCTACGCAGATGAATTCACTACTTTACATAGAGAA
AACCTCAGAATTCTAAAAGAATACGTCATGCTTGTTGTTAGAGATTAAAATAAAATTATT
GATTACATGGATCCTATGGAAAAGAATCTCTTTAAAGATCACTACTCTTAAACTGAGAAG
GTTATCAAGCCAGGTACCAGCAAGTTGAAATGGAGTTCTAAGGGTATTTTAGAAAATTTT
GTGCGTGATTGTAGAAAGAGCTGTAACGAAATTTACAATAAGTTAAAAATGTTCAAGAGC
AACACTGAGAAGATTGAGTAAAAATGTGTAGAAATCGCCACAAGAATTCTAATTAAAATT
GATAAAAAGCGTACAGTTGAAATTAAATAATTTGAAGAAGATCAAGAAAAGCACAGAAGA
GATATGCAAATTAAAATCAAGATTGCTTTAGATGAAATAAAAAGAATTTTAAGTGAAACA
TATGAGTTCTTCTTGAAAGATGGACCTGAAATTTAAAAAGTCTGGTTCAATTATGTAGCT
ATGATTGATAAAAAGATAGAAGAAGCATTGAAGAAAGCAAATAAGAGCAGTTTATTAGAA
TTGTACAGAGTTATTGGTGATGATAAAAACCCAGCTACTGCTATTTTCAGATTATCTCAA
GAAATAGAAAACGGTTCTCCTGAAAATGGAAAGACTCAACCTGTTTTAGTTTTTAAACCC
TCATAAAATTACTTAAGATAGATGATATAGATAACTATAACCTTAATGACTCAAATAATT
CAAGACTTTAAGAGAATGACTGTCATTATGAACTAGGAAAGAAAAGATAAGCTAGAAGAA
CAACGTATATTAAAAGAAAAGGAAATGAAAAACAATCCTATGATGGCTCAGCGCAAAGGA
CCTGAATAGGGAATCACCTTTGAAGAATAAAATCAGAGAGAAGACTATTTCTCTGCAATT
GCCAGTGATTTAGAAATTAAAAAATATACTGAAAGTATTCTCAGCAATTTGGATAAAACC
ATCCAAAAATTGACATCAGGTGAATTGTATGATCCTTGGAAACAAAAAGAATTCTTCTGG
TAAGGAGATGCTAGCATGAAACACAAATACTCCAAATCCATTTTAGACCATGATGATGAA
ATTTCAAATATCAGAGATCACATTGAAAAATTCGAAATATCTGCCAGTGATATTCAAGCT
CAAAAAACAACTGATAAATTAGATTGCATAGTTATTGATAACACAAATATTAAGAGCACA
ATAGTTGAAGTTCTAATTCAATGGTAGAGTGCTTTGTTGAATGCAGTCTAAGAAAAGGCT
ATTAGTGATTTAAATTCTTTGCATGCTTTGTTCCAAAATAGTGAGGCTCACTTAGAACCC
ACTCCTTTAGATATTCACTAACTTAAGAAGAATATGGAATCACTTGCAAAATTAAAGAAA
GACAAACCTGATATTGGTGATAAATTATAGCCTCTTGAAGAAAAATTCAAGTTGCTTGAA
GATTACCAAATCAACTTAAAGGAAGATGAAATTTACAGAAAGAACACTCTTCGTGATGCT
TGGATCAAGTTCGGAGATATGCTTGAAAGAATGGAAATTCGTAACTAAAAGGTTTATAAT
GATCTTTATCAAGACACCATGAAAAACCTTGATGATTTCATGAAGGAAGTTTCAGATAAT
AAAATTACATTTATGGCAAATGCTCCCTTCTAAGTAGGTAATTTAACAAATGAAAAGGCA
TTCCAAATGCTTAACGAGTATAAAGAAAACGTAAGAGCCTTGAGAGAAAGAGAAAAAGAA
ATGAGATTCGGTTTTGAACTCTTTAATATCAATTATGCTCCTAGCTCTGAGCTAGAAAGC
GTTGAAAAAGAAATAGCTAACTTGCAAGATGTCTGGAAAACTAAAGATGACTGGGATAAA
GAATGGGAAAAGAACAAACATATTAAGTTCCGCGAATTTAATAACGAAGAACTTGATGAT
TTGGCTGATGATTACTAAACCAAAATCAATTCATATCCTAAGGAAATGAAAAAGTGGGAA
GTTGTTAACTCTTTACGTAACAACGTAGAATAATTCAGATAAACTCTTCCTTTAATCAAG
ATGTTAGGCGAAAAGTTCATGCGTTAAAGACATTGGGATAAGCTTTAAAAATATTTACAA
ACTATATTAGATTATGAAAGTGATTCCTTCACTTTATAAGAAATCTTTAAAATTAATTTA
TTAACATATGCTGATTCAGTTCGTGAAGTTTGCGAAGTTGCAAGAGAAGAATATAAAATT
GAGTCTGCTTTAGAAAATATCAAAAACAGATGGTCTCGTCTTGAATTAGTCATGGATGAA
CACAAGAAAGGATACTATAAAGTCAAGAAGGCTGATGATATATTCTCAGCTTTAGAAGAT
GATATGGGTGTGCTTTCAGCATAAAAAACAACCCTGTTCTATGAATCATTCAAAACTGAT
ATTGAACAATGGGAAACTTGTCTTTAAAATATTTTAGAAACCCTCGAAGCTTTACTACAA
GTACAACGTCAATGGATTTATCTTGAGAGTATTTTTGCTTCTCAACAAAATGAACAAGAT
AAATAATTGGTTGGTGATATTGCTAAATTCGGTAAAATTGAAAAGCAACTTTAAAAATAT
ATGGCAGATATTTATGCAACCAAGAATGCAAAACAAGCCTTGAGTTAAGAAGGTTTCTTA
AACGAATTGTTAGAAATGAGCAAAAAGCTTGATGAGAGTCAAAAGATTCTTTTCTAATTG
CTTGAAAGAAACAGAAAGGAATTCCCTAGATTCTATTTCTTGTCTAACGATGATTTGTTT
GAAATTTTAGGTAACTCTAAAGATCCTAGCAAGGTCAACAAACATATCAAAAAGTGCTTT
GAAGGTATTAAAAAGTTGTAAATCAATACTGTTATGGGTTAAAATGTTAAGGGAAGACCT
TAAGAGAATCATGAAGTCATAACCATGGTATCTCCAGATGGTGAAAAGGTTAATTTAAGT
AGCAAGGTAACATGTGAATTTGGTGTTGAGAAATGGTTAAAAACAGTTGAGTAGCGCATG
TTTGAAACATTAAAGAAAGAATTAACCAAAACTCATGCTGGTATTAAAAAGAAAGAAGGT
TATAGATGGGTTGAAAAATGGATTCCAAGCTGGCCTGGTTAGTTGCTGATTGTTGCGTCT
TAACTCCATTGGACTCAGGAATGTGGTGCAGTTTTGCATAATATCAGTAACTCAGAAAAA
TCTGATAAGCACAAGGCTTGGAAGCCAGTTAAGGATGATAAAAATCATTTCCTTGCTGAA
TTAACTAAGTTAGTTAGAAAGCCCTCGACCGAAACAGATAGATTAAAACTTATTGCTTTG
ATTACAATTGAAGTTCACGCTAAAGATATTATTGAATCTTTATAAAAAACTTGTTTCAGT
GACACAGCTTTCGATTGGTTAAAACAATTAAGATTCTACTAAAACATTTAAGGTGACTGT
ATGGAAGTTGAAATCAAATAAACTAATACGAAATTCCCTTACGGTTATGAATACCAAGGC
AATAATGGTAGATTAGTCATTACTGCTTTGACAGATAGATGTTACATGACTTTAACTACT
GCTATGAAACTTAATAAGGGTGGTGCTCCATAAGGACCAGCTGGTACTGGTAAAACTGAA
ACCGTTAAAGATCTTGGTAAAGGTATGGGTAAATTCGTACTTGTCTTTAACTGTTCAGAA
GGTCTTGATTACAAGTCAATAGGCAGAATGTTTTCAGGTCTTATTCAAACAGGTGGTTGG
GGTTGCTTTGATGAGTTTAATAGAATTGAAGTAGAAGTACTTTCTGTCGTTGCTCAATAA
ATGCACTCTATCATGAATGCCTTAAGAAAATTAGGAGAAGACCGCGAACAAAATACTTTT
GAATTCGAAGAAGAAGTTATTTCAATTAATGATTAATGCGCTATTTTTATTACTATGAAT
CCTGGTTATGCTGGTAGATCTGAACTTCCTGATAACTTGAAATCATTGTTCCGTCCTATT
TCTATGATGGTTCCAGAAACAACCATTATTTGTGAAATTATGCTTCAATCAGAAGGTTTT
AAGAATGGTAGACCTTTGTCAATTAAGATGGTTACATTATATAATTTGATGACTCAACAA
TTATCTAAATAAGATCACTACGACTTTGGTCTCAGAGCTATTAAGTCAGTCTTGAACTGC
GCTGGTGCAATTCGTAGAAATGATAGCAACTCTGATTAAGCAGGAAACAGAGACAGAGAA
CGTGAAAAGGAAGCTGAAAGTGAAGAAAACATGAAAGAATAAAAGATTCTTATGAGAGCT
ATTTATGACATGAACATGCCAAAATTCGTTCAAGAAGATATTTTCCTCTTTAACGCTCTT
TTTAATGATCTTTTCCCCAATACTGATCTCCCTGAATCAGAGAACACTAAGCTTTATGAG
GCTATTGAGGCTGAAATGAGAAACGAAAAACTTATACCTAAAGTCGAAATGATCAATAAG
TGCATTTAACTTTATGATTCCAAAAACACTCGTCATGGTAATATGCTTGTCGGTAAATCT
TTATCTGGTAAGACTACAACCTGGAAGATGTTACAAAAAGCAATGAATTCTTTAAACAAA
TAAATGACTTAAGGAGATAAATAAGGCTAAGTTCCTTTCCCTGCTGTAAGAACTGAAGTT
TTGAATCCTAAGACTGTTACTCTTAATGAACTTTTTGGTTTTGTTGACCACTCAACTTTG
GAATGGAATGAAGGTGTTTTATCAAGCATGATGGCTCGTTTGTGTAAAGATGAATCTCTT
GATTAGAGATGGATGATCTTGGATGGACCTGTAGATACTCTTTGGATTGAATCTATGAAT
ACTGTCTTGGATGATAATAAAGTTTTAACTTTATTGAATGGTGATCGTATCAGTTTACCT
TAATAAGTAGGTTTAGTTTTCGAAGTAGAAGATCTCTCTGTTGCTTCTCCTGCTACTGTT
TCTCGTGCTGGTATGATTTATATTGATCCTAATGATTTAGGTTGGAGACCATACATAGAA
GCATGGATTGGCAGAATGAAAGATCCAGATGTTTAAGATTTCTTCTATGATCTTGTTGAT
AAGTGGATTATGAGATTATTCAAAACTCGTTCGATGTGCAAGGAATTGGTACCTTGTTCT
GATATAAATATCGTTATTGCACTTTGCAGGCTTATGGATTCTTTCATCAAGATGGAAAGT
CAAACTATTGGTCTTGAAATCCCTACCAAAAACGAAATCTATTACGCCCTACTTGAAAAG
TGGTTTACTTTCGCTTTGATTTGGTCATTTGGTGCTTCAGTAGATGAAGATGGTCGCAAG
CTAATTGACTATCATATGAGAGATATCGAAAGTATCTTCCCTCACTCTAACACTGTATAT
GATTATTACATTAATGTTGACAAAAATGAATGGGCTTCATGGGAAGATAAGATCAATGCC
AGTGTATGGAAACCAGGCCCTAATATGCCATATCATAAAATGTTAGTCCCAACAGTTGAC
AGTGCAAGAAATAGATTTGTAATTTAGACATTGTTAAAAAATAAAATAAATATTCTTGTT
GTTGGTAATACTGGTACTGGTAAGACTGCTGTTATTAATGGAATTCTTTCAGAATTGGAC
GATTCTTACACTTCCATGAATATTGTTTTCTCTTCCTAGACAAATTCTTTGAAAACTCAA
GATATGATTGAGTCCAAGCTTGTTAGAAGAACTAAATATAAAATGATTCCTGATGGTAAG
AAGATGGTTATATTTGTTGATGATCTCAACATGCCCAGAAAAGACACTTTTGGTAGTCAA
CCTCCTCTTGAACTCTTTAGATAATGGATGGACTACGAAGGCTGGTTCGACAGACAATCT
AGAGATCTCTTTAAATAGATTCTTGATATCTAATTCATAGCAGCTATGGGTCCTCCAGGT
GGTGGTAGAGCTCAAATTTCAAAAAGAACTCAAGGAAAATTCAATCTAATTAACTTCACA
TTCCCTACTGATAACTAAGTGAGAAGAATCTTCTAGTCTATTCTTAACCACAAGTTCCAT
GAATTTGAAGAAGAAATTAAACCTTTAGCAGAACCTGTTGCTTAGGCAACTTTGAACTTG
TTTAGAACTGTTTCTGAAAACTTCCTTCCTACTCCTAAGAAATCTCACTATGTCTTTAAC
TTAAGAGATATTTCCAAGGTTATCTAAGGTGTCTATATGCTTGATAGATTCTATTGTGAT
TCTAAAATGACAATTTTCAGACTTTGGGTGCACGAATGCTTAAGAGTTTTCCATGATAGA
CTTATTTCATTCGAAGACAGATTCTAATTAAAGAAATTGATTTCTGATTAACTTGAATAA
ACCCTTGGATCTAATATGAGAGAATGCACTAATGAAGAAGAGTTGGACACTATCTTTGTT
GATTTTATGGAAGAATCTGGTGGTAAACCTATTTATATTGAAATAGGCTACAAAGATCGT
GCTTAATTAAAGCAAACTGTTGAATAAAAGTTAGATGATTTCAATAAGAATTAAAGATCT
CCTATGCCTATTGTTCTTTTCGAAGAAGCTATTTCTTATGTTTGCAAAATCCACAGAATT
GTAAAATTAGGAAAAGGTCATGGTATGCTTGTTGGTGAAGGTGGTTCAGGTAGACACTCT
CTCACTCGTTTAGCTGCTTTCATCGCTGGCTACTCTCTTTGGTAAATTGAAATATCTAGA
AATTACAGAGTTAAAGAATTTAGAGATGATATTAAGCGTTGGGCTGAAGAAGCAGGTTAC
AAAGGAAAAAGCGGTGTTTTCTTGTTTAGTGATAACTAGATTATTAATGAAGGTTTCATT
GAAGATATCAACAACATTCTAACTGTAGGAGAAATTCCTAATTTGTTCAGTCAAAAGGAT
GACTATCCCCAAATTAAAGAAAAAATGAGAAAAGAATATATTAAGCATCACAATTTAGAA
AAAGACGCTCGTATTTTTGATGAAGATTTGATTGATTTCTTCTTCACTCGTGTCCAAAAT
AACTTCCATCTTATGTTATGTATGAGTAAAACAGGTGATTCACTCCGTAACTACACAAGA
ATGTATCCTGGTTTAGTAAACAATACTACTATCATTTGGTACATGCCTTGGCCTGAAGAG
GCTCTTCTTGAAGTCGCTAATAAATATCTTAAGACTTTAACACTTCAAGACAAAATCAAG
GAAGTTCCTCTTAAGCAAGAGCCTACTCCTGTTCCAGTACCTGAAAAGAAAGATGCTAAA
CCTGATCCAAAGAAGATTGCAGAAGAAGAAGCCAAATTAGCTGAAGAGAAAATAGAAGAA
GAACGTAGAGAAGTTCTTAGAAAGGCAATTGCTACATTCTTTAGTTAAGCCCATACTAAA
GTTTTATAAATGGCTGATGATATGTATGCTACCTTAAAGAGAATGTATTATGTAACTCCT
ACAAATTATATCGAGTTAGTCAAGGGTTATGTAGAATTGCTTGAATAGAAGTAGAAGGAA
TATGGTAATGAAATTACTAAGCTTAGACTTGGTCTCCATAAGCTTGATGAAGCTGGTGAG
AGCTCAGAACTGTTGAAACAATAATTACAAATATCATAAATATAATTATAAAAGAGTTAA
AAGGAAGTAGAAGATCTTATGATTAAGATTGAAGGTGAATCACGTGATGTTAATGAAAAG
CAAAAGTATGTTGAACAAAAAACTGTTCTTGTCGAAAAGGAAAAGGCTGAAATTCTTCGT
ATTTCCGCTGATGCTGAATAAGATCTTCAAGCTGCTATGCCAGCTCTTCGTATGGCCGAA
GAAGGTCTTGCAAATCTCAATAAAAATAAATTGGCAGAAGTAAAATCATTCACTTCACCT
CCTGCAGGTATTGATGTTGTCATGCAAGCTATTATGATTTTGTTATTGAAGGATCCCTCT
TGGGCTAGTGCAAAGAAAGAACTTGCTGCTCCTGATTTCTTATCTAAGTTATAAAATATA
GAAAAAGATAAAATCTCTTAAAAAACTTTACTTAAGATTGAAAAGTTGACTCATGACCCT
AAGATGAGTATTGAAAAGATTCAATAAATTTCCGAAGCCGGTGCGTCTATGTGGCGTTGG
GTTTTGGCTATGGAAATGTATGCAAAAGCATTCAAGGATATTGAACCAAAGAGAATTAAA
GTCAACTAATTGAAAGAAAGATTAGCTAAATCAGAAGAAGAATTACAAAATTTGTAAGAT
AACTTATCGAAATTACAAGAAAAGATTATGATTTTGTAGAAATAACTTGAATAAGCTAAG
ACTGATAAACAAAATTTGGAAGAATAAAATAAGATTCTTTAAGACAAGTAAGAAAGAGCT
GAAAAGCTTATCTCAGGTTTAGAGGGCACCAAGGAAGGTTGGAAAGATAGAAAGATTATC
TTTGAATAAAAGTTTGAATATCTAATTGGTGATTCTCTTATGTCAGCAGCATTTATGTCT
TATGCTGGTCCTTTCCCCTCTGAGTATAGAAGAATCTTCATGAAGGATGCTTTATTAGCT
TAAGTTAGAAACCTTAAAATTTAGCACAGCAGAGATTATAATTTCCCAGACTTCTTAGTC
AAACCCATTACATTCTTAAATTGGACATTTAAGGGTCTTCCTGATGATTAGTTCTCTAAA
GAAAACGCAGTACTTGTTACAAAAAGTAGTAGATTCCCACTTATGATTGACCCACAATAA
TAAGCTAACACTTGGATTAAAAACACAGAAAGAGATTAAGATAGAGAAAAATTGTAGATT
ATTGATCCTTAAACAGAAAACTACATAACCTTGTTGGAGAGAGCTATTTCATGGGGTCAA
GTAGTTATTCTTTAAAACCTTGATGAAGAAATAGATCCTGCTCTTGAACCCATCTTGAAT
AAATCTTTGAAGAAAGTTACTGGTGGTATTTTACTTTGTATAGGTGCAGATAAGGAAATT
AAGTATAATCCAGACTTCAGATTCTATATGACAACTAAATTGGCTAATCCTAAATACAAA
GCTGAAGTAAGTACAAGAGTTACTTTAGTCAACTTTGCTGTCAAAGAAGAAGGTCTCCAA
GATCAATTAATTTCAGTTGTTATCTAAAAAATGGAAGCAAACCTTGAAAAGTAAAAGAAT
GACCTAGTTCGTAAGAAAGCAGACAATGAATCAAAGCTAAAGGATCTTGATGATAAGATT
CTTCGTATGCTCTAAGAAACTAAAGGTTAACTTATTGATGATTTAGATCTTATCAAGGCA
CTCTAAGTCGCCAAAGAAACAGAAGAAGATGTTAGACATTAAATTGAAACTGGTGCTGCT
TAAATGACTAAGACCATGAATTTAAGAAAGAACTACGTAAGTTTGGCAACAACAGCATCA
AAGCTCTTCTTCGTTATAAATGAGTTTGGTCTTATTAATAATATGTATTAGTTCTCTCTT
GAGTCATACATTCAATTGTTCTAGAGAACTATTGATAATTACATTAACAAAGGTGCAGCT
GTTAACGATTCCTTAAATGATAAACTTAACAGTATATCAGAAAAGCACAAAGAAGAAATT
TATAAATATGCTTGCAGAGGTTTGTTTGAAAGTGACAAGCTTCTTCTTTCAATCTAAATG
GCTGTAAGATTATCAACTGATGTTAATCTTGAAGAATTCAATTTCTTCTTGAGAGGTAGT
GACACAGGATAAGATAGAAAGACTCAACCTCCTAATCCCAATCCAGACTGGATTACTCAA
TAATCTTGGGATACCATTTGCGATCTCGATAAGATGGCTAACTTTACAGGTATTATTGGT
GCTTTCACTCATAACTCTAAGGAATGGAAACGTTGGTACATGTCATCCACTCCTGAAAGT
GATGCCTTACCTGGTGAATGGGACACCAAGTGTGATCACTTGCGTAAGCTAATTATTGTA
AAGACTATTCGTCCTGATAGAGTTATTTTCAGTGCTTCTCAATTTGTTGAAAATAAAATT
GGTCCCTAATATATCACTGCTCCCTCTTTCACATTTGAAACTGTTTATGCTGATTCAACT
AAGACCTCACCTGTTATCTTCATTCTTTCTCCTGGTGTTGATCCTTATAACTAATTGTAA
CAATTCGCTGATCAAAAGAACATTTAGCTTGTTCCTGTATCTCTCGGTTAAGGTCAAGCT
CGTAAAGCTCGTGAAAAAGTTGCTGAAGGTTGCAAGAATGGTTACTGGCTCTATCTTGCT
AACTGTCACTTATCACTTAGTTTCCTTAAAGATCTTGAAAAGATTATTGAAAATCTTGAA
TAGAATAGAAGCGATATTCATGATAATTTCAGACTTTGGTTATCATCTTCTCCTCATCCT
AAGTTCCCTATTTCCATTCTTCAAAAATGTGTAAAAGTAACTACTGAGCCATCTAAAGGT
GTTAAATCTAACATGCTTCGTCTTTTTAATAACATGCCCTCTGACAAATATTAAGCTGTT
AGACTTAACAATAAATCATACTACAAAAAATTAGTCTTCTCTCTCTGCTGGTTCCACAGT
ATTATTGTTGAGAGAAAACGTTTCAAATAACTTGGTTGGAATGTTATTTATGACTTTAAT
GACTCAGATTGGGAAACATCTGATAATATTTTGTAGATGTACATTGATTAGTAAGTTCAC
ACTGATAAGTCTGCTCAATAACAAAGCACTTAACCTGGCTCTGGTGAACAGTAAGTTTAG
AACAAATCTCCTCCTTGGGATGCCATTAAATTCTTAATTTCTGATGTAACCTATGGTGGT
AGAGTTACCGATGATTGGGATAGAAGACTGTTGAACGTCTACGCTAATCAATTCTTTAAT
GATAAAGTTATTTTCGATGAAAAATATAAACTCGGTGACCCTTCTTAACAATTCTATTTT
GTCCCTGAAGAATTAAACATTAAGGACTTAAAGAACTTAGAAAAGACTGGCTCAGAACTT
ACTTATTATCGTGGTAAGATTGATGAATTCCCACCAATTGAGCGTCCAGAAACTTTCGGT
TAGCATATTAATGCAGAAATTTCTTCATAAATTATATAATCTAATTCTTTGATTGAATCT
ATTATCTCACTCTCACCACAAATAGCTTCTTCTGCTGGTGTTTCTAAAGAAAGCAAAGTT
GCTAATATTATCAAAGAACTCATGGAAAAATTACCTGAACTTATAGATGTTGATGAAGTT
AAAAGACAAACTAGTGCATATGATGAAGGAAATCCTTTGAGAGTTGTCCTAAATCAAGAA
ATAGATCGTTACAATAAATTGCTAGTTTTCGTCAAACAGTCTCTTATCAATTTGGATAAA
GGTATTCAAGGTATTTAACTCATTTCAGAAGATCTTGAAATCGTTCTTGATAGTCTATTT
GATGGCAGAGTTCCATCCAGCTGGAAATACTGCTATTATTCTCTCAAACCTCTTCAGTCA
TGGATTGAAGATCTTATCAAACGTATTGACCAACTAAGAGTTTGGGGAGAAAAGAATTAA
CAACCAAATGTATTTTGGATTTCTGGTTTATCATTCCCTACAGGTTTCACTACAGCTCTT
CTCTAACAATCAGCAAGAAAGTTAAGAGTTCCTATTGATCAATTTGGCTGGGACTTTAGT
TTCCTTCCTTATGATACTCATGTTAGCACTCCTGCTAAAGAAGGTGCATATATTTCTGGT
TTATACCTTGAAGGTGCCAAATGGGATGGAGACAAAAATTACATTGTTGATGCAGAACCT
ATGAAACTTCACTATTAAATGCCTGTAATTCTCTTTAAGCCAGTCTACTTTGAAGGAAAG
TAAAAGCAAAAGAAGGGTGAATCTAAATATGCATGCCCTACTTATATTTATCCTAACAGA
ACAGGTGTCAGAGAAAAACCTTCTTATATGTTTACTGTTATGCTTCCAATTAAACCTAAC
CCATCTGCTCAAGGTAGCTCAGATTAAGATTTCTGGGTTAAGAGAGGTACAGCTCTTCTT
ATGTCCTTAGCAGACTGA


>TTHERM_00912290(protein)
MSDNENNHQQDDNNQEQVDQNQSQNGMETNTNGNQVNGNHANGEENEGNKEQYEDVEEEV
EENIPAEELEELRKEAEKNGKDPSEVPSVRVVTKMVKRQVVKQQSQDSSQQDQQNKRGVQ
QISQETREKITWVMEQLEKGLNAFDEKLWNEELDYQISQFFGDQQHKNIYFWVEKDGLKY
NFVDPPILTEESYDPDFYFFTKYQNEHIVNFEVGNIDDFITHGSVQQNHIQSLLKLMDDV
YNPQIYTDTAWPENVKKEFIAQLHKFMATLTEASQQNEGYTKLYIPKEDLSDTQATSLDK
DLIQRLETTLIYWYRQIKEIVNNQDSQQDNENAGPQDEIIYWRRRKNNLQNIQRQLVNPD
LQRIIQILKIVDSSYVPSFEELTKNINSGSVEAENNLDFLNSLFDSCRQLEKATPREIPS
ILPSLLNRVRMIWEHSDYYNSQERISGLLHKISNEIIKRCKSQINISDMLDGDVEKCIQD
LKDSIECGKKWKKIYERTSALINKKRKENASKRAWDFNHNSIFAQMEAFVQRCSELTEIC
EGQLQFAAKGSNSQIPQFGGSIGPEIENILEEIKESFKKHIDKIRATDKDKILDVKASNW
HDLFNMFKNGMKDLDIMYQNIINTGFEQVSTVQQGVEMLEAFDYLAKRESIKMAVKKKAT
EVINMFLSELDKAKLEYDNMKKNMPLLNFPFHHGKYSGQAIWVRAQIHRIQKMKDSIDRL
FFIDEGTKRIAQEKYEAIHLTFKQFIINVKFKEWKEENKELEEKSLGHEFLDKPVLYMPE
PDYPELKYKENLRSKEGHLESKFNRQLEKLMSEVVAWKKLINFGIVVPSYADEFTTLHRE
NLRILKEYVMLVVRDQNKIIDYMDPMEKNLFKDHYSQTEKVIKPGTSKLKWSSKGILENF
VRDCRKSCNEIYNKLKMFKSNTEKIEQKCVEIATRILIKIDKKRTVEIKQFEEDQEKHRR
DMQIKIKIALDEIKRILSETYEFFLKDGPEIQKVWFNYVAMIDKKIEEALKKANKSSLLE
LYRVIGDDKNPATAIFRLSQEIENGSPENGKTQPVLVFKPSQNYLRQMIQITITLMTQII
QDFKRMTVIMNQERKDKLEEQRILKEKEMKNNPMMAQRKGPEQGITFEEQNQREDYFSAI
ASDLEIKKYTESILSNLDKTIQKLTSGELYDPWKQKEFFWQGDASMKHKYSKSILDHDDE
ISNIRDHIEKFEISASDIQAQKTTDKLDCIVIDNTNIKSTIVEVLIQWQSALLNAVQEKA
ISDLNSLHALFQNSEAHLEPTPLDIHQLKKNMESLAKLKKDKPDIGDKLQPLEEKFKLLE
DYQINLKEDEIYRKNTLRDAWIKFGDMLERMEIRNQKVYNDLYQDTMKNLDDFMKEVSDN
KITFMANAPFQVGNLTNEKAFQMLNEYKENVRALREREKEMRFGFELFNINYAPSSELES
VEKEIANLQDVWKTKDDWDKEWEKNKHIKFREFNNEELDDLADDYQTKINSYPKEMKKWE
VVNSLRNNVEQFRQTLPLIKMLGEKFMRQRHWDKLQKYLQTILDYESDSFTLQEIFKINL
LTYADSVREVCEVAREEYKIESALENIKNRWSRLELVMDEHKKGYYKVKKADDIFSALED
DMGVLSAQKTTLFYESFKTDIEQWETCLQNILETLEALLQVQRQWIYLESIFASQQNEQD
KQLVGDIAKFGKIEKQLQKYMADIYATKNAKQALSQEGFLNELLEMSKKLDESQKILFQL
LERNRKEFPRFYFLSNDDLFEILGNSKDPSKVNKHIKKCFEGIKKLQINTVMGQNVKGRP
QENHEVITMVSPDGEKVNLSSKVTCEFGVEKWLKTVEQRMFETLKKELTKTHAGIKKKEG
YRWVEKWIPSWPGQLLIVASQLHWTQECGAVLHNISNSEKSDKHKAWKPVKDDKNHFLAE
LTKLVRKPSTETDRLKLIALITIEVHAKDIIESLQKTCFSDTAFDWLKQLRFYQNIQGDC
MEVEIKQTNTKFPYGYEYQGNNGRLVITALTDRCYMTLTTAMKLNKGGAPQGPAGTGKTE
TVKDLGKGMGKFVLVFNCSEGLDYKSIGRMFSGLIQTGGWGCFDEFNRIEVEVLSVVAQQ
MHSIMNALRKLGEDREQNTFEFEEEVISINDQCAIFITMNPGYAGRSELPDNLKSLFRPI
SMMVPETTIICEIMLQSEGFKNGRPLSIKMVTLYNLMTQQLSKQDHYDFGLRAIKSVLNC
AGAIRRNDSNSDQAGNRDREREKEAESEENMKEQKILMRAIYDMNMPKFVQEDIFLFNAL
FNDLFPNTDLPESENTKLYEAIEAEMRNEKLIPKVEMINKCIQLYDSKNTRHGNMLVGKS
LSGKTTTWKMLQKAMNSLNKQMTQGDKQGQVPFPAVRTEVLNPKTVTLNELFGFVDHSTL
EWNEGVLSSMMARLCKDESLDQRWMILDGPVDTLWIESMNTVLDDNKVLTLLNGDRISLP
QQVGLVFEVEDLSVASPATVSRAGMIYIDPNDLGWRPYIEAWIGRMKDPDVQDFFYDLVD
KWIMRLFKTRSMCKELVPCSDINIVIALCRLMDSFIKMESQTIGLEIPTKNEIYYALLEK
WFTFALIWSFGASVDEDGRKLIDYHMRDIESIFPHSNTVYDYYINVDKNEWASWEDKINA
SVWKPGPNMPYHKMLVPTVDSARNRFVIQTLLKNKINILVVGNTGTGKTAVINGILSELD
DSYTSMNIVFSSQTNSLKTQDMIESKLVRRTKYKMIPDGKKMVIFVDDLNMPRKDTFGSQ
PPLELFRQWMDYEGWFDRQSRDLFKQILDIQFIAAMGPPGGGRAQISKRTQGKFNLINFT
FPTDNQVRRIFQSILNHKFHEFEEEIKPLAEPVAQATLNLFRTVSENFLPTPKKSHYVFN
LRDISKVIQGVYMLDRFYCDSKMTIFRLWVHECLRVFHDRLISFEDRFQLKKLISDQLEQ
TLGSNMRECTNEEELDTIFVDFMEESGGKPIYIEIGYKDRAQLKQTVEQKLDDFNKNQRS
PMPIVLFEEAISYVCKIHRIVKLGKGHGMLVGEGGSGRHSLTRLAAFIAGYSLWQIEISR
NYRVKEFRDDIKRWAEEAGYKGKSGVFLFSDNQIINEGFIEDINNILTVGEIPNLFSQKD
DYPQIKEKMRKEYIKHHNLEKDARIFDEDLIDFFFTRVQNNFHLMLCMSKTGDSLRNYTR
MYPGLVNNTTIIWYMPWPEEALLEVANKYLKTLTLQDKIKEVPLKQEPTPVPVPEKKDAK
PDPKKIAEEEAKLAEEKIEEERREVLRKAIATFFSQAHTKVLQMADDMYATLKRMYYVTP
TNYIELVKGYVELLEQKQKEYGNEITKLRLGLHKLDEAGESSELLKQQLQISQIQLQKSQ
KEVEDLMIKIEGESRDVNEKQKYVEQKTVLVEKEKAEILRISADAEQDLQAAMPALRMAE
EGLANLNKNKLAEVKSFTSPPAGIDVVMQAIMILLLKDPSWASAKKELAAPDFLSKLQNI
EKDKISQKTLLKIEKLTHDPKMSIEKIQQISEAGASMWRWVLAMEMYAKAFKDIEPKRIK
VNQLKERLAKSEEELQNLQDNLSKLQEKIMILQKQLEQAKTDKQNLEEQNKILQDKQERA
EKLISGLEGTKEGWKDRKIIFEQKFEYLIGDSLMSAAFMSYAGPFPSEYRRIFMKDALLA
QVRNLKIQHSRDYNFPDFLVKPITFLNWTFKGLPDDQFSKENAVLVTKSSRFPLMIDPQQ
QANTWIKNTERDQDREKLQIIDPQTENYITLLERAISWGQVVILQNLDEEIDPALEPILN
KSLKKVTGGILLCIGADKEIKYNPDFRFYMTTKLANPKYKAEVSTRVTLVNFAVKEEGLQ
DQLISVVIQKMEANLEKQKNDLVRKKADNESKLKDLDDKILRMLQETKGQLIDDLDLIKA
LQVAKETEEDVRHQIETGAAQMTKTMNLRKNYVSLATTASKLFFVINEFGLINNMYQFSL
ESYIQLFQRTIDNYINKGAAVNDSLNDKLNSISEKHKEEIYKYACRGLFESDKLLLSIQM
AVRLSTDVNLEEFNFFLRGSDTGQDRKTQPPNPNPDWITQQSWDTICDLDKMANFTGIIG
AFTHNSKEWKRWYMSSTPESDALPGEWDTKCDHLRKLIIVKTIRPDRVIFSASQFVENKI
GPQYITAPSFTFETVYADSTKTSPVIFILSPGVDPYNQLQQFADQKNIQLVPVSLGQGQA
RKAREKVAEGCKNGYWLYLANCHLSLSFLKDLEKIIENLEQNRSDIHDNFRLWLSSSPHP
KFPISILQKCVKVTTEPSKGVKSNMLRLFNNMPSDKYQAVRLNNKSYYKKLVFSLCWFHS
IIVERKRFKQLGWNVIYDFNDSDWETSDNILQMYIDQQVHTDKSAQQQSTQPGSGEQQVQ
NKSPPWDAIKFLISDVTYGGRVTDDWDRRLLNVYANQFFNDKVIFDEKYKLGDPSQQFYF
VPEELNIKDLKNLEKTGSELTYYRGKIDEFPPIERPETFGQHINAEISSQIIQSNSLIES
IISLSPQIASSAGVSKESKVANIIKELMEKLPELIDVDEVKRQTSAYDEGNPLRVVLNQE
IDRYNKLLVFVKQSLINLDKGIQGIQLISEDLEIVLDSLFDGRVPSSWKYCYYSLKPLQS
WIEDLIKRIDQLRVWGEKNQQPNVFWISGLSFPTGFTTALLQQSARKLRVPIDQFGWDFS
FLPYDTHVSTPAKEGAYISGLYLEGAKWDGDKNYIVDAEPMKLHYQMPVILFKPVYFEGK
QKQKKGESKYACPTYIYPNRTGVREKPSYMFTVMLPIKPNPSAQGSSDQDFWVKRGTALL
MSLAD


>TTHERM_00912290(gene)
ATGAGTGATAACGAAAATAATCATCAACAAGATGATAATAATTAAGAATAAGTGGACTAA
AATTAGTCTTAAAATGGTATGGAAACCAATACAAATGGTAATTAGGTAAATGGCAACCAT
GCAAACGGAGAAGAAAATGAAGGCAATAAAGAATAATACGAAGATGTAGAAGAAGAAGTA
GAAGAAAATATTCCTGCAGAAGAGCTTGAAGAGTTGAGAAAAGAAGCTGAAAAGAATGGA
AAAGACCCTTCTGAAGTTCCTTCTGTAAGAGTAGTTACAAAAATGGTAAAGAGATAAGTA
GTTAAATAATAATCTCAAGATAGCAGCCAGCAAGACCAACAAAACAAAAGAGGAGTTTAA
TAAATTTCTTAAGAAACAAGTAAGATTTTTATATTTTTATATTATAGGTTTATTTTCATT
CAAGTTAAGAAGGTTGTACTATGTTTCTTTTAGTACATTTTTCTTATTTGCGATACATAA
AAGTAATGAAACTAATCAACCGAATATCTTTTAGTCTTATTAGTTGAGCATTATTTAAAT
TTTTATGCAAGCTGGCCAAATATTTGCTTGTTTTAATACAACACATAACCCATACAAATT
GAATGAAAGATAATTGTATTTAATGGTCTTTTAATTGTATTGCTTTATAAATAAAATTAA
TACAAAGTATCAGTAAAAGTACAACTTATATTTGAAAAAATTATAAAACCACTTAATTTT
TAATTTACTTTTTAATATCAATGAAAATAATTATTTCTTAATTCACAATCTTAAATATTA
TCAAATAATTAAAGAAATTCAATCAGTTTAACTTTCAAATAAAAAATTATTAAAAATAAT
TTTAGAATCCATTTAAAAATTTAACTTTCATTATTTTTTTGATCATTTAAATAGTAAAAT
ATTAAAATATATTTTTTAAATAGGGGAGAAAATAACCTGGGTAATGGAGTAATTGGAAAA
AGGTTTAAATGCATTTGATGAGAAGCTATGGAATGAAGAACTTGACTACCAAATCAGCTA
ATTTTTTGGAGATTAATAACACAAGTAATTAATAAATTAATAAAATTTAATAAAAATAAA
AAATAAATTTGTAAATTAGGAATATTTATTTCTGGGTAGAAAAAGATGGACTCAAGTATA
ACTTTGTAGATCCTCCTATTTTAACTGAAGAATCTTATGATCCTGATTTTTATTTCTTCA
CTAAATACCAAAATGAACATATTGTCAATTTTGAAGTTGGTAATATTGATGATTTTATCA
CTCATGGGTCAGTTTAATAAAATCACATCTAGAGTCTTCTTAAATTGATGGATGATGTCT
ACAATCCTTAAATCTACACTGACACTGCTTGGCCAGAAAATGTCAAGAAGGAGTTCATTG
CCTAACTTCACAAAGTAATTAAATTTACTTTTTTTACAACAATTTATTTATTTTATTTAT
ATTTTTCTATTAGTTTATGGCTACTCTCACCGAGGCTTCCTAATAAAATGAAGGCTACAC
AAAACTTTATATTCCTAAAGAAGATCTCAGTGATACTTAGGCTACCTCTTTAGATAAAGA
TTTAATTTAAAGATTAGAAACTACTTTGATTTATTGGTACAGATAAATTAAAGAAATTGT
TAACAATTAAGACTCCTAACAAGATAATGAAAATGCAGGACCTCAAGATGAAATTATTTA
CTGGAGAAGAAGAAAAAATAATTTATAAAATATTTAAAGACAATTGGTTAATCCTGATTT
ACAACGCATCATACAAATATTAAAAATAGTTGATAGTTCTTATGTACCTTCCTTTGAAGA
ATTAACTAAAAACATAAACTCAGGATCAGTTGAAGCAGAAAACAACTTAGATTTCTTGAA
TTCTCTTTTTGATTCATGCCGTTAACTTGAAAAGGCTACTCCTCGTGAAATTCCATCTAT
TCTACCCTCTCTATTGAACAGAGTTCGTATGATTTGGGAACATTCTGATTATTACAATTC
ATAGGAGCGTATTTCAGGTTTATTGCACAAAATTTCTAACGAAATCATTAAACGTTGCAA
GTCTTAGATCAACATATCTGATATGCTAGACGGAGATGTAGAGAAGTGCATTTAAGATCT
AAAAGACTCTATTGAGTGTGGTAAAAAATGGAAAAAAATTTATGAACGCACATCTGCCTT
GATAAACAAGAAAAGAAAGGAAAATGCTTCTAAGAGAGCTTGGGATTTCAATCACAATTC
AATTTTCGCTCAAATGGAAGCCTTTGTTTAAAGATGCTCTGAACTTACTGAAATTTGTGA
AGGTTAATTATAATTCGCTGCAAAAGGATCTAACAGCTAAATTCCTTAATTTGGTGGTAT
CAAATAAATTAACTTATTATATAAATAATATTTTAAAATTTATTATAATTTTCTAAAGGT
TCAATTGGTCCAGAAATTGAAAATATTTTAGAAGAAATCAAAGAAAGCTTTAAGAAGCAC
ATAGATAAAATTAGAGCAACAGACAAAGACAAAATTTTAGATGTTAAAGCATCTAACTGG
CATGACTTATTCAATATGTTCAAGAATGGCATGAAAGATCTTGATATTATGTATTAAAAT
ATTATCAATACTGGTTTTGAACAAGTCTCCACTGTTTAGCAAGGTGTTGAAATGCTTGAA
GCATTTGATTACTTAGCTAAAAGAGAAAGTATTAAAATGGCTGTCAAAAAGAAAGCCACT
GAAGTCATCAACATGTTCCTATCCGAACTTGATAAAGCTAAATTAGAATATGATAATATG
AAGAAAAATATGCCTCTTTTAAACTTCCCCTTTCACCATGGTAAGTACTCTGGCTAAGCA
ATTTGGGTCAGAGCTTAAATTCACAGAATCCAAAAGATGAAAGACTCTATTGACAGACTC
TTTTTCATTGATGAAGGAACAAAGAGAATTGCATAAGAAAAATATGAAGCCATTCATCTT
ACTTTTAAATAATTTATCATTAATGTTAAGTTCAAAGAGTGGAAAGAAGAAAACAAAGTA
ATTTCTTTTTTAAAAATCATTTTTCTTTTGATAATTACTAACAATAATATTTATACTTTT
AATTTAATTTTTTAGGAACTTGAAGAAAAGTCTTTGGGACATGAATTCTTGGATAAGCCA
GTCCTTTACATGCCTGAACCTGACTATCCAGAACTTAAATATAAGGAGAATTTGAGAAGT
AAAGAAGGTCACCTTGAGTCTAAATTTAACAGATAGCTCGAGAAGTTAATGAGCGAAGTA
GTGGCTTGGAAGAAATTGATTAACTTTGGTATTGTTGTTCCTTCCTACGCAGATGAATTC
ACTACTTTACATAGAGAAAACCTCAGAATTCTAAAAGAATACGTCATGCTTGTTGTTAGA
GATTAAAATAAAATTATTGATTACATGGATCCTATGGAAAAGAATCTCTTTAAAGATCAC
TACTCTTAAACTGAGAAGGTTATCAAGCCAGGTACCAGCAAGTTGAAATGGAGTTCTAAG
GGTATTTTAGAAAATTTTGTGCGTGATTGTAGAAAGAGCTGTAACGAAATTTACAATAAG
TTAAAAATGTTCAAGAGCAACACTGAGAAGATTGAGTAAAAATGTGTAGAAATCGCCACA
AGAATTCTAATTAAAATTGATAAAAAGCGTACAGTTGAAATTAAATAATTTGAAGAAGAT
CAAGAAAAGCACAGAAGAGATATGCAAATTAAAATCAAGGTAAATTAATTAACTCCTTAT
ATTATCTTAATATTTATTTTTCTTTTAATTAGATTGCTTTAGATGAAATAAAAAGAATTT
TAAGTGAAACATATGAGTTCTTCTTGAAAGATGGACCTGAAATTTAAAAAGTCTGGTTCA
ATTATGTAGCTATGATTGATAAAAAGATAGAAGAAGCATTGAAGAAAGCAAATAAGAGCA
GTTTATTAGAATTGTACAGAGTTATTGGTGATGATAAAAACCCAGCTACTGCTATTTTCA
GATTATCTCAAGAAATAGAAAACGGTTCTCCTGAAAATGGAAAGACTCAACCTGTTTTAG
TTTTTAAACCCTCATAAAATTACTTAAGATAGATGATATAGATAACTATAACCTTAATGA
CTCAAATAATTCAAGACTTTAAGAGAATGACTGTCATTATGAACTAGGAAAGAAAAGATA
AGCTAGAAGAACAACGTATATTAAAAGAAAAGGAAATGAAAAACAATCCTATGATGGCTC
AGCGCAAAGGACCTGAATAGGGAATCACCTTTGAAGAATAAAATCAGAGAGAAGACTATT
TCTCTGCAATTGCCAGTGATTTAGAAATTAAAAAATATACTGAAAGTATTCTCAGCAATT
TGGATAAAACCATCCAAAAATTGACATCAGGTGAATTGTATGATCCTTGGAAACAAAAAG
AATTCTTCTGGTAAGGAGATGCTAGCATGAAACACAAATACTCCAAATCCATTTTAGACC
ATGATGATGAAATTTCAAATATCAGAGATCACATTGAAAAATTCGAAATATCTGCCAGTG
ATATTCAAGCTCAAAAAACAACTGATAAATTAGATTGCATAGTTATTGATAACACAAATA
TTAAGAGCACAATAGGTAATTTCTTTTAACATACTTTAAATTTAAAAAATACTTGAAAAA
ATAAAATAATATTTTATGAATAAAAATAAATTAAAATTTACTATTTTTAAAACAGTTGAA
GTTCTAATTCAATGGTAGAGTGCTTTGTTGAATGCAGTCTAAGAAAAGGCTATTAGTGAT
TTAAATTCTTTGCATGCTTTGTTCCAAAATAGTGAGGCTCACTTAGAACCCACTCCTTTA
GATATTCACTAACTTAAGAAGAATATGGAATCACTTGCAAAATTAAAGAAAGACAAACCT
GATATTGGTGATAAATTATAGCCTCTTGAAGAAAAATTCAAGTTGCTTGAAGATTACCAA
ATCAACTTAAAGGAAGATGAAATTTACAGAAAGAACACTCTTCGTGATGCTTGGATCAAG
TTCGGAGATATGCTTGAAAGAATGGAAATTCGTAACTAAAAGGTTTATAATGATCTTTAT
CAAGACACCATGAAAAACCTTGATGATTTCATGAAGGAAGTTTCAGATAATAAAGTATAT
TTTTTTTTGGTGTAATTGTTTGAAATTTTAAAGTGTATTTTTAAACTTAATAGATTACAT
TTATGGCAAATGCTCCCTTCTAAGTAGGTAATTTAACAAATGAAAAGGCATTCCAAATGC
TTAACGAGTATAAAGAAAACGTAAGAGCCTTGAGAGAAAGAGAAAAAGAAATGAGATTCG
GTTTTGAACTCTTTAATATCAATTATGCTCCTAGCTCTGAGCTAGAAAGCGTTGAAAAAG
AAATAGCTAACTTGCAAGATGTCTGGAAAACTAAAGATGACTGGGATAAAGAATGGGAAA
AGAACAAACATATTAAGTTCCGCGAATTTAATAACGAAGAACTTGATGATTTGGCTGATG
ATTACTAAACCAAAATCAATTCATATCCTAAGGAAATGAAAAAGTGGGAAGTTGTTAACT
CTTTACGTAACAACGTAGAATAATTCAGATAAACTCTTCCTTTAATCAAGATGTTAGGCG
AAAAGTTCATGCGTTAAAGACATTGGGATAAGCTTTAAAAATATTTACAAACTATATTAG
ATTATGAAAGTGATTCCTTCACTTTATAAGAAATCTTTAAAATTAATTTATTAACATATG
CTGATTCAGTTCGTGAAGGTAATAAAAAATTTATTTTTAAAAATGTTATAAAATATTCAA
ATTTATTAATTATTTAATAGTTTGCGAAGTTGCAAGAGAAGAATATAAAATTGAGTCTGC
TTTAGAAAATATCAAAAACAGATGGTCTCGTCTTGAATTAGTCATGGATGAACACAAGAA
AGGATACTATAAAGTCAAGAAGGCTGATGATATATTCTCAGCTTTAGAAGATGATATGGG
TGTGCTTTCAGCATAAAAAACAACCCTGTTCTATGAATCATTCAAAACTGATATTGAACA
ATGGGAAACTTGTCTTTAAAATATTTTAGAAACCCTCGAAGCTTTACTACAAGTACAACG
TCAATGGATTTATCTTGAGAGTATTTTTGCTTCTCAACAAAATGAACAAGATAAATAATT
GGTTGGTGATATTGCTAAATTCGGTAAAATTGAAAAGCAACTTTAAAAATATATGGCAGA
TATTTATGCAACCAAGAATGCAAAACAAGCGTAATATTCAAATCTATTTATCTATTTAAT
TCATCTAATTTAAAATTTTTTTTATTCAAATAGCTTGAGTTAAGAAGGTTTCTTAAACGA
ATTGTTAGAAATGAGCAAAAAGCTTGATGAGAGTCAAAAGATTCTTTTCTAATTGCTTGA
AAGAAACAGAAAGGAATTCCCTAGATTCTATTTCTTGTCTAACGATGATTTGTTTGAAAT
TTTAGGTAACTCTAAAGATCCTAGCAAGGTCAACAAACATATCAAAAAGTGCTTTGAAGG
TATTAAAAAGTTGTAAATCAATACTGTTATGGGTTAAAATGTTAAGGTAAAATTATCATC
TAAAATACTTTATTAAGATAAATTAATTTAATATTTTATGAAAATATCAGGGAAGACCTT
AAGAGAATCATGAAGTCATAACCATGGTATCTCCAGATGGTGAAAAGGTTAATTTAAGTA
GCAAGGTAACATGTGAATTTGGTGTTGAGAAATGGTTAAAAACAGTTGAGTAGCGCATGT
TTGAAACATTAAAGAAAGAATTAACCAAAACTCATGCTGGTATTAAAAAGAAAGAAGGTT
ATAGATGGGTTGAAAAATGGATTCCAAGCTGGCCTGGTTAGTTGCTGATTGTTGCGTCTT
AACTCCATTGGACTCAGGAATGTGGTGCAGTTTTGCATAATATCAGTAACTCAGAAAAAT
CTGATAAGCACAAGGCTTGGAAGCCAGTTAAGGATGATAAAAATCATTTCCTTGCTGAAT
TAACTAAGTTAGTTAGAAAGCCCTCGACCGAAACAGATAGATTAAAACTTATTGGTAAAA
ATTACATATTTAAATTTTTAATAATAATACTCAATAAAAAATTAATTAAATAAAGCTTTG
ATTACAATTGAAGTTCACGCTAAAGATATTATTGAATCTTTATAAAAAACTTGTTTCAGT
GACACAGCTTTCGATTGGTTAAAACAATTAAGATTCTACTAAAACATTTAAGGTGACTGT
ATGGAAGTTGAAATCAAATAAACTAATACGAAATTCCCTTACGGTTATGAATACCAAGGC
AATAATGGTAGATTAGTCATTACTGCTTTGACAGATAGATGTTACATGACTTTAACTACT
GCTATGAAACTTAATAAGGGTGGTGCTCCATAAGGACCAGCTGGTACTGGTAAAACTGAA
ACCGTTAAAGATCTTGGTAAAGGTATGGGTAAATTCGTACTTGTCTTTAACTGTTCAGAA
GGTCTTGATTACAAGTCAATAGGCAGAATGTTTTCAGGTCTTATTCAAACAGGTAAAAAT
TATTAAACTTATTTTTTATTCTCATTTGTATTTACTGAACAATTGAGGCTGGTTTAACAT
AAAAATATATTTTTTGTTTGTCTTTTAACTTCTTAAAATTAACTAATATTCATTATATAA
TTTTAGGTGGTTGGGGTTGCTTTGATGAGTTTAATAGAATTGAAGTAGAAGTACTTTCTG
TCGTTGCTCAATAAATGCACTCTATCATGAATGCCTTAAGAAAATTAGGAGAAGACCGCG
AACAAAATACTTTTGAATTCGAAGAAGAAGTTATTTCAATTAATGATTAATGCGCTATTT
TTATTACTATGAATCCTGGTTATGCTGGTAGATCTGAACTTCCTGATAACTTGAAATCAT
TGTTCCGTCCTATTTCTATGATGGTTCCAGAAACAACCATTATTTGTGAAATTATGCTTC
AATCAGAAGGTTTTAAGAATGGTAGACCTTTGTCAATTAAGATGGTTACATTATATAATT
TGATGACTCAACAATTATCTAAATAAGATCACTACGACTTTGGTCTCAGAGCTATTAAGT
CAGTCTTGAACTGCGCTGGTGCAATTCGTAGAAATGATAGCAACTCTGATTAAGCAGGAA
ACAGAGACAGAGAACGTGAAAAGGAAGCTGAAAGTGAAGAAAACATGAAAGAATAAAAGA
TTCTTATGAGAGCTATTTATGACATGAACATGCCAAAATTCGTTCAAGAAGATATTTTCC
TCTTTAACGCTCTTTTTAATGATCTTTTCCCCAATACTGATCTCCCTGAATCAGAGAACA
CTAAGCTTTATGAGGCTATTGAGGCTGAAATGAGAAACGAAAAACTTATACCTAAAGTCG
AAATGATCAATAAGTGCATTTAACTTTATGATTCCAAAAACACTCGTCATGGTAATATGC
TTGTCGGTAAATCTTTATCTGGTAAGACTACAACCTGGAAGATGTTACAAAAAGCAATGA
AGTAAATAATAAACAATTTTCTCTAACAATTTATATTTTTTTATCAATCAAGTTAAAATT
TAAAAATATTGACAAAAGTATGAAACTATTTTTAAAATTTTCTTTTATTTTTTAGTATTG
TTTAAATTTAAGCAAAAATTTTATAAAATAGTTCTTTAAACAAATAAATGACTTAAGGAG
ATAAATAAGGCTAAGTTCCTTTCCCTGCTGTAAGAACTGAAGTTTTGAATCCTAAGACTG
TTACTCTTAATGAACTTTTTGGTTTTGTTGACCACTCAACTTTGGAATGGAATGAAGGTG
TTTTATCAAGCATGATGGCTCGTTTGTGTAAAGATGAATCTCTTGATTAGAGATGGATGA
TCTTGGATGGACCTGTAGATACTCTTTGGATTGAATCTATGAATACTGTCTTGGATGATA
ATAAAGTTTTAACTTTATTGAATGGTGATCGTATCAGTTTACCTTAATAAGTAGGTTTAG
TTTTCGAAGTAGAAGATCTCTCTGTTGCTTCTCCTGCTACTGTTTCTCGTGCTGGTATGA
TTTATATTGATCCTAATGATTTAGGTTGGAGACCATACATAGAAGCATGGATTGGCAGAA
TGAAAGATCCAGATGTTTAAGATTTCTTCTATGATCTTGTTGATAAGGTAATTTCTTCAC
TTACATTATTTGCAATATTCAAAACAAAATATTTAATATTATTAAGTGGATTATGAGATT
ATTCAAAACTCGTTCGATGTGCAAGGAATTGGTACCTTGTTCTGATATAAATATCGTTAT
TGCACTTTGCAGGCTTATGGATTCTTTCATCAAGATGGAAAGTCAAACTATTGGTCTTGA
AATCCCTACCAAAAACGAAATCTATTACGCCCTACTTGAAAAGTGGTTTACTTTCGCTTT
GATTTGGTCATTTGGTGCTTCAGTAGATGAAGATGGTCGCAAGCTAATTGACTATCATAT
GAGAGATATCGAAAGTATCTTCCCTCACTCTAACACTGTATATGATTATTACATTAATGT
TGACAAAAATGAATGGGCTTCATGGTAATTATTTTTCATAACTTGTTTTAATTTAATATT
GATAAAATTTAATTCAAATTTTAAAATTAATTAATTTAGGGAAGATAAGATCAATGCCAG
TGTATGGAAACCAGGCCCTAATATGCCATATCATAAAATGTTAGTCCCAACAGTTGACAG
TGCAAGAAATAGATTTGTAATTTAGACATTGTTAAAAAATAAAATAAATATTCTTGTTGT
TGGTAATACTGGTACTGGTAAGACTGCTGTTATTAATGGAATTCTTTCAGAATTGGACGA
TTCTTACACTTCCATGAATATTGTTTTCTCTTCCTAGACAAATTCTTTGAAAACTCAAGA
TATGATTGAGTCCAAGCTTGTTAGAAGAACTAAATATAAAATGATTCCTGATGGTAAGAA
GATGGTTATATTTGTTGATGATCTCAACATGCCCAGAAAAGACACTTTTGGTAGTCAACC
TCCTCTTGAACTCTTTAGATAATGGATGGACTACGAAGGCTGGTTCGACAGACAATCTAG
AGATCTCTTTAAATAGATTCTTGATATCTAATTCATAGCAGCTATGGGTCCTCCAGGTGG
TGGTAGAGCTCAAATTTCAAAAAGAACTCAAGGAAAATTCAATCTAATTAACTTCACATT
CCCTACTGATAACTAAGTGAGAAGAATCTTCTAGTCTATTCTTAACCACAAGTTCCATGA
ATTTGAAGAAGAAATTAAACCTTTAGCAGGTAATTTTCATTTTATTCAGCAATATTTTAG
TTAAAGAAAATAATAATTTTAACTAAAATTTATTTTTGGTGATACTATTATCTCAATAAT
TTTTTAAATTCTCATATACAAATTTATTTTTAAATAATAAATCAGAACCTGTTGCTTAGG
CAACTTTGAACTTGTTTAGAACTGTTTCTGAAAACTTCCTTCCTACTCCTAAGAAATCTC
ACTATGTCTTTAACTTAAGAGATATTTCCAAGGTTATCTAAGGTGTCTATATGCTTGATA
GATTCTATTGTGATTCTAAAATGACAATTTTCAGACTTTGGGTGCACGAATGCTTAAGAG
TTTTCCATGATAGACTTATTTCATTCGAAGACAGATTCTAATTAAAGAAATTGATTTCTG
ATTAACTTGAATAAACCCTTGGATCTAATATGAGAGAATGCACTAATGAAGAAGAGTTGG
ACACTATCTTTGTTGATTTTATGGAAGAATCTGGTGGTAAACCTATTTATATTGAAATAG
GCTACAAAGATCGTGCTTAATTAAAGCAAACTGTTGAATAAAAGTTAGATGATTTCAATA
AGAATTAAAGATCTCCTATGCCTATTGTTCTTTTCGAAGAAGCTATTTCTTATGTTTGCA
AAATCCACAGAATTGTAAAATTAGGAAAAGGTCATGGTATGCTTGTTGGTGAAGGTGGTT
CAGGTAGACACTCTCTCACTCGTTTAGCTGCTTTCATCGCTGGCTACTCTCTTTGGTAAA
TTGAAATATCTAGAAATTACAGAGTTAAAGAATTTAGAGATGATATTAAGCGTTGGGCTG
AAGAAGCAGGTTACAAAGGAAAAGTATGAATTTTATTCATTTATTTATTTTCTTATTTTA
ATTTTTTTTAAAAAATATAGAGCGGTGTTTTCTTGTTTAGTGATAACTAGATTATTAATG
AAGGTTTCATTGAAGATATCAACAACATTCTAACTGTAGGAGAAATTCCTAATTTGTTCA
GTCAAAAGGATGACTATCCCCAAATTAAAGAAAAAATGAGAAAAGAATATATTAAGCATC
ACAATTTAGAAAAAGACGCTCGTATTTTTGATGAAGATTTGATTGATTTCTTCTTCACTC
GTGTCCAAAATAACTTCCATCTTATGTTATGTATGAGTAAAACAGGTGATTCACTCCGTA
ACTACACAAGAATGTATCCTGGTTTAGTAAACAATACTACTATCATTTGGTACATGCCTT
GGCCTGAAGAGGCTCTTCTTGAAGTCGCTAATAAATATCTTAAGACTTTAACACTTCAAG
ACAAAATCAAGGAAGTTCCTCTTAAGCAAGAGCCTGTAATATTTCTTTCAATTAATTTAC
ATTATTTTTTTTTAAATTAATATTTTGTATTTAAAATTGATAATTTAAAAATTTTTTTCT
GTTTAAATCTAATTTATTTAAAAATATATTTGTAATGAAATAGACTCCTGTTCCAGTACC
TGAAAAGAAAGATGCTAAACCTGATCCAAAGAAGATTGCAGAAGAAGAAGCCAAATTAGC
TGAAGAGAAAATAGAAGAAGAACGTAGAGAAGTTCTTAGAAAGGCAATTGCTACATTCTT
TAGTTAAGCCCATACTAAAGTTTTATAAATGGCTGATGATATGTATGCTACCTTAAAGAG
AATGTATTATGTAACTCCTACAAATTATATCGAGTTAGTCAAGGGTTATGTAGAATTGCT
TGAATAGAAGTAGAAGGAATATGGTAATGAAATTACTAAGCTTAGACTTGGTCTCCATAA
GCTTGATGAAGCTGGTGAGAGCTCAGAACTGTTGAAACAATAATTACAAATATCATAAAT
ATAATTATAAAAGAGTTAAAAGGAAGTAGAAGATCTTATGATTAAGATTGAAGGTGAATC
ACGTGATGTTAATGAAAAGCAAAAGTATGTTGAACAAAAAACTGTTCTTGTCGAAAAGGA
AAAGGCTGAAATTCTTCGTATTTCCGCTGATGCTGAATAAGATCTTCAAGCTGCTATGCC
AGCTCTTCGTATGGCCGAAGAAGGTCTTGCAAATCTCAATAAAAATAAATTGGCAGAAGT
AAAATCATTCACTTCACCTCCTGCAGGTATTGATGTTGTCATGCAAGCTATTATGATTTT
GTTATGTAAGCGATTATTATTTTTAACTTCAAATCATTAAATTGAATAAATATTAAAAAA
AATTAGTGAAGGATCCCTCTTGGGCTAGTGCAAAGAAAGAACTTGCTGCTCCTGATTTCT
TATCTAAGTTATAAAATATAGAAAAAGATAAAATCTCTTAAAAAACTTTACTTAAGATTG
AAAAGTTGACTCATGACCCTAAGATGAGTATTGAAAAGATTCAATAAATTTCCGAAGCCG
GTGCGTCTATGTGGCGTTGGGTTTTGGCTATGGAAATGTATGCAAAAGCATTCAAGGATA
TTGAACCAAAGAGAATTAAAGTCAACTAATTGAAAGAAAGATTAGCTAAATCAGAAGAAG
AATTACAAAATTTGTAAGATAACTTATCGAAATTACAAGAAAAGATTATGATTTTGTAGA
AATAACTTGAATAAGCTAAGACTGATAAACAAAATTTGGAAGAATAAAATAAGATTCTTT
AAGACAAGTAAGAAAGAGCTGAAAAGCTTATCTCAGGTTTAGAGGGCACCAAGGAAGGTT
GGAAAGATAGAAAGATTATCTTTGAATAAAAGTTTGAATATCTAATTGGTGATTCTCTTA
TGTCAGCAGCATTTATGTCTTATGCTGGTCCTTTCCCCTCTGAGTATAGAAGAATCTTCA
TGAAGGATGCTTTATTAGCTTAAGTTAGAAACCTTAAAATTTAGCACAGCAGAGATTATA
ATTTCCCAGACTTCTTAGTCAAACCCATTACATTCTTAAATTGGACATTTAAGGGTCTTC
CTGATGATTAGTTCTCTAAAGAAAACGCAGTACTTGTTACAAAAAGTGAAGATTTAATTT
TATAAATGTGTTTATTTATTAAAATTTATTTGAATGATATTTTTAGGTAGTAGATTCCCA
CTTATGATTGACCCACAATAATAAGCTAACACTTGGATTAAAAACACAGAAAGAGATTAA
GATAGAGAAAAATTGTAGATTATTGATCCTTAAACAGAAAACTACATAACCTTGTTGGAG
AGAGCTATTTCATGGGGTCAAGTAGTTATTCTTTAAAACCTTGATGAAGAAATAGATCCT
GCTCTTGAACCCATCTTGAATAAATCTTTGAAGAAAGTTACTGGTGGTATTTTACTTTGT
ATAGGTGCAGATAAGGAAATTAAGTATAATCCAGACTTCAGATTCTATATGACAACTAAA
TTGGCTAATCCTAAATACAAAGCTGAAGTAAGTACAAGAGTTACTTTAGTCAACTTTGCT
GTCAAAGAAGAAGGTCTCCAAGATCAATTAATTTCAGTTGTTATCTAAAAAATGGAAGCA
AACCTTGAAAAGTAAAAGAATGACCTAGTTCGTAAGAAAGCAGACAATGAATCAAAGCTA
AAGGATCTTGATGATAAGATTCTTCGTATGCTCTAAGAAACTAAAGGTTAACTTATTGAT
GATTTAGATCTTATCAAGGCACTCTAAGTCGCCAAAGAAACAGAAGAAGGTAAATATTAC
TTAAAAGTGGTTTCTTTTTTTGTATAAGAAATTTTTTTTTTCTGCTTGAAATTAAAAAAT
AATTAATAAAAAACTCTTGTGTTTTAATAAATTTTATATTTTAATTAATATATCATTTGA
TTTTTTAAAAATTAGATGTTAGACATTAAATTGAAACTGGTGCTGCTTAAATGACTAAGA
CCATGAATTTAAGAAAGAACTACGTAAGTTTGGCAACAACAGCATCAAAGCTCTTCTTCG
TTATAAATGAGTTTGGTCTTATTAATAATATGTATTAGTTCTCTCTTGAGTCATACATTC
AATTGTTCTAGAGAACTATTGATAATTACATTAACAAAGGTGCAGCTGTTAACGATTCCT
TAAATGATAAACTTAACAGTATATCAGAAAAGCACAAAGAAGAAATTTATAAATATGCTT
GCAGAGGTTTGTTTGAAAGTGACAAGCTTCTTCTTTCAATCTAAATGGCTGTAAGATTAT
CAACTGATGTTAATCTTGAAGAATTCAATTTCTTCTTGAGAGGTAGTGACACAGGATAAG
ATAGAAAGACTCAACCTCCTAATCCCAATCCAGACTGGATTACTCAATAATCTTGGGATA
CCATTTGCGATCTCGATAAGATGGCTAACTTTACAGGTAGATAGAAAATATTTTTGATTT
AATTTAATAAATTTCCTCTTTTAATAAAGGTATTATTGGTGCTTTCACTCATAACTCTAA
GGAATGGAAACGTTGGTACATGTCATCCACTCCTGAAAGTGATGCCTTACCTGGTGAATG
GGACACCAAGTGTGATCACTTGCGTAAGCTAATTATTGTAAAGACTATTCGTCCTGATAG
AGTTATTTTCAGTGCTTCTCAATTTGTTGAAAATAAAATTGGTCCCTAATATATCACTGC
TCCCTCTTTCACATTTGAAACTGTTTATGCTGATTCAACTAAGACCTCACCTGTTATCTT
CATTCTTTCTCCTGGTGTTGATCCTTATAACTAATTGTAACAATTCGCTGATCAAAAGAA
CATTTAGCTTGTTCCTGTATCTCTCGGTTAAGGTCAAGCTCGTAAAGCTCGTGAAAAAGT
TGCTGAAGGTTGCAAGAATGGTTACTGGCTCTATCTTGCTAACTGTCACTTATCACTTAG
TTTCCTTAAAGATCTTGAAAAGATTATTGAAAATCTTGAATAGAATAGAAGCGATATTCA
TGATAATTTCAGACTTTGGTTATCATCTTCTCCTCATCCTAAGTTCCCTATTTCCATTCT
TCAAAAATGTGTAAAAGTAACTACTGAGCCATCTAAAGGTGTTAAATCTAACATGCTTCG
TCTTTTTAATAACATGCCCTCTGACAAATATTAAGCTGTTAGACTTAACAATAAATCATA
CTACAAAAAATTAGTCTTCTCTCTCTGCTGGTTCCACAGTGTAATTATTAATATTTCATT
TTTTTTTTTTTTTTCATAAAAACAAAACTCTACAATATTAATTATTGTTTTAGGAAACAA
TTTTATCATCTATAAAATAACCTTTATTGAAAATTACATTTAAAATATTAAATAGATTAT
TGTTGAGAGAAAACGTTTCAAATAACTTGGTTGGAATGTTATTTATGACTTTAATGACTC
AGATTGGGAAACATCTGATAATATTTTGTAGATGTACATTGATTAGTAAGTTCACACTGA
TAAGTCTGCTCAATAACAAAGCACTTAACCTGGCTCTGGTGAACAGTAAGTTTAGAACAA
ATCTCCTCCTTGGGATGCCATTAAGTAAATAACAAATTTTTAATTTAATTCATAAATTTG
AAAAATTGTATTCTTAATCAAATAGATTCTTAATTTCTGATGTAACCTATGGTGGTAGAG
TTACCGATGATTGGGATAGAAGACTGTTGAACGTCTACGCTAATCAATTCTTTAATGATA
AAGTTATTTTCGATGAAAAATATAAACTCGGTGACCCTTCTTAACAATTCTATTTTGTCC
CTGAAGAATTAAACATTAAGGACTTAAAGAACTTAGAAAAGACTGGCTCAGAACTTACTT
ATTATCGTGGTAAGATTGATGAATTCCCACCAATTGAGCGTCCAGAAACTTTCGGTTAGC
ATATTAATGCAGAAATTTCTTCATAAATTATATAATCTAATTCTTTGATTGAATCTATTA
TCTCACTCTCACCACAAATAGCTTCTTCTGCTGGTGTTTCTAAAGAAAGCAAAGTTGCTA
ATATTATCAAAGAACTCATGGAAAAATTACCTGAACTTATAGATGTTGATGAAGTTAAAA
GACAAACTAGTGCATATGATGAAGGAAATCCTTTGAGAGTTGTCCTAAATCAAGAAATAG
ATCGTTACAATAAATTGCTAGTTTTCGTCAAACAGTCTCTTATCAATTTGGATAAAGGTA
TTCAAGGTATTTAACTCATTTCAGAAGATCTTGAAATCGTTCTTGATAGTCTATTTGATG
GCAGAGTTCCATCCAGCTGGAAATACTGCTATTATTCTCTCAAACCTCTTCAGTCATGGA
TTGAAGATCTTATCAAACGTATTGACCAACTAAGAGTTTGGGGAGAAAAGAATTAACAAC
CAAATGTATTTTGGATTTCTGGTTTATCATTCCCTACAGGTTTCACTACAGCTCTTCTCT
AACAATCAGCAAGAAAGTTAAGAGTTCCTATTGATCAATTTGGCTGGGACTTTAGGTAAA
ATTAAAAATAATTTATTAATTCATTTAAAAATTGCTTAAAATTAACTGATTTTTTAATAA
AATATAGTTTCCTTCCTTATGATACTCATGTTAGCACTCCTGCTAAAGAAGGTGCATATA
TTTCTGGTTTATACCTTGAAGGTGCCAAATGGGATGGAGACAAAAATTACATTGTTGATG
CAGAACCTATGAAACTTCACTATTAAATGCCTGTAATTCTCTTTAAGCCAGTCTACTTTG
AAGGAAAGTAAAAGCAAAAGAAGGGTGAATCTAAATATGCATGCCCTACTTATATTTATC
CTAACAGAACAGGTGTCAGAGAAAAACCTTCTTATATGTTTACTGTTATGCTTCCAATTA
AACCTAACCCATCTGCTCAAGGTAGCTCAGATTAAGATTTCTGGGTTAAGAGAGGTACAG
CTCTTCTTATGTCCTTAGCAGACTGA