Identifiers and Description

Gene Model Identifier

TTHERM_00688470

Standard Name

DYH6 (DYnein Heavy chain )

Aliases

PreTt23142 | 105.m00109 | 3737.m00022

Description

Heavy chain subunit of ciliary two-headed inner arm dynein (IAD) complex 1; KO mutants lack reversal response

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF09061 ) Stirrup
  • ( PF03789 ) ELK domain
  • ( PF00617 ) RasGEF domain
  • ( PF05859 ) Mis12 protein
  • ( PF01920 ) Prefoldin subunit
  • ( TIGR01612 ) rhoptry protein
  • ( PF03028 ) Dynein heavy chain
  • ( PF04778 ) LMP repeated region
  • ( PF08671 ) Anti-repressor SinI
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR02640 ) gas vesicle protein GvpN
  • ( PF08112 ) ATP synthase epsilon subunit
  • ( TIGR01420 ) twitching motility protein
  • ( PF05377 ) Flagella accessory protein C (FlaC)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF06658 ) Protein of unknown function (DUF1168)
  • ( PF08424 ) Protein of unknown function (DUF1740)
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( PF01297 ) Periplasmic solute binding protein family
  • ( PF06391 ) CDK-activating kinase assembly factor MAT1
  • ( TIGR00153 ) conserved hypothetical protein TIGR00153
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( TIGR00213 ) D,D-heptose 1,7-bisphosphate phosphatase
  • ( PF05698 ) Bacterial trigger factor protein (TF)
  • ( TIGR00449 ) tRNA-guanine transglycosylases, various specificities
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00688470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_47380
WormBaseWBGene000009629.997093137033517e-262locus:dhc-1 Dynein heavy cha
in, cytoplasmic status:Parti
ally_confirmed UniProt:Q1902
0 protein_id:CCD64267.1
Tetrahymena borealisEI9_16664.19.997093137033517e-262dynein heavy chain family prot
ein (4385 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig19661.0.g1099.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14691947: Deckman CM, Pennock DG (2004) Dephosphorylation of inner arm 1 is associated with ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 57(2):73-83
  2. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  3. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  4. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  5. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_00688470(coding)
ATGGAGAAAGATAAATCAAAATATTAAAACTAAAAAGTTCTAAACTCACTTTCAGCAGTG
ATTAGAAGTGTTTTTATTCCTCTTGAGACTAAATCAAACGATCTCAAGTCAACCTTAGTA
AAATTTACATCATAAATCAATCATTCAGCATAGTAAGTATCAGGGACAATAGATATTGAA
CTCCCTTCTCATAAAGATGATATTAGCGATTCAGAAGCAATTAAAAATGTTGACCTTATG
CTCAAATATGAAACTTTATTGGAATAATGGTCTTAAACAATTAAAGATACTATTAAGAAA
GTTAAGGAATAAAAGCCTGAAAACTCTCACGCCTTAGCAGAAATTGAACTTTAAAGATCT
AAGAGTGCTATCCTTTCAACTTTGCACCAAAAATTGAATGATCCTAAAGTTCAAATAGTA
AAATAAAGATACCGCGATTTCTAGTCTGACAGTGGTAACACTACTATTGTTATGGATTTT
GAAGCTCAAATGAAAGATTTGACTCAATTATACAATGAAGCCAAAGATAACGTTAAATTC
TTAAATACTCTTGAAAGATAATTTAAGATTTTGGCATCTGAAGGGCTTGTTGGTGTAGAG
GAAACTCTACCTTCCTTAATGACTGGTCTTAGAACTATTTGGATTATCTCAAGACATTAT
CAATCAGAAGATAAAATGTAGAATTTACTTTCTTTAATTTCAGATGAAATTGCAGATAAG
GTAGAGAGTGAAATTAAAATTACTGAACTCTTCAAGTTATCTGATGAATTTTCTTCTTAT
GAAACTTAATTGCAGCAATCAATTGAATTAATTGCTTAAGGTAGACGTATCCTAACAACT
TGGAAGACACTTTACAAAAAAACTAAACAAAAAATTGAAGAAGAAGGTCTTGATAGATGG
GATTTCACTGTTCCTGCTTTAAATAACCGTATCGAACACATGGTTGGTGTTTTAACTGAG
CTTGAAGCAAACACTGATATTATAAAGAGCTTCTTAGTATTCTTAGGTCCCAATCTAAAG
GCTGTCACAGGTAATTCTGAAGGTATTGATAACCTTGTTACAGAAGTTAAAAAGCTAGTT
ATTCCCTATCAAAACCCTAAAGTCAATTTATTCCAAAAATAACAATCTCACTAATGGAAT
CAGCTCTCTGCAAAGTTTAAAGCTGATAAAGGCTAGATTAGTGAAAAAACTATTAAATTA
ATTAATGAAACTTTCCGTGATCTTAGATCTGCAGAAGGTGCTTTCGATTTACTCCTTAAA
TTTAAGGACGTTCATACAATTAAAGAAATCCAAGAGTAATTACAAAAGAAATACTCAGAA
GTTTTGTATAGATACGAAAGAGAAGTAGATCAAAACAGATAACTCTTTGAAAATGGTAAA
GCTTTGCTTAAAAATAGTAAAGGATTCTTAGTTATTAGTAAGAATAAACCACCTGTAGCA
GGTTCTATTGCTTGGGCTTTGTCAATTTACTATAGAGTTTAGAGACCTATTATGAAATTC
AAGAAGAAAGAAGGAGAATTAGACAAAGACAGCTATGATAATGTAAAAAAAGATTACTTG
AAATTAGCCAAGGCAATAGACGAATATTAATTGGCAAACTTCAAAGAGTGGAATGAAAAA
ATAAGAGAAAAAGCTATGGGTTTCCTGAAATAAAAAATTCTAGTAAAAAATGAAAGATTT
GAGGTCAACTTTTCTCAAGAATTTAGAGTTCTCATTAAAGAAGCCAAACATTTAGAAAAA
ATGGGATACCCAATCTCTAAAACAATTATTAATATATCTCTCTAAGAAAAAGAATATTAT
ATTTATATCGATAAATTACACAGCATGCTTAATGAATATTATGATGTTGTAGACTCACTT
TCTGAAATTGAAAAAATATTGCTCGATCAGCCCATTTAAAAGCTTAATAAGGAATTAGAT
CCAGGTATTGAAAGTTTGAATCTTTCTTCACTTGGTATTCCAGATTTTATTGATAAGTGT
ACTAAAGCTATCAATGAATTCAAAGAAACTAAAAAGAAAGTAGAAAAAAGTGCTAGCCAC
ATTGAAGAATTCGTTAGAAATATCGAAGAAGCTAAAATTTTCAAAGACTATGACTTTGAA
AGCAGAAAAGATCCTAACTCTAATACTATCAATATTCCAACTGCTAATGAATTTATGACT
TATTTTGATGAAAACATGAATAAAGTTGTTAGTGAATGTGTTGAAAAGTATAATATGATT
GGAGACTAATTTTTAAAGAATATTGAAGAAACAATTATTGGAACTTAAAATGTCTTACAA
GGATATAGCTCATAAAAAATGAAAGAATATTATTACTACTGGGAACGTAGAGTTTACAAT
GCCCTCATTAAGATGATTTTAAGGGCTTTACTTTCCTTAAAAAACCTTATGCAATAACCA
GGAACAAAATCTCTACCTCTATTCTAAATTACCTAAGAGTACGATCACCCTACTCCTAGT
ACTAATCCTCCAACTCCTGAAGTAGAAAGCTATTTAAATAAAATTAAAACTAACATTCTC
TCAACTGCTAGTTAATTCTGGAGATGGAAAGATGGAAGAAGAATCTTTTGTGAGCCTTTG
ATTGGCAATAATGATGAAAAAGTTTAAAGATACACTTTCCTCGATTAAGTAAATGAGAAT
CACGTTATTACTTAAGTTTGTTTCTAAATTGCAGACATACAAAAGAAGGCTTTCAACAAA
GCTACTTCATTTAAAGAAATGTGGGAAGAAGATAAAAGAAAATCCCTTTGGGATCATAAA
GCCAAACTAAATATTGAAAAATTAGTTGAGAAAAAACCATCTACTGTTTAGCTTGAAAGA
AAGATGATGCTTTACAAAAATTTAGTTTTAGAATTCGACGAAATGCTCAAAGAAAGAAAT
GCTCTTTTCATTAGTGTGCATTTTGGAAATGTAATCAATTCGTTTAAGAACTAAGCTAAG
GAATGGCTTGATAAACATGGTAATGTAATGAGAGTCATTGGTGAAAGAGAACTTCAAGAA
ATAAAGAAAGAAATTGAAGAATATCATAAGAAGCTTGATAGCGAACCTAGTCATATTGAA
GAATTAAAAAGAATGCTTAATGAAATTACAGAAATCTTAAACCAATCTATGATTATGGAA
TTTAAGATTTCAGATGTGACTGAAAAGTTCAGAACCTTAAAGCAATATGAATAAAATGTC
GATCCTGAATTAATGGAAGAAGCTTTTACTCTTGGCAAGAAGTGGGATGATTTAGTTAAA
GAAGCTAAGAAAAAAGATAAAAAATTAAAAGAAACAAAAGAAACTTTTGCTAACGTTACA
AAGGATGATGTTGCTCAGTTTAAAGAAACCTTAAAGGAACTATTTTAAGAGTACAAGTCC
TCTGGTCCTGGAGCTTAAGAAACTAACTTAGATGATGGCTTGGAGAGTCTTCAAAAATAC
AAAGAAAAGGTTATTGAATTCAACAAGAGAAAAGATGAACTCGTTCTTGCTGAAAAACTT
TTCAACTTACCTATATCTACTTTCAAAGAACTAGTTATGATTGAAGAAGAAAATAAAAAG
TTAAATATTTTATATGAGACCTACAGAGAATTGAGATCAAACATTAAAGAATGGTCTACA
ATGCTTTGGGCCAAATTAGATGCAGAAATGCTCAGATAAGGCTCTGAAGAATATGAAAAA
AAGAGAAAGAAATTAAATAGATAATATGAAGACAACTGTGTTTTCTAAAAGTTGTCTCAA
AAAATTACAGATTTCAAAAATTCTATTCCACTTATTCAGTAGCTTAAGAGTGGTGCTATT
ACTGATAGACATTGGAATAAATTGATGAAAGAAACTGGAACAAAAATTGAAACTAACATT
AAAACTCTTACTCTTGAACAAGTATTTGCCTTAAATCTATAAAATTTCCCAGAAAAAGTT
AGCGAAATCGTCAACGAAGCAAATCAAGAACATAAAAATGAAGAAGAAATTATGAAGATT
GAGCAAGCTTGGAAGACAGAATCATTCGAACTTGCTATGCAAAAGAAAGGCCGTTGCTAC
ATGTTAAAGAATACTGATTAGATTAAGCTAATTTTAGAAGATCAACAAGCAAATCTCTAA
ACTGTTGCTTCATCTCGTTATGTAGCTGCTTTTGTTAAATAAATTCGTCATTGGGAGCAA
GCATTAAACAGAATTAGTGAAATTATTGATGTTTGGCTTATTGTGCAAAAGAAATGGTAA
TATCTTGAAAGTATTTTTATTGGTTCTGAAGATATCCGTCAATAACTTCGTGAAGAAGCT
AAAAAATTTGATAAAAACGACAAAACATTCATCAAAATTATGGAATAAACTTATAAAAAT
CCAAATATTTACACTTGTTGTGTTACAAATGAAAATCGTCTTATGGAACTTAAAACTCTT
TCTGACGAGCTTGATAAGCGTCAAAAGTCATTATCAGATTATTTAGATACAAAAAGAGGT
ATCTTCCCTCGTTTTTACTTATTGTCAGATGATGATCTTCTTTCTATCCTTGGTAACTCT
GAGCCTGCTGGTGTTTAACCACATATGCTTAAACTTTTTGATAATTGTAAAGAATTGAAG
TTTGGTAAGAGTGGTAAATTAATTACTGGTTTGGAATCTGAAGAACAAGAAAAGTTTGAC
TTGTTTGAACCTTAAAAACCTGAAGGAGCAGTAGAAATTTGGATGAAGCGTGTTGATGAA
GAAATGCAATCTACTCTCCATAAAAAGACTAAAGAAGGAGTATTTACTTATGCTCAAAAA
GAGCGTATTCAATGGGTACTTGAAAACTTGGGAATGATAGCTATTGTAGGTGCTTAAATT
TGGTGGACATGGCGTGTAGAAGATGTTTTCCGTAAAGTAAGAGAAGGCAACAAGCATGCT
ATGAAATAAGAAAATTCAAAACAAACAAAAGACTTGAATGATTTAATTGATTTAGTTAGA
ACTGACTTGAATGATCAAGATAGAAAAAAAGTTAACACCCTTATTATTGTTGATGTCCAT
GCTAGAGATATCGTTTCAAATTTCGTCAGAGATTCCATTTTGGATGCTAGAGAATTTGAA
TGGGAGTCTTAATTAAGATTCTATTGGATACAAAATGAAAATGATATTAGAATTCGTTAA
TGCACTGGTCAGTTTACTTATGGTTATGAATATTAGGGTTTGAATGGACGTTTGGTTATC
ACTCCTCTTACAGATAGATGTGTTATGACTTTAACTACTGCTCTTTCATTTAAGATGGGT
GGTGCTCCTGCTGGTCCAGCAGGTACAGGTAAAACTGAAACTGTAAAAGATCTTGCAAAG
TCTCTGGCCATCAGATGTTGTGTTACTAACTGTGGTGATGGTTTGGATTACAAGGCTATG
GGTTTCATCTTTTCAGGTCTTTGTCAAACAGGTTTCTGGGGTTGCTTCGATGAATTCAAT
AGAATCAATGCTGATGTGCTTTCAGTTGTTGCAGTCTAAATTAAAACTATCTAAACTGCT
TTGGTTTAAGGTAAGAGCACTCTTGAACTCATGAAAAAAGAACTCAATCTTAAAACTACT
ATTGGTATTTTCGTTACAATGAATCCTGGTTATGCAGGTCGTACCGAACTTCCAGATAAC
CTTAAGGCACTTTTCAGACCAGTAACAATGGTTGTTCCCGATACCAATATTATTTGTGAA
ATTATGCTTATGTCTGAAGGTTTTAATGAAGCTAGAATTTTAGCTAAAAAAATGAATGTC
TTATATAAGCTTGCAAAAGAACAACTTTCAAAATAGTACCATTATGATTTTGGTCTAAGA
GCTCTAAAATCAGTCTTGGTCATGGCAGGTGCTCTGAAGAGAGAAGCTTAAGACATGGCT
GAAGAACTCACTTTGATGAGAGCTTTAAGAGATATGAATATGCCTAAATTTATTTTCGAA
GATGTTCCACTTTTCATGGGTTTGATTTCAGATCTTTTCCCTAATATGGATATTAAGAGA
AAACCTTATGAAAAGAAAGATAAAATCATTGAAGTTATGGAAAGTCTTGGATTATAAAAA
GAATTACCTAAGCAGATTGATAAGGTAGTTTAGCTTTTTGAAACAATGTTAACACGTCAT
ACAACTATGGTTGTAGGTCCAACTGGATCAGGTAAATCTACTATCATAGAAATATTAAAA
AAGGTTGAAAGTGTTACTATTTACTGCATGAATCCAAAGGCTATCACTGTAAATGAGCTT
TACGGAACTATGGATATGCAAACAAGAGAATGGAAAGATGGTTTGCTTTCAAAGATTTTC
CGTATTGCTAACGCTGGACCAGGAAATGAGATGCGCTGGATTCTTTTTGATGGTGATGTT
GATGCTGTTTGGGTAGAAAATATGAACTCAGTCATGGATGACAACAAATTGCTAACACTT
ATTAATGGTGATCGTATTCGTTTAGAGCGTTATTGCAAGCTTCTTTTTGAAGTCTACGAT
CTACAGTATGCTTCTCCTGCTACTATTTCTCGTTGCGGTATGGTCTATGTAGATCCAAAA
GATTTAGGATATGCTCCTTACTATGACAAATGGCTCAATAAATGGAGTAAATTTGAGGCT
TTGCATGAAGCATTAGTAGATTTCTTCTAGAAATATATTCCTCCCTTGATTAATCTCATA
TTTGAAGGTATAGAAAACGATGAAGTTACTACTCCCATTCCCTTCTTAATTCCTCGTACA
AACCTCAACTTAGTTGAGCAAATGACTCGTATTATGGATTCTATGCTTAATGAAGATGAA
CCTTAACAAGAAGTAGATATTATTGAACTTATGTACATTTTCTCAATAGTATGGTCCCTA
GGTGCATGCTTAAAAGTAGAAGGAAGAAAGCGTTTCGAAGATTTCCTTCGTGGCATTAGT
GGTCGTGCTCTTCCTGCTACATCTCTTTACGATAACTACTTTGACTATGAAAAATCTAAG
AACTTTATTACATGGGAAAAGCTTGTTTAAGGATATCAACCTCCTATTGATGGTAAATTC
TCAAAGATTTTAGTACCTACAGTTGATACTTAGCGTTTTTCTTTCATCCTTGGATAACAT
ATTAACAGTAAAAAGCCTTGCTTATTCGTTGGTGAATCAGGTACTGCTAAGACTGTTATC
ATTTAAAACTTTTTGAACAACTCTTTGAGTACAGACTCTTATATGAAATTGAATATAAAT
TTCTCATCTCGTACTACTAGTTAGGATCTCTAACGTAACATAGATGATAACATCGATAAA
CGTACAGGTCGTATTTTTGGTCCAAAGAACCCTGGTAAATAATTGGTTGTATTTATTGAT
GATTTGCACATGCCAACAATCGATATTTATGGTACTTAGCAACCTATCGCTCTCCTGAAA
TTCCTTGTTGAAAAAGGCTATATTTACGAGCGTGAAGGAAATCTCGATTAAAAAATTATT
AAAGATATTCTATTTGTTTCTGCCATGCTCCCTCCTGGTGGTGGTACTAATTCTGTTGAC
CCTCGTTTCTTATCCCTTTATTCAACTTTCACTCTTATCTTCCCTTCAACTGAAACCCTG
GAAGTCATTTACTCAAGTATCCTAAAAGCTCATGTTGAATCCTTCCCAGAAGAAATCAAA
GCCTTGGTTAAAAAAATAACTTCTGGAACTCTTTTCCTTTATAGATCTATTGTTGATTAA
CTTCCTCGTACTCCTGTGAAATTCCATTATATTTTCAATCTTCGTGATTTGTCTCGTGTT
TATGAAGGTCTATGTCGCTCTACTATAGATAAATTTAGCGTAAAAGAAGCATTCCTCCGT
TTATGGAGAAATGAATCCATGCGTGTCTTCTAAGATCGTCTTTTAACTGAAGATGATAGA
AATTTAGTTTCTAGACTATTCTAACAAATAGTTAGTGAAAACTTTGCAGAATCATAAGAA
TAAATTCTAAGTGAACCACTCTTAATTGGTGATTACTTATTAGCTGCTCCTGCTGATCCT
GAAGCTGTTGATCCTTAATTATATGAAGAACTAGGAGATTATGAAAGAGTTAAAACTAAA
TTAGAAAGTATGTTATTAGACTATAACGAAACTGAAGGAAACAAAGAAATGAACTTGGTT
CTCTTTAATGATGCCCTTTTCCACATTACAAAAATACATCGTATAGTCAAAATCCCTCGT
GGACATGCTTTATTAGTTGGTTATGGTGGTTCAGGTAAGTAATCACTAACAAAGTTGGCT
TCATTCACTGCTGGTTATTAAATATTTACTATCACTCTTACTCGTGGTTACCGTGAAAGA
GAATTTAGAGATGATCTTAAAAAGCTTTATGAAATTCTTTGTCATGGACCTTGCACTTTC
CTATTTACAGATTCTCATGTTATTGAAGAAGGTTTCTTGGAATTACTAAATAATATGCTT
TCAATTGGTATGGTACCCGCTTTGTTCGATGATGAAGGCAAAAAGTAAATGGGTGATTTA
GTTAGAGAAGAAGCTAAAAAGAAAGGTGTCAATGAAAGCAAGGATGATTTATGGAATTAC
TTCTTAGAAAAAGTAAGAGATAACTTGCATATTATTATGTGTATGTCACCTGCAGGTGAT
ACTTTGAGAATCCGTTGCAGAAATTTCCCAGGTTTAGTTTCAAACACAAGTATAAATTGG
TTCTTCCCTTGGCCAGATGAGGCTCTTCATGCTGTCGCTGTAAATTACCTCGAAGAAGTT
GAGGACATTGGCCAATTCAAAGAAAATATTACTAACCACATCGTCTTAGTACACACAAGT
GTTCAAAAATATTCAGTTGATTTTGAATTATAGCTTAAACGTAAGAATTTCTCTACCCCT
AAAAACTATCTTGATTTCTTGAGTAACTACAAAAAAATGCTTGCCAACAATCGTAAAAAA
TTCAATGATATGATAAAGCGTTATGAGGTTGGTCTTGATAAGCTTGAATAAGCTGCTTAA
CAAGTTAAAAAATTATAAGTAGAACTCCAAAAGAAAGAAGTTGAGGTCACTCATGAGTTT
AATGAAGTTAAACAATTGCTTGACATTATTAAAGAAAAGAAAGAAATTGCAGAAAAGGCT
TAAAATGTTGCAACTGAAAAAAAGAAAGAATTAGATATCGAAACTGTTTAGATTAATGAA
AGTAAGAAAGAAGCTGATAGAATTTTGTAAGAAGCTATTCCTATCTTAGAAGAAGCTCAA
GCAAGTTTAAATAAAATAAAGAAAGAAGAATTAGTTAATATGAAAGCCTTAGCTAATCCT
CCTGCTCCAGTCAAGGCTGTTGCATAATGTTTGTAAATTTTGCGTCCTAATGGAAATGAA
AACGAAGCTGATGGATGGCCTGGTGCTAAAATTATGATGAACGATCCTGGTAGACTTATA
TCAAATCTTTAAGGGTATGATAAGCAAATCCATAAAGTGAAAGATTAACACATCAGTAAG
ATCAATAAGATTACTTCAGATCCTTAAAACAGATTTGCTGAAATCGCAAGTATTTCTTCT
GCTGCAGCAGGTTTGTATGGTTGGGTCAGAAGTACAGTAAACTTGTATGAAGTCCACAAA
AAAGTTAATCCTCTCAAAAAGAGAGTCGAAGAAATGACAATCAAGCAAGTATAACTTTAA
GAAGATTTACAAAAGACAGAATAACTTTTGAGTGAATTAGATGCTTAATTGACTGATTTA
GAATCAAACAGAGAAAAGAAACAAGTGATTTTAGATGATTTAACTCAGGAAGCAAATATT
ATGAGAAGAAGAAAAGATGCTGCTGAAAAACTTATTAATGGTTTAGGAAGAGAAAAGGAA
AGATGGACATAAGATAAAGAAGATTTAAAAATTAAGGTTGTTAAGCTTATTGGAGACTGT
TTATCTTGTTCAAGTTTCCTCTCTTATGCAGGTCCATTCGATTATACTTTCCGTCAAAAA
ATGGTATTTGAACATTGGAGAAAAGATGTTGGAGAGAAATAAATTCCTTGTTCAGACGAA
TTCATCTTAGAAGATCTCTTAACAAGTGAGGTAGAAAAATCTCAATGGGCAAGTGAAAGT
TTACCTGGTGATGAACTTTCTATTTAGAATGGTATTTTAACAACAAGAGCTTCAAGATGG
CCTTTGTGTATAGATCCTTAGTTATAGGCTGTAACTTGGATTAAGAGAAGAGAAGAAAAG
GACACTGGTTTCAGAGTTTTGAACTTAAATGATGGTGCAAATGTTTTCTTGAAACCCTTA
GAAAATTGTATTCGTTTTGGTAAACCTTGTCTTTTCGAAAATGTTGATGAAGAATTGGAT
CCTACTATTGACCCCATTCTAGAAAGAAACTTTATTATTAAAGCTGGTTTAAAGCTTATT
AAACTTGGTGAAAACGAATTCGATTACAATGAGGAATTCAGATTATACTTTACTACTAAG
TTAGCTAATCCCAAATATACTCCTGAAATTATGGGTAAGACAATGGTCATCAACTATACA
GTTACTCGTGACGGTCTTCGTGATTAACTTTTGAATGTCGTTGTAGGATTTGAACGTCCC
GATAAAGAAAAGTAAAGATTAGAGCTTGTTTAATCCATGAGTGAAAATAAAAAGAAATTG
AAAGAAGCAGAAGATGAATTGCTTCAACGTTTATCTGAAGCTAAAGGTTCTTTGTTAGAT
GATGATGAACTCATTCAAACTCTTGAACAGACAAAAACTAAATCTATTGAAATTGCAGAA
GCAATTAAGATTGGTGAGCAAACAAAGATAGAAATCGAAACAGCTTGTAAATAGTATGAA
CCAGCTGCTATGAGAGGTGCAATTCTTTTCTTTGCAATGAGCTCTCTTTCTGCTATCTCT
GAAATGTATGAATACTCACTGGCTTCATATCTATAAGTTTTCAACTAATCCCTTCGTGAT
GCACGTAAAGATAATATCCTTGAAAACAGACTTCGTAATATCATGGATCGTTTAACATTA
AATGTTTACGACTATACCTGTCTTGGTATTTTCGGTCGTCATATTCTTATTTTTGCATTG
TAAATGACACTTATGATCAAAGAAGAAAGAAATTTACTTAACCGTGAAGAGCTTAACTTC
TTCTTAAAGGGTAACACTTCTCTTGAATAAGTTACTAGACCAAAACCATATAAATGGATA
CCAGATCAAGGTTGGAAGGACATGCAAAAGTTAATTACTATTGATAAAGAATATGCAAAC
TTGATCAATGATTTGGAATAAAATGAACAAATTTGGAAGAAGTGGTATGATTTAGAAAAA
CCTGAGTCAGAGCTTCCAAGCAATTATCGTAAGTTAGAACCCTTCTAGACTCTTTTGTTC
TTAAGAGTTTTCCGTTCAGACAGAGTCATTAATGGTGTTAAGAGATTCATTATTGACTAT
TATAACAACAATAACCATTTCGTACAACCTCCAACTGCTAATTTCAATAAAATATTCGAC
TAATCTCACGAGCGTTCTCCTATAGTCTTTATTCTTTCTCCAGGTGCTGATCCATTGAGT
GATGTCTAGAAGCTTGGTGACTAACTAGGTTTTACTGGTAATAAATTCAGATTCCTTTCT
CTTGGTTAAGGTATGGAACAAGAGGCAACACAGTTCGTAGAAACAAGTTCATAAAGAGGT
CATTGGTTAATGCTTATGAATTGCCATTTACTTCCAAACTGGCTTAAAAACACTCTCGAA
AAGCAATTAGAAAATATGCATAAACCTCATAAAGATTTCAGACTTTGGCTTACCACATAA
CCCACCGACAGATTCCCACTTGGTATCCTTCAAAAATCACTTAAAATTGTAACAGAACCA
CCAGATGGTTTAAGACCTAATATGAAGGGTACTCTTTCTAAGATCAACGAAAAAGATTTA
GATTCATGTACTCATGAAGCATTTAAACCCCTCGTTTATGTGGTTTCATTCTTCCACGCT
ATTGTCCAAGATAGAAGAAAGTATGGTAAGATTGGTTGGAATGTTTCTTATGACTTTAAC
GAATCTGACTTTAGAATATCTTTCCACTTGCTTAATCTTTATTTGACAAAGGCTTATGTT
AATAAAGATGAATCTATCCCTTGGAACTCTCTTAAATATTTAATTGGTGAAGCAATGTAT
GGTGGTAGAGTTACTGATGATTTCGATAGAAGAGTTCTTGTTTGTTACTTGGATGAATAT
ATGGGAGACTTCTTATTTGATAAGAATAGAGAATTTTTCTTTGCTAAAGTAGATGATGTC
ACCTACTCCCTACCCAAGTAAATGAATCTTGAAGGTTACATTAATACAGTTAATGAAATT
CCTATTATTAACTCTCCTGCAGTTTTTGGTTTACATCCAAATGCAGAAATTATGTATTAC
ACAAATGCTGCTAAAGATCTATGGGATAATATGCTTACTCTTCAAGTATAGGGAAGTCAT
AGCAGTTCAAGTGATAACAAAGATGAATACATAGATAATATTGCTTCAGATATATTAAGT
AAATTACCTTCAATATGGGATGTCTTCCTCCTCAGAAAAGAAGCTGGAGAGGTCTTGCAA
CCAACTACAGTTGTGTTGTTCTAAGAGTTAGAACGTTTCAATATGTTGATATTAAAGATT
TAGAGCTCTCTTTATAACTTAAAAAGAGCACTTAAGGGTGAAATCGGTATGAGTTCTGAA
TTGGATGAGCTTGCTATTTCACTTTACAATGGTTTCTTACCTTCAATTTGGGCTAAGCTT
GCTCCTTAAACAGAAAAGAAATTAGGTTCTTGGATGGAACATTTCTTGAATCGTGTTAAA
TAGTATAGAGAATGGACTACAAACGGTGAACCTGCAGTTATATGGCTTTCTGGTATCCAT
ATTCCTGAATCTTACTTAACTGCTTTAGTCTAGACAACCTGTAGAGCTAAATAATGGGCT
CTTGATAAGAGTACTCTATACACAGTTGTAACAAACCAAAAATCAGCAGAGCAAATCAAA
AAGAAACCTGAGCATGGCTGTTATGTTCGTGGTTTCTATTTAGAAGGAGCTTAATGGGAT
TTATCTAAAAACTGTCTTAAACGTTAAAATCCTAAAGAACTCATCTTTGAAATGCCACTT
ATTTAGATTATTCCAGTAGAAGCTAATAAACTCAAGCTTAAGGACTCCTTGAACACACCT
GTCTATGTTACTTAAAATAGAAGAAATGCAATGGGTGTAGGTTTAGTCTTTACTGCAAAT
CTTAGAACTGAAGAGCATCCTTCTCATTGGGTACTTCAAGGTGTTTGCTTGGTTCTCAAT
GTAGATTTCTGA


>TTHERM_00688470(protein)
MEKDKSKYQNQKVLNSLSAVIRSVFIPLETKSNDLKSTLVKFTSQINHSAQQVSGTIDIE
LPSHKDDISDSEAIKNVDLMLKYETLLEQWSQTIKDTIKKVKEQKPENSHALAEIELQRS
KSAILSTLHQKLNDPKVQIVKQRYRDFQSDSGNTTIVMDFEAQMKDLTQLYNEAKDNVKF
LNTLERQFKILASEGLVGVEETLPSLMTGLRTIWIISRHYQSEDKMQNLLSLISDEIADK
VESEIKITELFKLSDEFSSYETQLQQSIELIAQGRRILTTWKTLYKKTKQKIEEEGLDRW
DFTVPALNNRIEHMVGVLTELEANTDIIKSFLVFLGPNLKAVTGNSEGIDNLVTEVKKLV
IPYQNPKVNLFQKQQSHQWNQLSAKFKADKGQISEKTIKLINETFRDLRSAEGAFDLLLK
FKDVHTIKEIQEQLQKKYSEVLYRYEREVDQNRQLFENGKALLKNSKGFLVISKNKPPVA
GSIAWALSIYYRVQRPIMKFKKKEGELDKDSYDNVKKDYLKLAKAIDEYQLANFKEWNEK
IREKAMGFLKQKILVKNERFEVNFSQEFRVLIKEAKHLEKMGYPISKTIINISLQEKEYY
IYIDKLHSMLNEYYDVVDSLSEIEKILLDQPIQKLNKELDPGIESLNLSSLGIPDFIDKC
TKAINEFKETKKKVEKSASHIEEFVRNIEEAKIFKDYDFESRKDPNSNTINIPTANEFMT
YFDENMNKVVSECVEKYNMIGDQFLKNIEETIIGTQNVLQGYSSQKMKEYYYYWERRVYN
ALIKMILRALLSLKNLMQQPGTKSLPLFQITQEYDHPTPSTNPPTPEVESYLNKIKTNIL
STASQFWRWKDGRRIFCEPLIGNNDEKVQRYTFLDQVNENHVITQVCFQIADIQKKAFNK
ATSFKEMWEEDKRKSLWDHKAKLNIEKLVEKKPSTVQLERKMMLYKNLVLEFDEMLKERN
ALFISVHFGNVINSFKNQAKEWLDKHGNVMRVIGERELQEIKKEIEEYHKKLDSEPSHIE
ELKRMLNEITEILNQSMIMEFKISDVTEKFRTLKQYEQNVDPELMEEAFTLGKKWDDLVK
EAKKKDKKLKETKETFANVTKDDVAQFKETLKELFQEYKSSGPGAQETNLDDGLESLQKY
KEKVIEFNKRKDELVLAEKLFNLPISTFKELVMIEEENKKLNILYETYRELRSNIKEWST
MLWAKLDAEMLRQGSEEYEKKRKKLNRQYEDNCVFQKLSQKITDFKNSIPLIQQLKSGAI
TDRHWNKLMKETGTKIETNIKTLTLEQVFALNLQNFPEKVSEIVNEANQEHKNEEEIMKI
EQAWKTESFELAMQKKGRCYMLKNTDQIKLILEDQQANLQTVASSRYVAAFVKQIRHWEQ
ALNRISEIIDVWLIVQKKWQYLESIFIGSEDIRQQLREEAKKFDKNDKTFIKIMEQTYKN
PNIYTCCVTNENRLMELKTLSDELDKRQKSLSDYLDTKRGIFPRFYLLSDDDLLSILGNS
EPAGVQPHMLKLFDNCKELKFGKSGKLITGLESEEQEKFDLFEPQKPEGAVEIWMKRVDE
EMQSTLHKKTKEGVFTYAQKERIQWVLENLGMIAIVGAQIWWTWRVEDVFRKVREGNKHA
MKQENSKQTKDLNDLIDLVRTDLNDQDRKKVNTLIIVDVHARDIVSNFVRDSILDAREFE
WESQLRFYWIQNENDIRIRQCTGQFTYGYEYQGLNGRLVITPLTDRCVMTLTTALSFKMG
GAPAGPAGTGKTETVKDLAKSLAIRCCVTNCGDGLDYKAMGFIFSGLCQTGFWGCFDEFN
RINADVLSVVAVQIKTIQTALVQGKSTLELMKKELNLKTTIGIFVTMNPGYAGRTELPDN
LKALFRPVTMVVPDTNIICEIMLMSEGFNEARILAKKMNVLYKLAKEQLSKQYHYDFGLR
ALKSVLVMAGALKREAQDMAEELTLMRALRDMNMPKFIFEDVPLFMGLISDLFPNMDIKR
KPYEKKDKIIEVMESLGLQKELPKQIDKVVQLFETMLTRHTTMVVGPTGSGKSTIIEILK
KVESVTIYCMNPKAITVNELYGTMDMQTREWKDGLLSKIFRIANAGPGNEMRWILFDGDV
DAVWVENMNSVMDDNKLLTLINGDRIRLERYCKLLFEVYDLQYASPATISRCGMVYVDPK
DLGYAPYYDKWLNKWSKFEALHEALVDFFQKYIPPLINLIFEGIENDEVTTPIPFLIPRT
NLNLVEQMTRIMDSMLNEDEPQQEVDIIELMYIFSIVWSLGACLKVEGRKRFEDFLRGIS
GRALPATSLYDNYFDYEKSKNFITWEKLVQGYQPPIDGKFSKILVPTVDTQRFSFILGQH
INSKKPCLFVGESGTAKTVIIQNFLNNSLSTDSYMKLNINFSSRTTSQDLQRNIDDNIDK
RTGRIFGPKNPGKQLVVFIDDLHMPTIDIYGTQQPIALLKFLVEKGYIYEREGNLDQKII
KDILFVSAMLPPGGGTNSVDPRFLSLYSTFTLIFPSTETLEVIYSSILKAHVESFPEEIK
ALVKKITSGTLFLYRSIVDQLPRTPVKFHYIFNLRDLSRVYEGLCRSTIDKFSVKEAFLR
LWRNESMRVFQDRLLTEDDRNLVSRLFQQIVSENFAESQEQILSEPLLIGDYLLAAPADP
EAVDPQLYEELGDYERVKTKLESMLLDYNETEGNKEMNLVLFNDALFHITKIHRIVKIPR
GHALLVGYGGSGKQSLTKLASFTAGYQIFTITLTRGYREREFRDDLKKLYEILCHGPCTF
LFTDSHVIEEGFLELLNNMLSIGMVPALFDDEGKKQMGDLVREEAKKKGVNESKDDLWNY
FLEKVRDNLHIIMCMSPAGDTLRIRCRNFPGLVSNTSINWFFPWPDEALHAVAVNYLEEV
EDIGQFKENITNHIVLVHTSVQKYSVDFELQLKRKNFSTPKNYLDFLSNYKKMLANNRKK
FNDMIKRYEVGLDKLEQAAQQVKKLQVELQKKEVEVTHEFNEVKQLLDIIKEKKEIAEKA
QNVATEKKKELDIETVQINESKKEADRILQEAIPILEEAQASLNKIKKEELVNMKALANP
PAPVKAVAQCLQILRPNGNENEADGWPGAKIMMNDPGRLISNLQGYDKQIHKVKDQHISK
INKITSDPQNRFAEIASISSAAAGLYGWVRSTVNLYEVHKKVNPLKKRVEEMTIKQVQLQ
EDLQKTEQLLSELDAQLTDLESNREKKQVILDDLTQEANIMRRRKDAAEKLINGLGREKE
RWTQDKEDLKIKVVKLIGDCLSCSSFLSYAGPFDYTFRQKMVFEHWRKDVGEKQIPCSDE
FILEDLLTSEVEKSQWASESLPGDELSIQNGILTTRASRWPLCIDPQLQAVTWIKRREEK
DTGFRVLNLNDGANVFLKPLENCIRFGKPCLFENVDEELDPTIDPILERNFIIKAGLKLI
KLGENEFDYNEEFRLYFTTKLANPKYTPEIMGKTMVINYTVTRDGLRDQLLNVVVGFERP
DKEKQRLELVQSMSENKKKLKEAEDELLQRLSEAKGSLLDDDELIQTLEQTKTKSIEIAE
AIKIGEQTKIEIETACKQYEPAAMRGAILFFAMSSLSAISEMYEYSLASYLQVFNQSLRD
ARKDNILENRLRNIMDRLTLNVYDYTCLGIFGRHILIFALQMTLMIKEERNLLNREELNF
FLKGNTSLEQVTRPKPYKWIPDQGWKDMQKLITIDKEYANLINDLEQNEQIWKKWYDLEK
PESELPSNYRKLEPFQTLLFLRVFRSDRVINGVKRFIIDYYNNNNHFVQPPTANFNKIFD
QSHERSPIVFILSPGADPLSDVQKLGDQLGFTGNKFRFLSLGQGMEQEATQFVETSSQRG
HWLMLMNCHLLPNWLKNTLEKQLENMHKPHKDFRLWLTTQPTDRFPLGILQKSLKIVTEP
PDGLRPNMKGTLSKINEKDLDSCTHEAFKPLVYVVSFFHAIVQDRRKYGKIGWNVSYDFN
ESDFRISFHLLNLYLTKAYVNKDESIPWNSLKYLIGEAMYGGRVTDDFDRRVLVCYLDEY
MGDFLFDKNREFFFAKVDDVTYSLPKQMNLEGYINTVNEIPIINSPAVFGLHPNAEIMYY
TNAAKDLWDNMLTLQVQGSHSSSSDNKDEYIDNIASDILSKLPSIWDVFLLRKEAGEVLQ
PTTVVLFQELERFNMLILKIQSSLYNLKRALKGEIGMSSELDELAISLYNGFLPSIWAKL
APQTEKKLGSWMEHFLNRVKQYREWTTNGEPAVIWLSGIHIPESYLTALVQTTCRAKQWA
LDKSTLYTVVTNQKSAEQIKKKPEHGCYVRGFYLEGAQWDLSKNCLKRQNPKELIFEMPL
IQIIPVEANKLKLKDSLNTPVYVTQNRRNAMGVGLVFTANLRTEEHPSHWVLQGVCLVLN
VDF


>TTHERM_00688470(gene)
ATGGAGAAAGATAAATCAAAATATTAAAACTAAAAAGTTCTAAACTCACTTTCAGCAGTG
ATTAGAAGTGTTTTTATTCCTCTTGAGACTAAATCAAACGATCTCAAGTCAACCTTAGTA
AAATTTACATCATAAATCAATCATTCAGCATAGTAAGTATCAGGGACAATAGATATTGAA
CTCCCTTCTCATAAAGATGATATTAGCGATTCAGAAGCAATTAAAAATGTTGACCTTATG
CTCAAATATGAAACTTTATTGGTAATTATTTAAAATTTGTGAAGTTTTTATTAAAAGAAT
CATATAATTTTTTTTTGAATAATGTTGGTTTGATCTCATGAAACTTATTTTTATATTAAA
TTAGGAATAATGGTCTTAAACAATTAAAGATACTATTAAGAAAGTTAAGGAATAAAAGCC
TGAAAACTCTCACGCCTTAGCAGAAATTGAACTTTAAAGATCTAAGAGTGCTATCCTTTC
AACTTTGCACCAAAAATTGAATGATCCTAAAGTTCAAATAGTAAAATAAAGGTATTCATT
TAAAAAAATATCTACCAATTTTTAAATCTTAGAGCATCTATAAAAATAATTTAATTAATA
TAATTTAAAACATAAATTATGAGATTTTTGTAACTTAAAATAATGCTTTATACAAAATTT
TTAATAATATTTTTTTTTAATAAGATACCGCGATTTCTAGTCTGACAGTGGTAACACTAC
TATTGTTATGGATTTTGAAGCTCAAATGAAAGATTTGACTCAATTATACAATGAAGCCAA
AGATAACGTTAAATTCTTAAATACTCTTGAAAGATAATTTAAGATTTTGGCATCTGAAGG
GCTTGTTGGTGTAGAGGAAACTCTACCTTCCTTAATGACTGGTCTTAGAACTATTTGGAT
TATCTCAAGACATTATCAATCAGAAGATAAAATGTAGAATTTACTTTCTTTAATTTCAGA
TGAAATTGCAGATAAGGTAGAGAGTGAAATTAAAATTACTGAACTCTTCAAGTTATCTGA
TGAATTTTCTTCTTATGAAACTTAATTGCAGCAATCAATTGAATTAATTGCTTAAGGTAG
ACGTATCCTAACAACTTGGAAGACACTTTACAAAAAAACTAAACAAAAAATTGAAGAAGA
AGGTCTTGATAGATGGGATTTCACTGTTCCTGCTTTAAATAACCGTATCGAACACATGGT
TGGTGTTTTAACTGAGCTTGAAGCAAACACTGATATTATAAAGAGCTTCTTAGTATTCTT
AGGTCCCAATCTAAAGGCTGTCACAGGTAATTCTGAAGGTATTGATAACCTTGTTACAGA
AGTTAAAAAGCTAGTTATTCCCTATCAAAACCCTAAAGTCAATTTATTCCAAAAATAACA
ATCTCACTAATGGAATCAGCTCTCTGCAAAGTTTAAAGCTGATAAAGGCTAGATTAGTGA
AAAAACTATTAAATTAATTAATGAAACTTTCCGTGATCTTAGATCTGCAGAAGGTGCTTT
CGATTTACTCCTTAAATTTAAGGACGTTCATACAATTAAAGGTAAATTTTAAACCCATTT
AATTTAAATTCATATTTAATAAAATATTTCTTTATCTAAATTATAGAAATCCAAGAGTAA
TTACAAAAGAAATACTCAGAAGTTTTGTATAGATACGAAAGAGAAGTAGATCAAAACAGA
TAACTCTTTGAAAATGGTAAAGCTTTGCTTAAAAATAGTAAAGGATTCTTAGTTATTAGT
AAGAATAAACCACCTGTAGCAGGTTCTATTGCTTGGGCTTTGTCAATTTACTATAGAGTT
TAGAGACCTATTATGAAATTCAAGAAGAAAGAAGGAGAATTAGACAAAGACAGCTATGAT
AATGTAAAAAAAGATTACTTGAAATTAGCCAAGGCAATAGACGAATATTAATTGGCAAAC
TTCAAAGAGTGGAATGAAAAAATAAGAGAAAAAGCTATGGGTTTCCTGAAATAAAAAATT
CTAGTAAAAAATGAAAGATTTGAGGTCAACTTTTCTCAAGAATTTAGAGTTCTCATTAAA
GAAGCCAAACATTTAGAAAAAATGGGATACCCAATCTCTAAAACAATTATTAATATATCT
CTCTAAGAAAAAGAATATTATATTTATATCGATAAATTACACAGCATGCTTAATGAATAT
TATGATGTTGTAGACTCACTTTCTGAAATTGAAAAAATATTGCTCGATCAGCCCATTTAA
AAGCTTAATAAGTAAAAATTTTTTTGATAAATTTTTATTGTTTATATTAATATTTATATT
TAAAAAAAAGGGAATTAGATCCAGGTATTGAAAGTTTGAATCTTTCTTCACTTGGTATTC
CAGATTTTATTGATAAGTGTACTAAAGCTATCAATGAATTCAAAGAAACTAAAAAGAAAG
TAGAAAAAAGTGCTAGCCACATTGAAGAATTCGTTAGAAATATCGAAGAAGCTAAAATTT
TCAAAGACTATGACTTTGAAAGCAGAAAAGATCCTAACTCTAATACTATCAATATTCCAA
CTGCTAATGAATTTATGACTTATTTTGATGAAAACATGAATAAAGTTGTTAGTGAATGTG
TTGAAAAGTATAATATGATTGGAGACTAATTTTTAAAGAATATTGAAGAAACAATTATTG
GAACTTAAAATGTCTTACAAGGATATAGCTCATAAAAAATGAAAGAATATTATTACTACT
GGGAACGTAGAGTTTACAATGCCCTCATTAAGATGATTTTAAGGGCTTTACTTTCCTTAA
AAAACCTTATGCAATAACCAGGAACAAAATCTCTACCTCTATTCTAAATTACCTAAGAGT
ACGATCACCCTACTCCTAGTACTAATCCTCCAACTCCTGAAGTAGAAAGCTATTTAAATA
AAATTAAAACTAACATTCTCTCAACTGCTAGTTAATTCTGGAGATGGAAAGATGGAAGAA
GAATCTTTTGTGAGCCTTTGATTGGCAATAATGATGAAAAAGTTTAAAGATACACTTTCC
TCGATTAAGTAAATGAGAATCACGTTATTACTTAAGTTTGTTTCTAAATTGCAGACATAC
AAAAGAAGGCTTTCAACAAAGCTACTTCATTTAAAGAAATGTGGGAAGAAGATAAAAGAA
AATCCCTTTGGGATCATAAAGCCAAACTAAATATTGAAAAATTAGTTGAGAAAAAACCAT
CTACTGTTTAGCTTGAAAGAAAGATGATGCTTTACAAAAATTTAGTTTTAGAATTCGACG
AAATGCTCAAAGAAAGAAATGCTCTTTTCATTAGTGTGCATTTTGGAAATGTAATCAATT
CGTTTAAGAACTAAGCTAAGGAATGGCTTGATAAACATGGTAATGTAATGAGAGTCATTG
GTGAAAGAGAACTTCAAGAAATAAAGAAAGGTATAAATAAAAATGAAGATATTATTATTT
ATTTAAAATATACATTTTTTTTAAACTTAGAAATTGAAGAATATCATAAGAAGCTTGATA
GCGAACCTAGTCATATTGAAGAATTAAAAAGAATGCTTAATGAAATTACAGAAATCTTAA
ACCAATCTATGATTATGGAATTTAAGATTTCAGATGTGACTGAAAAGTTCAGAACCTTAA
AGCAATATGAATAAAATGTCGATCCTGAATTAATGGAAGAAGCTTTTACTCTTGGCAAGA
AGGTATATTAATAAAAAAGTAATATTATAGAGAATATTAAAATATTTTTAAATTCAAATA
GTGGGATGATTTAGTTAAAGAAGCTAAGAAAAAAGATAAAAAATTAAAAGAAACAAAAGA
AACTTTTGCTAACGTTACAAAGGATGATGTTGCTCAGTTTAAAGAAACCTTAAAGGAACT
ATTTTAAGAGTACAAGTCCTCTGGTCCTGGAGCTTAAGAAACTAACTTAGATGATGGCTT
GGAGAGTCTTCAAAAATACAAAGAAAAGGTTATTGAATTCAACAAGAGAAAAGATGAACT
CGTTCTTGCTGAAAAACTTTTCAACTTACCTATATCTACTTTCAAAGAACTAGTTATGAT
TGAAGAAGAAAATAAAAAGTTAAATATTTTATATGAGACCTACAGAGAATTGAGATCAAA
CATTAAAGAATGGTCTACAATGCTTTGGGCCAAATTAGATGCAGAAATGCTCAGATAAGG
CTCTGAAGAATATGAAAAAAAGAGAAAGAAATTAAATAGATAATATGAAGACAACTGTGT
TTTCTAAAAGTTGTCTCAAAAAATTACAGATTTCAAAAATTCTATTCCACTTATTCAGTA
GCTTAAGAGTGGTGCTATTACTGATAGACATTGGAATAAATTGATGAAAGAAACTGGAAC
AAAAATTGAAACTAACATTAAAACTCTTACTCTTGAACAAGTATTTGCCTTAAATCTATA
AAATTTCCCAGAAAAAGTTAGCGAAATCGTCAACGAAGCAAATCAAGAACATAAAAATGA
AGAAGAAATTATGAAGATTGAGCAAGCTTGGAAGACAGAATCATTCGAACTTGCTATGCA
AAAGAAAGGCCGTTGCTACATGTTAAAGAATACTGATTAGATTAAGCTAATTTTAGAAGA
TCAACAAGCAAATCTCTAAACTGTTGCTTCATCTCGTTATGTAGCTGCTTTTGTTAAATA
AATTCGTCATTGGGAGCAAGCATTAAACAGAATTAGTGAAATTATTGATGTTTGGCTTAT
TGTGCAAAAGAAATGGTAATATCTTGAAAGTATTTTTATTGGTTCTGAAGATATCCGTCA
ATAACTTCGTGAAGAAGCTAAAAAATTTGATAAAAACGACAAAACATTCATCAAAATTAT
GGAATAAACTTATAAAAATCCAAATATTTACACTTGTTGTGTTACAAATGAAAATCGTCT
TATGGAACTTAAAACTCTTTCTGACGAGCTTGATAAGCGTCAAAAGTCATTATCAGATTA
TTTAGATACAAAAAGAGGTATCTTCCCTCGTTTTTACTTATTGTCAGATGATGATCTTCT
TTCTATCCTTGGTAACTCTGAGCCTGCTGGTGTTTAACCACATATGCTTAAACTTTTTGA
TAATTGTAAAGAATTGAAGTTTGGTAAGAGTGGTAAATTAATTACTGGTTTGGAATCTGA
AGAACAAGAAAAGTTTGACTTGTTTGAACCTTAAAAACCTGAAGGAGCAGTAGAAATTTG
GATGAAGCGTGTTGATGAAGAAATGCAATCTACTCTCCATAAAAAGACTAAAGAAGGAGT
ATTTACTTATGCTCAAAAAGAGCGTATTCAATGGGTACTTGAAAACTTGGGAATGATAGC
TATTGTAGGTGCTTAAATTTGGTGGACATGGCGTGTAGAAGATGTTTTCCGTAAAGTAAG
AGAAGGCAACAAGGTATACATTTTATTTATTTATTCTTAGACTTGTGATTTTAACTTTTA
AATAATTTTAATTAAAGCATGCTATGAAATAAGAAAATTCAAAACAAACAAAAGACTTGA
ATGATTTAATTGATTTAGTTAGAACTGACTTGAATGATCAAGATAGAAAAAAAGTTAACA
CCCTTATTATTGTTGATGTCCATGCTAGAGATATCGTTTCAAATTTCGTCAGAGATTCCA
TTTTGGATGCTAGAGAATTTGAATGGGAGTCTTAATTAAGATTCTATTGGATACAAAATG
AAAATGATATTAGAATTCGTTAATGCACTGGTCAGTTTACTTATGGTTATGAATATTAGG
GTTTGAATGGACGTTTGGTTATCACTCCTCTTACAGATAGATGTGTTATGACTTTAACTA
CTGCTCTTTCATTTAAGATGGGTGGTGCTCCTGCTGGTCCAGCAGGTACAGGTAAAACTG
AAACTGTAAAAGATCTTGCAAAGTCTCTGGCCATCAGATGTTGTGTTACTAACTGTGGTG
ATGGTTTGGATTACAAGGCTATGGGTTTCATCTTTTCAGGTCTTTGTCAAACAGGTTTCT
GGGGTTGCTTCGATGAATTCAATAGAATCAATGCTGATGTGCTTTCAGTTGTTGCAGTCT
AAATTAAAACTATCTAAACTGCTTTGGTTTAAGGTAAGAGCACTCTTGAACTCATGAAAA
AAGAACTCAATCTTAAAACTACTATTGGTATTTTCGTTACAATGAATCCTGGTTATGCAG
GTCGTACCGAACTTCCAGATAACCTTAAGGCACTTTTCAGACCAGTAACAATGGTTGTTC
CCGATACCAATATTATTTGTGAAATTATGCTTATGTCTGAAGGTTTTAATGAAGCTAGGT
AATTAATTTTGATATTTTATGTTAAGGATTATTAAACTTTACTTTTTTAATAGAATTTTA
GCTAAAAAAATGAATGTCTTATATAAGCTTGCAAAAGAACAACTTTCAAAATAGTACCAT
TATGATTTTGGTCTAAGAGCTCTAAAATCAGTCTTGGTCATGGCAGGTGCTCTGAAGAGA
GAAGCTTAAGACATGGCTGAAGAACTCACTTTGATGAGAGCTTTAAGAGATATGAATATG
CCTAAATTTATTTTCGAAGATGTTCCACTTTTCATGGGTTTGATTTCAGATCTTTTCCCT
AATATGGATATTAAGAGAAAACCTTATGAAAAGAAAGATAAAATCATTGAAGTTATGGAA
AGTCTTGGATTATAAAAAGAATTACCTAAGCAGATTGATAAGGTAGTTTAGCTTTTTGAA
ACAATGTTAACACGTCATACAACTATGGTTGTAGGTCCAACTGGATCAGGTAAATCTACT
ATCATAGAAATATTAAAAAAGGTTGAAAGTGTTACTATTTACTGCATGAATCCAAAGGCT
ATCACTGTAAATGAGCTTTACGGAACTATGGATATGCAAACAAGAGAATGGAAAGATGGT
TTGCTTTCAAAGATTTTCCGTATTGCTAACGCTGGACCAGGAAATGAGATGCGCTGGATT
CTTTTTGATGGTGATGTTGATGCTGTTTGGGTAGAAAATATGAACTCAGTCATGGATGAC
AACAAATTGCTAACACTTATTAATGGTGATCGTATTCGTTTAGAGCGTTATTGCAAGCTT
CTTTTTGAAGTCTACGATCTACAGTATGCTTCTCCTGCTACTATTTCTCGTTGCGGTATG
GTCTATGTAGATCCAAAAGATTTAGGATATGCTCCTTACTATGACAAATGGCTCAATAAA
TGGAGTAAATTTGAGGCTTTGCATGAAGCATTAGTAGATTTCTTCTAGAAATATATTCCT
CCCTTGATTAATCTCATATTTGAAGGTATAGAAAACGATGAAGTTACTACTCCCATTCCC
TTCTTAATTCCTCGTACAAACCTCAACTTAGTTGAGCAAATGACTCGTATTATGGATTCT
ATGCTTAATGAAGATGAACCTTAACAAGAAGTAGATATTATTGAACTTATGTACATTTTC
TCAATAGTATGGTCCCTAGGTGCATGCTTAAAAGTAGAAGGAAGAAAGCGTTTCGAAGAT
TTCCTTCGTGGCATTAGTGGTCGTGCTCTTCCTGCTACATCTCTTTACGATAACTACTTT
GACTATGAAAAATCTAAGAACTTTATTACATGGGAAAAGCTTGTTTAAGGATATCAACCT
CCTATTGATGGTAAATTCTCAAAGATTTTAGTACCTACAGTTGATACTTAGCGTTTTTCT
TTCATCCTTGGATAACATATTAACAGTAAAAAGCCTTGCTTATTCGTTGGTGAATCAGGT
ACTGCTAAGACTGTTATCATTTAAAACTTTTTGAACAACTCTTTGAGTACAGACTCTTAT
ATGAAATTGAATATAAATTTCTCATCTCGTACTACTAGTTAGGATCTCTAACGTAACATA
GATGATAACATCGATAAACGTACAGGTCGTATTTTTGGTCCAAAGAACCCTGGTAAATAA
TTGGTTGTATTTATTGATGATTTGCACATGCCAACAATCGATATTTATGGTACTTAGCAA
CCTATCGCTCTCCTGAAATTCCTTGTTGAAAAAGGCTATATTTACGAGCGTGAAGGAAAT
CTCGATTAAAAAATTATTAAAGATATTCTATTTGTTTCTGCCATGCTCCCTCCTGGTGGT
GGTACTAATTCTGTTGACCCTCGTTTCTTATCCCTTTATTCAACTTTCACTCTTATCTTC
CCTTCAACTGAAACCCTGGAAGTCATTTACTCAAGTATCCTAAAAGCTCATGTTGAATCC
TTCCCAGAAGAAATCAAAGCCTTGGTTAAAAAAATAACTTCTGGAACTCTTTTCCTTTAT
AGATCTATTGTTGATTAACTTCCTCGTACTCCTGTGAAATTCCATTATATTTTCAATCTT
CGTGATTTGTCTCGTGTTTATGAAGGTCTATGTCGCTCTACTATAGATAAATTTAGCGTA
AAAGAAGCATTCCTCCGTTTATGGAGAAATGAATCCATGCGTGTCTTCTAAGATCGTCTT
TTAACTGAAGATGATAGAAATTTAGTTTCTAGACTATTCTAACAAATAGTTAGTGAAAAC
TTTGCAGAATCATAAGAATAAATTCTAAGTGAACCACTCTTAATTGGTGATTACTTATTA
GCTGCTCCTGCTGATCCTGAAGCTGTTGATCCTTAATTATATGAAGAACTAGGAGATTAT
GAAAGAGTTAAAACTAAATTAGAAAGTATGTTATTAGACTATAACGAAACTGAAGGAAAC
AAAGAAATGAACTTGGTTCTCTTTAATGATGCCCTTTTCCACATTACAAAAATACATCGT
ATAGTCAAAATCCCTCGTGGACATGCTTTATTAGTTGGTTATGGTGGTTCAGGTAAGTAA
TCACTAACAAAGTTGGCTTCATTCACTGCTGGTTATTAAATATTTACTATCACTCTTACT
CGTGGTTACCGTGAAAGAGAATTTAGAGATGATCTTAAAAAGCTTTATGAAATTCTTTGT
CATGGACCTTGCACTTTCCTATTTACAGATTCTCATGTTATTGAAGAAGGTATTTTCATA
TTTGTAAATTATATATTTATAATAAATTAAAATTATAGGTTTCTTGGAATTACTAAATAA
TATGCTTTCAATTGGTATGGTACCCGCTTTGTTCGATGATGAAGGCAAAAAGTAAATGGG
TGATTTAGTTAGAGAAGAAGCTAAAAAGAAAGGTGTCAATGAAAGCAAGGATGATTTATG
GAATTACTTCTTAGAAAAAGTAAGAGATAACTTGCATATTATTATGTGTATGTCACCTGC
AGGTGATACTTTGAGAATCCGTTGCAGAAATTTCCCAGGTTTAGTTTCAAACACAAGTAT
AAATTGGTTCTTCCCTTGGCCAGATGAGGCTCTTCATGCTGTCGCTGTAAATTACCTCGA
AGAAGTTGAGGACATTGGCCAATTCAAAGAAAATATTACTAACCACATCGTCTTAGTACA
CACAAGTGTTCAAAAATATTCAGTTGATTTTGAATTATAGCTTAAACGTAAGAATTTCTC
TACCCCTAAAAACTATCTTGATTTCTTGAGTAACTACAAAAAAATGCTTGCCAACAATCG
TAAAAAATTCAATGATATGATAAAGCGTTATGAGGTTGGTCTTGATAAGCTTGAATAAGC
TGCTTAACAAGTTAAAAAATTATAAGTAGAACTCCAAAAGAAAGAAGTTGAGGTCACTCA
TGAGTTTAATGAAGTTAAACAATTGCTTGACATTATTAAAGAAAAGAAAGAAATTGCAGA
AAAGGCTTAAAATGTTGCAACTGAAAAAAAGAAAGAATTAGATATCGAAACTGTTTAGAT
TAATGAAAGTAAGAAAGAAGCTGATAGAATTTTGTAAGAAGCTATTCCTATCTTAGAAGA
AGCTCAAGCAAGTTTAAATAAAATAAAGAAAGAAGAATTAGTTAATATGAAAGCCTTAGC
TAATCCTCCTGCTCCAGTCAAGGCTGTTGCATAATGTTTGTAAATTTTGCGTCCTAATGG
AAATGAAAACGAAGCTGATGGATGGCCTGGTGCTAAAATTATGATGAACGATCCTGGTAG
ACTTATATCAAATCTTTAAGGGTATGATAAGCAAATCCATAAAGTGAAAGATTAACACAT
CAGTAAGATCAATAAGATTACTTCAGATCCTTAAAACAGATTTGCTGAAATCGCAAGTAT
TTCTTCTGCTGCAGCAGGTTTGTATGGTTGGGTCAGAAGTACAGTAAACTTGTATGAAGT
CCACAAAAAAGTTAATCCTCTCAAAAAGAGAGTCGAAGAAATGACAATCAAGCAAGTATA
ACTTTAAGAAGATTTACAAAAGACAGAATAACTTTTGAGTGAATTAGATGCTTAATTGAC
TGATTTAGAATCAAACAGAGAAAAGAAACAAGTAATTTATAATAAATTTCAATAAACAGA
TAAATAAGCGAATTATAATTTTTAATTTATTAAAGGTGATTTTAGATGATTTAACTCAGG
AAGCAAATATTATGAGAAGAAGAAAAGATGCTGCTGAAAAACTTATTAATGGTTTAGGAA
GAGAAAAGGAAAGATGGACATAAGATAAAGAAGATTTAAAAATTAAGGTTGTTAAGCTTA
TTGGAGACTGTTTATCTTGTTCAAGTTTCCTCTCTTATGCAGGTCCATTCGATTATACTT
TCCGTCAAAAAATGGTATTTGAACATTGGAGAAAAGATGTTGGAGAGAAATAAATTCCTT
GTTCAGACGAATTCATCTTAGAAGATCTCTTAACAAGTGAGGTAGAAAAATCTCAATGGG
CAAGTGAAAGTTTACCTGGTGATGAACTTTCTATTTAGAATGGTATTTTAACAACAAGAG
CTTCAAGATGGCCTTTGTGTATAGATCCTTAGTTATAGGCTGTAACTTGGATTAAGAGAA
GAGAAGAAAAGGACACTGGTTTCAGAGTAATTTTTATATCAAAAAAAAATTAGTTAATTT
CTATTTATTTCTTTATTAGGTTTTGAACTTAAATGATGGTGCAAATGTTTTCTTGAAACC
CTTAGAAAATTGTATTCGTTTTGGTAAACCTTGTCTTTTCGAAAATGTTGATGAAGAATT
GGATCCTACTATTGACCCCATTCTAGAAAGAAACTTTATTATTAAAGCTGGTTTAAAGCT
TATTAAACTTGGTGAAAACGAATTCGATTACAATGAGGAATTCAGATTATACTTTACTAC
TAAGTTAGCTAATCCCAAATATACTCCTGAAATTATGGGTAAGACAATGGTCATCAACTA
TACAGTTACTCGTGACGGTCTTCGTGATTAACTTTTGAATGTCGTTGTAGGATTTGAACG
TCCCGATAAAGAAAAGTAAAGATTAGAGCTTGTTTAATCCATGAGTGAAAATAAAAAGAA
ATTGAAAGAAGCAGAAGATGAATTGCTTCAACGTTTATCTGAAGCTAAAGGTTCTTTGTT
AGATGATGATGAACTCATTCAAACTCTTGAACAGACAAAAACTAAATCTATTGAAATTGC
AGAAGCAATTAAGATTGGTGAGCAAACAAAGATAGAAATCGAAACAGCTTGTAAATAGTA
TGAACCAGCTGCTATGAGAGGTGCAATTCTTTTCTTTGCAATGAGCTCTCTTTCTGCTAT
CTCTGAAATGTATGAATACTCACTGGCTTCATATCTATAAGTTTTCAACTAATCCCTTCG
TGATGCACGTAAAGATAATATCCTTGAAAACAGACTTCGTAATATCATGGATCGTTTAAC
ATTAAATGTTTACGACTATACCTGTCTTGGTATTTTCGGTCGTCATATTCTTATTTTTGC
ATTGTAAATGACACTTATGATCAAAGAAGAAAGAAATTTACTTAACCGTGAAGAGCTTAA
CTTCTTCTTAAAGGGTAACACTTCTCTTGAATAAGTTACTAGACCAAAACCATATAAATG
GATACCAGATCAAGGTTGGAAGGACATGCAAAAGTTAATTACTATTGATAAAGAATATGC
AAACTTGATCAATGATTTGGAATAAAATGAAGTAAATTTTTTTATCTTTATTAAATTTTA
TATTTCAACTAAAATTTAAAATATTAGCAAATTTGGAAGAAGTGGTATGATTTAGAAAAA
CCTGAGTCAGAGCTTCCAAGCAATTATCGTAAGTTAGAACCCTTCTAGACTCTTTTGTTC
TTAAGAGTTTTCCGTTCAGACAGAGTCATTAATGGTGTTAAGAGATTCATTATTGACTAT
TATAACAACAATAACCATTTCGTACAACCTCCAACTGCTAATTTCAATAAAATATTCGAC
TAATCTCACGAGCGTTCTCCTATAGTCTTTATTCTTTCTCCAGGTGCTGATCCATTGAGT
GATGTCTAGAAGCTTGGTGACTAACTAGGTTTTACTGGTAATAAATTCAGATTCCTTTCT
CTTGGTTAAGGTATGGAACAAGAGGCAACACAGTTCGTAGAAACAAGTTCATAAAGAGGT
CATTGGTTAATGCTTATGAATTGCCATTTACTTCCAAACTGGCTTAAAAGTAAAACGTTT
ATTTATTCTTTTTACTAATTTACTAAAAATATTTTATTGAAAAAGACACTCTCGAAAAGC
AATTAGAAAATATGCATAAACCTCATAAAGATTTCAGACTTTGGCTTACCACATAACCCA
CCGACAGATTCCCACTTGGTATCCTTCAAAAATCACTTAAAATTGTAACAGAACCACCAG
ATGGTTTAAGACCTAATATGAAGGGTACTCTTTCTAAGATCAACGAAAAAGATTTAGATT
CATGTACTCATGAAGCATTTAAGTAATTAATATTCGAATTCATTCATTTAATTTTTATTT
ATACTATTAATTTTATAAAATAGACCCCTCGTTTATGTGGTTTCATTCTTCCACGCTATT
GTCCAAGATAGAAGAAAGTATGGTAAGATTGGTTGGAATGTTTCTTATGACTTTAACGAA
TCTGACTTTAGAATATCTTTCCACTTGCTTAATCTTTATTTGACAAAGGCTTATGTTAAT
AAAGATGAATCTATCCCTTGGAACTCTCTTAAATATTTAATTGGTGAAGCAATGTATGGT
GGTAGAGTTACTGATGATTTCGATAGAAGAGTTCTTGTTTGTTACTTGGATGAATATATG
GGAGACTTCTTATTTGATAAGAATAGAGAATTTTTCTTTGCTAAAGTAGATGATGTCACC
TACTCCCTACCCAAGTAAATGAATCTTGAAGGTTACATTAATACAGTTAATGAAATTCCT
ATTATTAACTCTCCTGCAGTTTTTGGTTTACATCCAAATGCAGAAATTATGTATTACACA
AATGCTGCTAAAGATCTATGGGATAATATGCTTACTCTTCAAGTATAGGGAAGTCATAGC
AGTTCAAGTGATAACAAAGTAATTAATTATATTTAAATTTATCTATAAACTAATTAAATT
TTTTTTAATTTAGGATGAATACATAGATAATATTGCTTCAGATATATTAAGTAAATTACC
TTCAATATGGGATGTCTTCCTCCTCAGAAAAGAAGCTGGAGAGGTCTTGCAACCAACTAC
AGTTGTGTTGTTCTAAGAGTTAGAACGTTTCAATATGTTGATATTAAAGATTTAGAGCTC
TCTTTATAACTTAAAAAGAGCACTTAAGGGTGAAATCGGTATGAGTTCTGAATTGGATGA
GCTTGCTATTTCACTTTACAATGGTTTCTTACCTTCAATTTGGGCTAAGCTTGCTCCTTA
AACAGAAAAGAAATTAGGTTCTTGGATGGAACATTTCTTGAATCGTGTTAAATAGTATAG
AGAATGGACTACAAACGGTGAACCTGCAGTTATATGGCTTTCTGGTATCCATATTCCTGA
ATCTTACTTAACTGCTTTAGTCTAGACAACCTGTAGAGCTAAATAATGGGCTCTTGATAA
GAGTACTCTATACACAGTTGTAACAAACCAAAAATCAGCAGAGCAAATCAAAAAGAAACC
TGAGCATGGCTGTTATGTTCGTGGTTTCTATTTAGAAGGAGCTTAATGGGATTTATCTAA
AAACTGTCTTAAACGTTAAAAGTAATTAACAATATTTTTATTTAATTTTAGATTATTTAT
TTCATATTAATAATATTCTGTTTTTAATAATAAAGTCCTAAAGAACTCATCTTTGAAATG
CCACTTATTTAGATTATTCCAGTAGAAGCTAATAAACTCAAGCTTAAGGACTCCTTGAAC
ACACCTGTCTATGTTACTTAAAATAGAAGAAATGCAATGGGTGTAGGTTTAGTCTTTACT
GCAAATCTTAGAACTGAAGAGCATCCTTCTCATTGGGTACTTCAAGGTGTTTGCTTGGTT
CTCAATGTAGATTTCTGA