Identifiers and Description

Gene Model Identifier

TTHERM_00486600

Standard Name

DYH5 (DYnein Heavy chain )

Aliases

PreTt19591 | 59.m00229 | 3680.m00086

Description

Heavy chain subunit of ciliary three-headed outer arm dynein (OAD); Dyh4p/Dyh5p dimer produces the active force

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08775 ) ParB family
  • ( PF01833 ) IPT/TIG domain
  • ( PF02370 ) M protein repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF03028 ) Dynein heavy chain
  • ( TIGR00264 ) alpha-NAC homolog
  • ( PF01344 ) kelch repeat protein
  • ( PF07646 ) kelch repeat protein
  • ( PF00630 ) Filamin/ABP280 repeat
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR02640 ) gas vesicle protein GvpN
  • ( TIGR00206 ) flagellar M-ring protein FliF
  • ( TIGR00020 ) peptide chain release factor 2
  • ( TIGR01446 ) DnaD and phage-associated domain
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( TIGR00150 ) conserved hypothetical protein TIGR00150
  • ( TIGR02928 ) orc1/cdc6 family replication initiation protein
  • ( TIGR00042 ) non-canonical purine NTP pyrophosphatase, rdgB/HAM1
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00486600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_164050
WormBaseWBGene000004859.997093137033517e-262locus:che-3 Cytoplasmic dyne
in 2 heavy chain 1 status:Pa
rtially_confirmed UniProt:Q1
9542 protein_id:CAA99830.2
Tetrahymena borealisEI9_12161.19.997093137033517e-262dynein heavy chain family prot
ein (4165 aa)
OxytrichaContig19406.0.0.g759.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p
DictyBaseDDB_G02763551.0002211124116698e-173dhcA on chromosome: 2 position
6681538 to 6695830

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  2. Ref:14983522: Toba S, Gibson TM, Shiroguchi K, Toyoshima YY, Asai DJ (2004) Properties of the full-length heavy chains of Tetrahymena ciliary outer arm dynein separated by urea treatment. Cell motility and the cytoskeleton 58(1):30-8
  3. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  4. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  5. Ref:10568033: Xu W, Royalty MP, Zimmerman JR, Angus SP, Pennock DG (2000) The dynein heavy chain gene family in Tetrahymena thermophila. The Journal of eukaryotic microbiology 46(6):606-11
  6. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_00486600(coding)
ATGCCTTAGCCTCTCGTTTGGACATAATTAAAATAAACTGGTACAACATAGCCAACCGCT
AGATCTGGTCATACCATCATAACTGTAGGTAAGACTCATATCATGTTCGGTGGTTTAGAC
AATGACAAGAATAACTACAAGGACGGTAAAATAGCTCCCAATAACTAAGTATTTACCTTG
AAGTTAACTTAAAATAACTGCGAATGGCGTTAAATTGCATGCTAAGGTGATGTACCTTTG
CCCAGATGTTATCATGCATCTTGCGCTATTTCGGCTGATAAAATGTTAGTTTTTGGTGGT
AGTTACACTTCTAATTTGCGTTTTAATGACACATACATCCTCAAGACAACTTCATATTAA
TGGAGTAAGCCTGCTAACTAAATTAGCGGAGGAGAACCAAAAAATGCTGAATCAAAAATT
GGTGCACCTTAGCCTAGATATGGTCATAGTGCAACTTTCTTTGAAGGAAAGGTTTATATT
TTTGGTGGACATGGTGGTATTAATTATTAAAGACTTGCTTTTAATGACTTATATGTTCTA
GAAACTGAAAACTTTGAATGGACTAGACTTGAACCTAAGGGTAATCCTCCTGATCCAAGA
GGTGGTCACTCTGCTGCTATGATGGCTAACAAGCCTTAGTTAATGATTTTCGGTGGTTGG
AGTTTTACTTCATAATATTCAAATATTATGATTTATGATATTGAAAAAGATGAATGGGTT
GATCCCGAAATTGCTCATGAAATTCCTAAATGGAATCTTTCAGGTATCATGGCTCCCTCC
ATTCCTTCATGGAAGTATTTTATCTTCGGTGGTAGCGTTGGTTCATTTGAAGAAGGTGGT
AATAGAACTAATTCTCGTTTTGTTGATGACTCTTTTGTTTTAGATATAGACACTCTCAGC
TGGAGTTCCATTAATTTGGAAGCTGATGAAACTTCAAAAGCTGTCTGCAAACCAAGACCA
AGAGAAAGTGCTTCTATTTTCTATGATTCTGGAGAATCTAGAGCTATAGTTTTCGGTGGT
TGGGCCAACAACTGGTTGAATGACTTATGGGCTTTGAATGTTTCAACAATTACTGGTCCT
CCTTATGCTATTTTCAGTATTAAGCCAGCTTTAGGACCACTCACTGGTAAAACTAAAGTT
CTTATTGAAGGTGATGGCTTTAAGGATACTTAAAATATTTCAGTTAAATTTTCAGGCGGT
AAGTTAGAAAAGGAAGTTAATGGTACTTTTGTTAATGAGAAAGAAATTTCTTGTGAAACT
CCTACCTTCGACTATCCAAGATCTGTAGAAGTAACTGTTTGCATGAACAAGGGTGATTAT
ACTATCACAAAGAGTGCTTTTACTTATTATTTGAATACAAAGGCTGACAAAACTATTGCT
TATGGTCCTGGTCTTCTTACAGAGAACTTAATTGGTGTTCAAACAACTATTGTCATCTAG
GCTCGTAATAAGAATGATTAAAATCGTGAATCTGGCTCTGATGAATTTGTTGTTACTATT
CGCAATCCTGCTAAAATTAAAAAGGAAGAAGAAGTTAAAGAAGGTGATAAGGCAAATACT
AAAAACACTATCAAGGAAGATGAAGAAGAAGAAGGTGAAGATGAAGAAGAAAATAAAAAA
AAGAAAGAAGCTGAAAAGGCTGCTGCTGAAAAAGCTGCTGCAGAAAAAGCTGCTGAAGAA
GAGCAAGGTGAAGCTGTAGATCCATCTCTTGTTCCCTTCAATATAGTTGATAATGATGAT
GGTTCTTACTTCATACAATTTACTAGTGAAGAGGAAGCTGTTTTAGAAATTGATATTAAA
TTCAAGGATGAGAATAATGAACTTCATTCTATCAGAGGTAATCCTTTCAGATGTGGATTC
GTCAAAGGATCTAAGCCTAACAATAATGACTTGACTGGTTCTGCTGTCATGAATTATATC
TCTAAGTAACTCAAAGACATCTAAGAATTTATTGAAAACACCAAAGAAAATATTGAAATC
AGAAATAAGAATATTAGAGAAAATGTTTCTGAGCTTATCAACGTTATGATTAATTTGGAA
AAAGTTCGTGTAAAGAATGACGATGATGTCCTTACTCTTGATACAGTTGAAGAAATGCTC
AATTTCCTAAAGAAAAAAGATTTTGGTAAGGATTCTGATATCAAAAAATGTAAGAAATTA
CAAGAAGAATGGAAAAATCTTGCTAAAATGGCTCAAGCAGTCAAAAAAGATATCCAAAAT
CCAGTTAAAACTGAATCAGATAAAACAAAGGAAAATATTAAGAAATTCGAAGAAATTACC
CTTAAAGAATATGCTAACAGCTTAAAGAAAGAAAGTTTCTTCATCTATAAGACTGGAGTT
TCAGAGTCTTTTAAGAGAATTGGTGAAGTTAAGTAAAAGGTTGACGAATTCGAAGTTCAA
CTCAACCAATATGAAGATTTCGCCCGTATGTTTGAATTCCCTGATGCAGTTATCGGAAGC
AAGAAATTGATGGAATAAATCCGTACTGATGTCAGCTCTGTTGAAAAGTTGTGGGTCAGA
ATTGAAATTTCTGAAAAAACCATGGATGAATATAAAAAAATGAAGTGGGGCTCAATCAAC
TCTATGGATATGGAAGATGAAATCAAAAAGCTCAGAAAAGCGCTTACAGATTTGCGTGGT
ATCGATAAGAGATCTAATGCATTTATTGGAATAACTGAAGAACTTAAGAAGTGGGCCACT
TTCTTACCTCTTCTCGGTGAACTTAAAGATCCTTCTATGAACTCAGAAGATGGCCGTCAC
TGGAAAAAGCTTAAGGACTTAGTTAAGAAGGAATTCGATGTCAGCTAAGAACTTATGCTT
GAAATCATTTGGGATTTGAAATTGTTCGATTATAAAGATGGTATTGAAGAAATTACTGAT
TAAGCTAAGCAAGAATTAAAAATGGAAAAAGCATTAAAGAAGATTATTGATTTCTGGAGA
GATATTGAATTTGAACTTGTTCAACATAAGAACACCGATATTCACACTTTGAAGATGAGC
GAAGAAAACTTTGAAACTTTAGAAGACCATCAATTACAAATTAACAATATGCTTTTAAGT
AAGTATGTAGCTTACTTCGAAAAGGAAGTTGAAAAATGGAAGTATGATTTGGGTAGCGTT
TATGATGTTGTTTAATTATTACTTGAAGTCTAAAAGACATGGTCTTTCTTAGAAAATCTA
TTCATCTAATCAGAAGAAGTTAAGCGTGAATTACCTAATGAATCAGCTCAATTTGTTGGT
ATTGATAAAGATATGAAAGAAATTATGCAAAAGGGTTGTGATATCAAGAATTGTTTAAAG
TTCTGTACAATTGAAGGTATGCTTAAGAGATTAGAAAATATTCAAGCCCAATTGAAAGTT
TGCGAAAAGGCTTTAAATGAATTCTTGGATAGCAAGCGTCGTGCTTTCCCTCGTTTCTAC
TTCGTTTCAGTTAATGACTTGTTAGATATTTTATCTAATGGTAATTCTCCTGCCAAGATT
AATCGTCACATGAGTAAAATCTTCTAAGCTATTGATAATTTGTAATTAAAGGAAGACAGC
TCTGGTGGTCGTCCAACTGCTTTAAAGATGATTTCTTGTGTTGGTACTGAAGAAGTTGAT
TTCTCATCACCCCGTTTACTATAGGGTAAGGTAGAAAGCTATCTCAAGGATGTTATTGAC
ACCATGATTGGAACTCTTAAGTCAGTTGCCAACTCCTCTTTCAAGAATTTCTAATCCATG
ACTCGTAAGGAATGGTTGAAGTCAGATCCTTCATAAATTACTTTATTGGTCAACAACATC
ATATGGTCAAAGGCTGTTGAAGATTGTTTCTTAAAGCTCTAGAGCGGTGATATCAATGCA
ATGAAGCTATTTTTAGATGAATCTATCAAATAATTAACTGAGCTTATTGGTATGGTCTAA
GGTGACTTGTCAAAGCCCCTTCGTCAAAAGATTATGTGTTTAATCACTATTGATACCCAC
TCTCGTGATGTCGTTCATCGTTTGATAAATGAGCATGTCCGTAAGGCTGAAGAATTTTAA
TGGTAATCATAACTTAAATTTTATTGGGTTGATAATGATGCTAAGATTAAGATTGCTGAT
GCTCGTTTTGTTTACAATTATGAATATCTTGGTAATGGTCCACGTTTGGTTATTACTCCT
TTGACAGATCGTATTTATGTCACAGCCACTTAGGCTCTTCACTTAAAGATGGGTTGCGCT
CCTGCTGGTCCTGCAGGTACTGGTAAGACAGAAACTACTAAAGATCTCGCTAATGCACTT
GCTAAGGCATGTTATGTATTCAATTGTTCATCAGAAATGAACTATGAATCTATGGGTAAT
ATTTATAAAGGTCTCGCTTCTTCAGGATGTTGGGGTTGTTTTGATGAATTCAATAGATTA
TTACCAGAAGTGCTTTCTGTGTGCTCTGTTTAGTTCAAGGCTGTCACTGATGCTATTAAG
CAAAATGTTGAACGTTTTATTATCGAAGGTGATGAAATTTCTTTAGATCCCACTTGTGGT
GTCTTCATTACAATGAATCCTGGTTATTTAGGTCGTGCAGAATTGCCTGAAGGTTTGAAG
GCACTTTTCCGTCCTATTACTGTCGTTGTTCCTGATTTGGAATTAATTTGCGAAAATATG
CTTATGGCTGAAGGTTTTATTGAAGCTAAAATTCTTGCCAAAAAATTCGTTACCCTTTAT
ATGCTTTGCCGTGATTTACTCTCTAAATAACTTCACTATGATTGGGGTCTCCGTGCCATT
AAGTCTGTCTTGGTCGTCGCTGGTGGTTTCAAACGTTCTGAACCTGAAATTGCTGAATAA
GCCTTGCTTATGAGAGCTTTAAGAGATTTCAATATTCCTAAAATTGCTTTCTAAGATTTG
TATGTCTTCCACGGCCTTTTAGGTGATCTCTTCCCTGGTATCAATATTAAGCCTAAGAAA
GATCTTGATTTTGAAAAAATTATTACAGATGTTTGCATTGAAAATAAGCTTGACCCTGAT
CCAGAATTTGTATTGAAGGTTGTTTAGCTTAGTGAATTACTTGCTATTCGTCACTGTGTC
TTCGTTATGGGCCCTCCTGGAGCTGGTAAATCTACTACTTGGAAGATTCTTGCTAAGGCT
TAAGATAAGACCAACAAGAAGACTACTTTAATTGATATTGATCCTAAAGTCGTCTCAACA
AAGGACTTTTATGGATATAACTTACCTTCAAAAGAATGGAAGGATGGTTTATTCTCAAAA
ATGTTACGTTCATTAGCTGAATAGCCTGATACCAATCCTAAATGGATTTGCCTAGATGGT
GATCTTGATGCTAATTGGATCGAATCTATGAACTCTGTTATGGATGACAATAAGATTTTG
ACACTTGCCAATAACGAGCGTATTCCTCTTAAGCCTCACATGAGAGCTCTTTTCGAAATT
CGTGATTTACGTTTTGCCACTCCTGCTACTGTCTCTCGTGCTGGTATTCTTTATATTTCT
GATGAAGTTGGATACTAATGGCGTTCATATGTTAAATCTTGGATTAAGTAAGAATTTAGC
TAAGATTAGGAAATGTCCAAGAACCTTGATACTCTTTTTGGCAAATATGTTCCTGATACT
CTTGACCACATTAAAAAACACTGCAGATTCTTAGTTCCAGTCTCACCTATCTCCTAAGTC
ATTTCAATTTGTAAGTCTCTTCAAACTTTACTTAAAGGAGATGTTAAAAATCTTGAATAT
CTTTTTGTATATGCTCTTATTTGGGCTATTGGTGGTGCTCTTGCTGAAAAGGATTCTATT
GATTATCGTAAAGATTTCTCTACTTGGTGGAAAGGTGCATGGAAAACTGCAGTAAAATTC
CCAAGTAAAGGTACTATTTTCGATTACTATGTTGACTAATCTGGAGATTCTTCTAAATTC
GTTGAATGGAGTAAGAGATTAGAAAATAAGGAATTTGATCCTTAAGTCGAAACTATGGGT
AATATAACAGTTAACACTATCGAAACTCTTGCTACTACAGAATTTATTAAGTCTTACTTG
ATGGTAAAACACCCTTCTCTTCTTATAGGTAACTCTGGTTGTGGTAAGACTCAACTTGCT
AAGGGTATTCTCAAAGAAATTGTGCAAGCAAAGCCTGAAAACTATGCTTATTAGTTAATC
AATTTCAACTATTACACAGATTCAACTTATCTTTAGGGTTAAATTGAACAAACTTTAGAA
AAGAAAGCTGGTCGTCAATATGGTCCCCCAGGTAAAGTCCAATTAATTTACTTCATTGAT
GACTTGAATATGCCTTAACTTGATGCCTATGATACTCAAACTGCTATTGCACTTCTTCGT
TAATTAGCTGATTATGGCCACTTCTATGATGTTAGTAAGCTTGCTCTTAAGGATATCATT
AATACATAAGTACTTGCTGCTATGAATCCTTCAGCTGGTTCTTTCTTTGTTAATCCTCGT
TATTAGCGTCATTTCTGGACTATTTCTATTCCATTCCCAGACAATGAATCACTTTCACTA
ATTTATATTACATTCCTTAATGGTCACTTAAAGAGATTCAAATCTACCATTTAAGAATAC
TCCAATATCATAGTCCGTGCCTCATTGATGCTTCACTAAGCTGTTACCTAAAATTTCCGT
AAAACAGCTATCAATTTCCACTATGAATTCAACCTTCGTCATATGTCCAATGTATTCTAG
GGTCTTCTTCTTTCTGATCCTAACAAATTTACTGAACCTGATAAATTAATTAAGCTTTGG
ATCCATGAGTGTGAACGTACATATGGTGATCGTTTGGTTTCTACTGATAACCTTAAGACT
TATAAAGAAAATATTTTTGATATTGTTAAAAAGTCCTTTTCTAAATTCAACTTCTCACGT
TACTTTGGTAATAACCCAGAAAATCTCATTTATTGCAACTTTATAGCAGGTATAAACTCT
GATCGTTTCTACGACTAAATGCCTAACAATGAAATGGAAAAGCACATTTCTGAAGCTCTA
AAGGAATACAATGATAACAATGCTTTTATGGGTCTTGTCCTTTTCGAAGATGCTATGAAG
CATGTTTGCAGAATATGCCGTATTGTTCTTCCTTCTTCAGGACATGCTTTACTTGTAGGT
GTTGGTGGTTCTGGTAAGTAATCTCTATCTAAATTAGCTTCATTCATTATGGGTTATACA
ACTTTCTCTATCACAATTTCTGCTACCTACTCCATGGTTGATCTTCGTAATGATTTATAA
TAATTATACTTCAAGTGTGGTCCTAAAGAAGAAGGTATTCTTTTCCTCTTTACTGAAGGT
TAAATTACTAATGAACGTTTCCTTGTGTACATTAACGATCTTCTTTCCTCTGGTGAAATT
GCTGAACTTTACACACTTGATGAAAAAGAAGCCATGATCAACTAAGTCCGTGCAAAGGTT
AAGGGTGAGGGTAAACCTGATACTCGTGAAAACTGTTGGAATTGGTTTATTGATCAAGTT
AAAAAGAATCTCCACATGGCTATTTGTTTCTCTCCTGTTGGTGATATGCGTCGTCGTGCT
CGTTAATTCCCTGCTCTTGTTAATTGTACTGTTATCGATTGGTTCTAACCTTGGCCTTAT
GAGGCACTTTTCAATGTCGCTAAATCTTTCCTTGAACCAGTTGATTTAGGTGATGATAAG
GTACGTGAAGCCGTCGTTAAATTCATGCCTTTCTCTTTCACTCTAGTCAATGATTTGGGT
CTTAAACTTCTTGAATAAGAACGTCGTTATGCCTATACCACTCCTAAATCTTTCCTTGAA
CTTATTTCCTTATTCACAAATATGCTTGCTTAAAAACGTGAGTCTCTAGAAAGAAACAAG
GAACGTTATGAAACAGGTCTTGTAAAACTCAAAGAAACTGCTGAATAAGTCGCTATTATT
GAAGTTGAAGTCAAAGAAAAGTAAGTAGAAGCTGAAGCTAAGAAGAAAGAAGCTGATGCC
TTCGCAGAAGTTGTAGGTCGTGAAAAAGATAAAGTAGAAAAAGAAAATTCTAAAGCCACA
ATTGAAGCAGATAAGTGTGGTCTCATTAAATAAAATGTAGAAGCTCAAAAATCCTCTACC
TAATAGGATCTAGATGCAGCCCAACCTCTTGTCGAATAAGCCAAGTCTGCTCTTAACTCT
ATTTCTAAAAAAGATTTCTAATAAGCTAAATCTTTTGCAAGTCCTCCTGCAGGTGTGCCA
GAAGTGTTTGCTGCTACAATTTATCTCCTTGCTGGTTATTTCAATGAAGCTATTGAAATT
GATAAGAACAAAAAGCCTAAGGATGTCTCATGGAAGAGTTCCTTAAAGCTGATGAAGTCC
CCTGAAGAATTTATGGAAAAATTACTCAATTTCAAGGATGTCGTAGATGCAAACTAAGTT
CCTGCAGCTAATGTCAATATTGTAAAGAATCAATATCTCAATATGCCTTCTTTCACTCCT
GAATAGATGGCTTCAAAGTCAGCTGCTGCCAAGGGTATTTGTTCTTGGGTCGTTAATATT
GTTAAATATTACGATGTTATTTAAGATGTTGAACCTAAGCGTAAAGCTCTTAAGGAAGCT
ACAGAATAACTTGAAGAAGCTACTGTTAAGCTTAATGAAGTCGAAGAAGTTGTTAGAAAG
CTTAATGAAGAATTGAATAAGCTTAAAGCTGAAAACGATAAGGCTATTGCTGAAAGAAAT
GCAGCTATTTCAGAAGCTGAAAGATGTGCCAGAAGACTTAATTTAGCATAAAGATTAGTA
ACAGCTCTTTCCAGTGAAAATGAACGTTGGGGTAAATCTATCATTCAATTAGAAGATTAA
CTCAAACTTATGGTTGGTGATGTCCTCGTTGCCTCTTCTTTCGTCAGTTATTCTGGTCCT
TTCAACAAGAAATTCCGTAATATTATGATTAACCAGAACTTCATGAAATTCATGAAAGAG
CATACCATTCCTATGTCTCCTGATCCAAATCCTATTAAAATTTTAACTGATGAATCAACC
ATCGCTCTTTGGAACAAATAAAAACTTCCAAGTGACTCTGTCTCTATAGAAAATGGTACA
ATTCTCACAAACTCTGCAAGATATCCTTTGATGATTGATCCTCAATTATAGGGTATTACT
TGGATTCGTGAAAAGGAAAAAGCAAACAACTTGAAGATCCTTCGTCTTGGCTCAAAGAAT
ATTAACAGAGATCTTGAATTATCCATTGAAAATGGTTACTCTGCCATCATCGAAAATATG
AATGAACGTATTGATGCTATATTGATGCCTATTATTGCACGTTCTTTCATTAAGAGAGGT
AAAAATAAAATTATTAAATTCGCTGGTAAAGATTTGATCCTTCACCCCAACTTCAAACTT
TTCCTCCATACCAAACTTTCAAATCCTCACTATCCTCCTGAAATTTAAGCAGAAGCTGCT
CTTATTAACTTCACTGTCACAGAAGCTGGTTTAGGAGATTAACTTCTTTCTTTGGTCGTA
GCTCGTGAACGTCCTGATTTAGCTAAAATGAAGATTGAACTTATCACTCAACAAAATGAT
TTCAAGATTAAATTGAAAGATCTTGAAGATGAATTATTATACAAGCTTGCTAATGCTAAG
GGTGATATTCTTGATGATATTGAATTGATTGAAAATCTTGAATATTCTAAGAAGCTTTCA
GTAGAAATTGCTGAAAAAGTTGCAGCTGCAAAGATTACTGAAGCTAAGATCAATGAAACT
TCTGAAAATTACAGACCCGCAGCTTCACGTGGTGCTCTTTTCTATTTCTTACTTTCAGAT
TTGTCAAAGGTTCACTCTTTCTACAAATACTCATTAGAATCTTTCATCGTTGTCATCAAT
CGTGCTATTGATGCTATTTCTGAAAATAAGATTTACGGTAAAACTACAATGGTTCCATAT
GGTGATGAAACCTATGCCTCAAATTAACATGAAAAAGAAGAAGAAGAAGAGGAAGAAGAA
CATTAATAAGCTCAATAATAATAGAATTAAGAAGAATAATAAGAATAAAAGGATGAAGAA
AACAAAGGACCAGTTGAAGAAGAATAGCCTGAAGGAGAAAATAAAGGGCCAGTAGAAGAA
GAAGGAGCTGAAGGTTAAAACGAAGGTCCTGTAGAAGAAGAAAATGCTGAAAACTAAGAA
GGAGAAGGTGAAGAAGAAGGAGAAAAACAACAAAAGGCAAAAGATTCTGATGAGCCTATG
AGTCCCAGATCTTTGAAGAAGCGTGTTGACGAACTAATTGAATCACTTACTTACACTGCA
TATCAAACCACTCGTCGTGGTCTATTTGAAAGCCATAAGCTCATTGTTGCAGCTATGCTT
TGTCTTAGAGTTTTATTGCGTTCAGAAGAACTTAATTCAGATGAAGTTGATCACCTCATC
ATTGGTAAAGTCGATGTCAATCCTACTCCTATGCCTGATGCTCTTAAATCATTCTTGAAC
GATAATATTTGGGCTGCTTGCAAGGCTCTTGAAACTATTCATCAATTCTAAGGTTTCTGC
TAATCTCTTGAAACTGATGTTTTGTAATGGAAGAAGTGGTACAGTGAAGAAAAGGCAGAA
ACAGCTGATTTACCTAAGGCCTTTAAGGAATTATCAAAGTTCCACAGATTACTTCTTTTA
CGTGCTTTACGTCCTGACAGACTTCCATCTGCTTTGAGCTAATTCGTTCATGATAAGATG
GGTGAAAGATATATTGAATAACCTCCTTTCAATATCTTTGAAACATTCTAAGAAACTTCC
AAAACAGTACCCATTTTCTTCGTACTTTTCCCTGGTGTTGATCCTACACCTGATGTTGAA
AGAGTCGCAGCTACTTTTGATGTTTCCGCAAATAACGGCCGTTTCATTAATATTTCTATG
GGTCAAGGTTAAGAAGATAGAGCTAAAAAGGCTCTCTTTGATTGTGCTTAAAAAGGACAC
TGGATTATGCTTTAAAATGTACATCTTATGCAAAGTTGGTTGTATGGACTTAATGGTCTT
GAAGGTTTCCTTGAGAGTGTGTTTGCTTCACCTAAAACTCATCCTAATTTCCGTGTCTTC
ATTTCTTCCGAACCTCCTAATGTCTTACTTCCTCTTATGTAAATTATTCCTGAATCTATT
TTACAAGGATCTCTCAAGATTGCAAATGAAGCTCCTTAATATTTAAAGGCTAACCTCCGT
CGTGCCTATAATAAATTCGATCAAGAATTCTTAGATAAATGTGATAAGAAACCAACTGAA
TTTAAGTCTTGTCTCTTCGCTCTTTGCTTCTTCCACAGTCTTATGCTTGGACGTAAGAAA
TTCGGTACTTAAGGTTGGTCAAGAGTATATAACTTCAATGATGGTGATCTTACAATTTGT
GCAGACGTACTCTACAATTATCTTTCTAAGTATGACTAAGTACCTTGGGATGATTTACGT
TACATTTTCGGTGAAATTATGTATGGTGGTCATATTACAGATGATTGGGATAGAAGAACA
AATAGAACATATTTGAAGGTATTGATTAGATCTGAATTGCTTCAATAAAACTTCAACTTA
GCTCCTCAATTCAAGTCACCTGATCCCAGTAAATTTGATTATGAAGCATATAGAAAATAC
ATAGAAGAAAAATTACCAATTGAATCTCCTTAAATGTTTGGTATGCATCCTAACGCTGAA
ATTGGTTACTTAACATAGACTTGCGACTAGGTCTTTAATACCATCCTAGAAGTCCAAGGT
GGTTCTTCAGGTGGTGGTGCTTCTAAAAAGGATGATGGTGTCATGGTTACTTTAACTGAC
TTTAAGACAAGATGCCCTCACGATTTCAATATGCTTCTTATTGAAGAAAAGGTTAAAGAA
AAAACTCCTTATATTGTTGTTTGCTTACAAGAATGCGAACGTATGAATGGACTACTTAAA
GAAATAAAGACTTCATTGGAAGATCTCCGTCTTGGTTTAACAGGTGCACTTAACATGACA
GATGCTATGGAAAGCTTACAATAATCACTTTCTTTCAACAAGGTTCCAGACACTTGGGAA
AAGAAGGCTTATTTCTCTAAAAAACCATTATCTTCTTGGTTTGCTGATCTTATTGAAAGA
AATATATAACTCTAAGAATGGTGTAAAGAATTGGTTACTCCTACCTCTTTATGTATTTCA
TATCTATTCAATCCTATGTCTTATCTTACTGCTATTATGCAGTTCACAGCAAGAGCTTAG
GGATTACCTCTCGATGGTATCACTATCTAAACTAACGTTACTGCTATGAAGGGTCCTGAA
GATGTTGTAAATCCAGCTGAAAATGGTGCTTACATTCACGGTCTCTTCTTAGAAGGAGCT
GCTTGGGAAATTGGTGGTTAAGGACAAGATGGTTACTTAATTGAACAAAAACCAAAAGAG
TTACATCCTAAGATGCCAGTTATAAATGCAGTTGCAGTTCCTCTTGATAAAAAGAAGAAG
AATGGTTAATATGACTGCCCAACTTATGTTACTTCTGCCAGAGGTCAAACATTTGTATTC
ACTGCTAACTTAAATATGGAAAGTGATGATTCTGACCCTAATAAGTGGATTCTCTCAGGT
ACTTGCATGCTTATGAGTGATGATTGA


>TTHERM_00486600(protein)
MPQPLVWTQLKQTGTTQPTARSGHTIITVGKTHIMFGGLDNDKNNYKDGKIAPNNQVFTL
KLTQNNCEWRQIACQGDVPLPRCYHASCAISADKMLVFGGSYTSNLRFNDTYILKTTSYQ
WSKPANQISGGEPKNAESKIGAPQPRYGHSATFFEGKVYIFGGHGGINYQRLAFNDLYVL
ETENFEWTRLEPKGNPPDPRGGHSAAMMANKPQLMIFGGWSFTSQYSNIMIYDIEKDEWV
DPEIAHEIPKWNLSGIMAPSIPSWKYFIFGGSVGSFEEGGNRTNSRFVDDSFVLDIDTLS
WSSINLEADETSKAVCKPRPRESASIFYDSGESRAIVFGGWANNWLNDLWALNVSTITGP
PYAIFSIKPALGPLTGKTKVLIEGDGFKDTQNISVKFSGGKLEKEVNGTFVNEKEISCET
PTFDYPRSVEVTVCMNKGDYTITKSAFTYYLNTKADKTIAYGPGLLTENLIGVQTTIVIQ
ARNKNDQNRESGSDEFVVTIRNPAKIKKEEEVKEGDKANTKNTIKEDEEEEGEDEEENKK
KKEAEKAAAEKAAAEKAAEEEQGEAVDPSLVPFNIVDNDDGSYFIQFTSEEEAVLEIDIK
FKDENNELHSIRGNPFRCGFVKGSKPNNNDLTGSAVMNYISKQLKDIQEFIENTKENIEI
RNKNIRENVSELINVMINLEKVRVKNDDDVLTLDTVEEMLNFLKKKDFGKDSDIKKCKKL
QEEWKNLAKMAQAVKKDIQNPVKTESDKTKENIKKFEEITLKEYANSLKKESFFIYKTGV
SESFKRIGEVKQKVDEFEVQLNQYEDFARMFEFPDAVIGSKKLMEQIRTDVSSVEKLWVR
IEISEKTMDEYKKMKWGSINSMDMEDEIKKLRKALTDLRGIDKRSNAFIGITEELKKWAT
FLPLLGELKDPSMNSEDGRHWKKLKDLVKKEFDVSQELMLEIIWDLKLFDYKDGIEEITD
QAKQELKMEKALKKIIDFWRDIEFELVQHKNTDIHTLKMSEENFETLEDHQLQINNMLLS
KYVAYFEKEVEKWKYDLGSVYDVVQLLLEVQKTWSFLENLFIQSEEVKRELPNESAQFVG
IDKDMKEIMQKGCDIKNCLKFCTIEGMLKRLENIQAQLKVCEKALNEFLDSKRRAFPRFY
FVSVNDLLDILSNGNSPAKINRHMSKIFQAIDNLQLKEDSSGGRPTALKMISCVGTEEVD
FSSPRLLQGKVESYLKDVIDTMIGTLKSVANSSFKNFQSMTRKEWLKSDPSQITLLVNNI
IWSKAVEDCFLKLQSGDINAMKLFLDESIKQLTELIGMVQGDLSKPLRQKIMCLITIDTH
SRDVVHRLINEHVRKAEEFQWQSQLKFYWVDNDAKIKIADARFVYNYEYLGNGPRLVITP
LTDRIYVTATQALHLKMGCAPAGPAGTGKTETTKDLANALAKACYVFNCSSEMNYESMGN
IYKGLASSGCWGCFDEFNRLLPEVLSVCSVQFKAVTDAIKQNVERFIIEGDEISLDPTCG
VFITMNPGYLGRAELPEGLKALFRPITVVVPDLELICENMLMAEGFIEAKILAKKFVTLY
MLCRDLLSKQLHYDWGLRAIKSVLVVAGGFKRSEPEIAEQALLMRALRDFNIPKIAFQDL
YVFHGLLGDLFPGINIKPKKDLDFEKIITDVCIENKLDPDPEFVLKVVQLSELLAIRHCV
FVMGPPGAGKSTTWKILAKAQDKTNKKTTLIDIDPKVVSTKDFYGYNLPSKEWKDGLFSK
MLRSLAEQPDTNPKWICLDGDLDANWIESMNSVMDDNKILTLANNERIPLKPHMRALFEI
RDLRFATPATVSRAGILYISDEVGYQWRSYVKSWIKQEFSQDQEMSKNLDTLFGKYVPDT
LDHIKKHCRFLVPVSPISQVISICKSLQTLLKGDVKNLEYLFVYALIWAIGGALAEKDSI
DYRKDFSTWWKGAWKTAVKFPSKGTIFDYYVDQSGDSSKFVEWSKRLENKEFDPQVETMG
NITVNTIETLATTEFIKSYLMVKHPSLLIGNSGCGKTQLAKGILKEIVQAKPENYAYQLI
NFNYYTDSTYLQGQIEQTLEKKAGRQYGPPGKVQLIYFIDDLNMPQLDAYDTQTAIALLR
QLADYGHFYDVSKLALKDIINTQVLAAMNPSAGSFFVNPRYQRHFWTISIPFPDNESLSL
IYITFLNGHLKRFKSTIQEYSNIIVRASLMLHQAVTQNFRKTAINFHYEFNLRHMSNVFQ
GLLLSDPNKFTEPDKLIKLWIHECERTYGDRLVSTDNLKTYKENIFDIVKKSFSKFNFSR
YFGNNPENLIYCNFIAGINSDRFYDQMPNNEMEKHISEALKEYNDNNAFMGLVLFEDAMK
HVCRICRIVLPSSGHALLVGVGGSGKQSLSKLASFIMGYTTFSITISATYSMVDLRNDLQ
QLYFKCGPKEEGILFLFTEGQITNERFLVYINDLLSSGEIAELYTLDEKEAMINQVRAKV
KGEGKPDTRENCWNWFIDQVKKNLHMAICFSPVGDMRRRARQFPALVNCTVIDWFQPWPY
EALFNVAKSFLEPVDLGDDKVREAVVKFMPFSFTLVNDLGLKLLEQERRYAYTTPKSFLE
LISLFTNMLAQKRESLERNKERYETGLVKLKETAEQVAIIEVEVKEKQVEAEAKKKEADA
FAEVVGREKDKVEKENSKATIEADKCGLIKQNVEAQKSSTQQDLDAAQPLVEQAKSALNS
ISKKDFQQAKSFASPPAGVPEVFAATIYLLAGYFNEAIEIDKNKKPKDVSWKSSLKLMKS
PEEFMEKLLNFKDVVDANQVPAANVNIVKNQYLNMPSFTPEQMASKSAAAKGICSWVVNI
VKYYDVIQDVEPKRKALKEATEQLEEATVKLNEVEEVVRKLNEELNKLKAENDKAIAERN
AAISEAERCARRLNLAQRLVTALSSENERWGKSIIQLEDQLKLMVGDVLVASSFVSYSGP
FNKKFRNIMINQNFMKFMKEHTIPMSPDPNPIKILTDESTIALWNKQKLPSDSVSIENGT
ILTNSARYPLMIDPQLQGITWIREKEKANNLKILRLGSKNINRDLELSIENGYSAIIENM
NERIDAILMPIIARSFIKRGKNKIIKFAGKDLILHPNFKLFLHTKLSNPHYPPEIQAEAA
LINFTVTEAGLGDQLLSLVVARERPDLAKMKIELITQQNDFKIKLKDLEDELLYKLANAK
GDILDDIELIENLEYSKKLSVEIAEKVAAAKITEAKINETSENYRPAASRGALFYFLLSD
LSKVHSFYKYSLESFIVVINRAIDAISENKIYGKTTMVPYGDETYASNQHEKEEEEEEEE
HQQAQQQQNQEEQQEQKDEENKGPVEEEQPEGENKGPVEEEGAEGQNEGPVEEENAENQE
GEGEEEGEKQQKAKDSDEPMSPRSLKKRVDELIESLTYTAYQTTRRGLFESHKLIVAAML
CLRVLLRSEELNSDEVDHLIIGKVDVNPTPMPDALKSFLNDNIWAACKALETIHQFQGFC
QSLETDVLQWKKWYSEEKAETADLPKAFKELSKFHRLLLLRALRPDRLPSALSQFVHDKM
GERYIEQPPFNIFETFQETSKTVPIFFVLFPGVDPTPDVERVAATFDVSANNGRFINISM
GQGQEDRAKKALFDCAQKGHWIMLQNVHLMQSWLYGLNGLEGFLESVFASPKTHPNFRVF
ISSEPPNVLLPLMQIIPESILQGSLKIANEAPQYLKANLRRAYNKFDQEFLDKCDKKPTE
FKSCLFALCFFHSLMLGRKKFGTQGWSRVYNFNDGDLTICADVLYNYLSKYDQVPWDDLR
YIFGEIMYGGHITDDWDRRTNRTYLKVLIRSELLQQNFNLAPQFKSPDPSKFDYEAYRKY
IEEKLPIESPQMFGMHPNAEIGYLTQTCDQVFNTILEVQGGSSGGGASKKDDGVMVTLTD
FKTRCPHDFNMLLIEEKVKEKTPYIVVCLQECERMNGLLKEIKTSLEDLRLGLTGALNMT
DAMESLQQSLSFNKVPDTWEKKAYFSKKPLSSWFADLIERNIQLQEWCKELVTPTSLCIS
YLFNPMSYLTAIMQFTARAQGLPLDGITIQTNVTAMKGPEDVVNPAENGAYIHGLFLEGA
AWEIGGQGQDGYLIEQKPKELHPKMPVINAVAVPLDKKKKNGQYDCPTYVTSARGQTFVF
TANLNMESDDSDPNKWILSGTCMLMSDD


>TTHERM_00486600(gene)
ATGGTAACTTTAACTGAAAGCTATTAAAAGAGAAAATTAATTTTTTTTATATTTGTTATA
GCCTTAGCCTCTCGTTTGGACATAATTAAAATAAACTGGTACAACATAGCCAACCGCTAG
ATCTGGTCATACCATCATAACTGTAGGTAAGACTCATATCATGTTCGGTGGTTTAGACAA
TGACAAGAATAACTACAAGGACGGTAAAATAGCTCCCAATAACTAAGTATTTACCTTGAA
GTTAACTTAAAATAACTGCGAATGGCGTTAAATTGCATGCTAAGGTGATGTACCTTTGCC
CAGATGTTATCATGCATCTTGCGCTATTTCGGCTGATAAAATGTTAGTTTTTGGTGGTAG
TTACACTTCTAATTTGCGTTTTAATGACACATACATCCTCAAGACAAGTAATTTTTTTGA
TTAATTTAAATCGGTTTGACATTTTATTTGAGTTTTAGTTGGAAATTTGCAATTTTAAAA
AAATGAGGAATAAACAAATAAATATTGTTTTTTCTTTTTCTTGTTGAATTTAATTGATAT
CTTAAAGTGTTTTCATTCAATAATGAATGAAAATTTTAAGATTCCAATAATTGTTTCAAA
ACGAATCTAATTTAATTATAACAATAAAAATAAAACCTCCAATTTTAATTAAAGCTGAAT
AATTTATTATTAATTTGAATTAATATTTATTGATTAGCAACGAATGTTAAAAATGGCTTT
AAAATTTTTTTTAATTTGAATTAAACAAATTTTCAATTTTCTCTAATAAATATTTATTTT
TAATGTTTATTAAAAAATAATATTTATTAAAAAAGCTTCATATTAATGGAGTAAGCCTGC
TAACTAAATTAGCGGAGGAGAACCAAAAAATGCTGAATCAAAAATTGGTGCACCTTAGCC
TAGATATGGTCATAGTGCAACTTTCTTTGAAGGAAAGGTTTATATTTTTGGTGGACATGG
TGGTATTAATTATTAAAGACTTGCTTTTAATGACTTATATGTTCTAGAAACTGAAAACTT
TGAATGGACTAGACTTGAACCTAAGGGTAATCCTCCTGATCCAAGAGGTGGTCACTCTGC
TGCTATGATGGCTAACAAGCCTTAGTTAATGATTTTCGGTGGTTGGAGTTTTACTTCATA
ATATTCAAATATTATGATTTATGATATTGAAAAAGATGAATGGGTTGATCCCGAAATTGC
TCATGAAATTCCTAAATGGAATCTTTCAGGTATCATGGCTCCCTCCATTCCTTCATGGAA
GTATTTTATCTTCGGTGGTAGCGTTGGTTCATTTGAAGAAGGTGGTAATAGAACTAATTC
TCGTTTTGTTGATGACTCTTTTGTTTTAGATATAGACACTCTCAGCTGGAGTTCCATTAA
TTTGGAAGCTGATGAAACTTCAAAAGTAAGAAATCTATTTTAAATATTGGTTTATGCTAA
ATTTATTCTTTTTAACTTAATAGGCTGTCTGCAAACCAAGACCAAGAGAAAGTGCTTCTA
TTTTCTATGATTCTGGAGAATCTAGAGCTATAGTTTTCGGTGGTTGGGCCAACAACTGGT
TGAATGACTTATGGGCTTTGAATGTTTCAACAATTACTGGTCCTCCTTATGCTATTTTCA
GTATTAAGCCAGCTTTAGGACCACTCACTGGTAAAACTAAAGTTCTTATTGAAGGTGATG
GCTTTAAGGATACTTAAAATATTTCAGTTAAATTTTCAGGCGGTAAGTTAGAAAAGGAAG
TTAATGGTACTTTTGTTAATGAGAAAGAAATTTCTTGTGAAACTCCTACCTTCGACTATC
CAAGATCTGTAGAAGTAACTGTTTGCATGAACAAGGGTGATTATACTATCACAAAGAGTG
CTTTTACTTATTATTTGAATACAAAGGCTGACAAAACTATTGCTTATGGTCCTGGTCTTC
TTACAGAGAACTTAATTGGTGTTCAAACAACTATTGTCATCTAGGCTCGTAATAAGAATG
ATTAAAATCGTGAATCTGGCTCTGATGAATTTGTTGTTACTATTCGCAATCCTGCTAAAA
TTAAAAAGGAAGAAGAAGTTAAAGAAGGTGATAAGGCAAATACTAAAAACACTATCAAGG
AAGATGAAGAAGAAGAAGGTGAAGATGAAGAAGAAAATAAAAAAAAGAAAGAAGCTGAAA
AGGCTGCTGCTGAAAAAGCTGCTGCAGAAAAAGCTGCTGAAGAAGAGCAAGGTGAAGCTG
TAGATCCATCTCTTGTTCCCTTCAATATAGTTGATAATGATGATGGTTCTTACTTCATAC
AATTTACTGTAAATAATAAAATCAATTTTTTTATTTTAATTAACTAATAAAAAATATTTT
TAAATAAAGAGTGAAGAGGAAGCTGTTTTAGAAATTGATATTAAATTCAAGGATGAGAAT
AATGAACTTCATTCTATCAGAGGTAATCCTTTCAGATGTGGATTCGTCAAAGGATCTAAG
CCTAACAATAATGACTTGACTGGTTCTGCTGTCATGAATTATATCTCTAAGTAACTCAAA
GACATCTAAGAATTTATTGAAAACACCAAAGAAAATATTGAAATCAGAAATAAGAATATT
AGAGAAAATGTTTCTGAGCTTATCAACGTTATGATTAATTTGGAAAAAGTTCGTGTAAAG
AATGACGATGATGTCCTTACTCTTGATACAGTTGAAGAAATGCTCAATTTCCTAAAGAAA
AAAGATTTTGGTAAGGATTCTGATATCAAAAAATGTAAGAAATTACAAGAAGAATGGAAA
AATCTTGCTAAAATGGCTCAAGCAGTCAAAAAAGATATCCAAAATCCAGTTAAAACTGAA
TCAGATAAAACAAAGGAAAATATTAAGAAATTCGAAGAAATTACCCTTAAAGAATATGCT
AACAGCTTAAAGAAAGAAAGTTTCTTCATCTATAAGACTGGAGTTTCAGAGTCTTTTAAG
AGAATTGGTGAAGTTAAGTAAAAGGTTGACGAATTCGAAGTTCAACTCAACCAATATGAA
GATTTCGCCCGTATGTTTGAATTCCCTGATGCAGTTATCGGAAGCAAGAAATTGATGGAA
TAAATCCGTACTGATGTCAGCTCTGTTGAAAAGTTGTGGGTCAGAATTGAAATTTCTGAA
AAAACCATGGATGAATATAAAAAAATGAAGTGGGGCTCAATCAACTCTATGGATATGGAA
GATGAAATCAAAAAGCTCAGAAAAGCGCTTACAGATTTGCGTGGTATCGATAAGAGATCT
AATGCATTTATTGGAATAACTGAAGAACTTAAGAAGTGGGCCACTTTCTTACCTCTTCTC
GGTGAACTTAAAGATCCTTCTATGAACTCAGAAGATGGCCGTCACTGGAAAAAGCTTAAG
GACTTAGTTAAGAAGGAATTCGATGTCAGCTAAGAACTTATGCTTGAAATCATTTGGGAT
TTGAAATTGTTCGATTATAAAGATGGTATTGAAGAAATTACTGATTAAGCTAAGCAAGAA
TTAAAAATGGAAAAAGCATTAAAGAAGATTATTGATTTCTGGAGAGATATTGAATTTGAA
CTTGTTCAACATAAGAACACCGATATTCACACTTTGAAGATGAGCGAAGAAAACTTTGAA
ACTTTAGAAGACCATCAATTACAAATTAACAATATGCTTTTAAGTAAGTATGTAGCTTAC
TTCGAAAAGGAAGTTGAAAAATGGAAGTATGATTTGGGTAGCGTTTATGATGTTGTTTAA
TTATTACTTGAAGTCTAAAAGACATGGTCTTTCTTAGAAAATCTATTCATCTAATCAGAA
GAAGTTAAGCGTGAATTACCTAATGAATCAGCTCAATTTGTTGGTATTGATAAAGATATG
AAAGAAATTATGCAAAAGGGTTGTGATATCAAGAATTGTTTAAAGTTCTGTACAATTGAA
GGTATGCTTAAGAGATTAGAAAATATTCAAGCCCAATTGAAAGTTTGCGAAAAGGCTTTA
AATGAATTCTTGGATAGCAAGCGTCGTGCTTTCCCTCGTTTCTACTTCGTTTCAGTTAAT
GACTTGTTAGATATTTTATCTAATGGTAATTCTCCTGCCAAGATTAATCGTCACATGAGT
AAAATCTTCTAAGCTATTGATAATTTGTAATTAAAGGAAGACAGCTCTGGTGGTCGTCCA
ACTGCTTTAAAGATGATTTCTTGTGTTGGTACTGAAGAAGTTGATTTCTCATCACCCCGT
TTACTATAGGGTAAGGTAGAAAGCTATCTCAAGGATGTTATTGACACCATGATTGGAACT
CTTAAGTCAGTTGCCAACTCCTCTTTCAAGAATTTCTAATCCATGACTCGTAAGGAATGG
TTGAAGTCAGATCCTTCATAAATTACTTTATTGGTCAACAACATCATATGGTCAAAGGCT
GTTGAAGATTGTTTCTTAAAGCTCTAGAGCGGTGATATCAATGCAATGAAGCTATTTTTA
GATGAATCTATCAAATAATTAACTGAGCTTATTGGTATGGTCTAAGGTGACTTGTCAAAG
CCCCTTCGTCAAAAGATTATGTGTTTAATCACTATTGATACCCACTCTCGTGATGTCGTT
CATCGTTTGATAAATGAGCATGTCCGTAAGGCTGAAGAATTTTAATGGTAATCATAACTT
AAATTTTATTGGGTTGATAATGATGCTAAGATTAAGATTGCTGATGCTCGTTTTGTTTAC
AATTATGAATATCTTGGTAATGGTCCACGTTTGGTTATTACTCCTTTGACAGATCGTATT
TATGTCACAGCCACTTAGGCTCTTCACTTAAAGATGGGTTGCGCTCCTGCTGGTCCTGCA
GGTACTGGTAAGACAGAAACTACTAAAGATCTCGCTAATGCACTTGCTAAGGCATGTTAT
GTATTCAATTGTTCATCAGAAATGAACTATGAATCTATGGGTAATATTTATAAAGGTCTC
GCTTCTTCAGGATGTTGGGGTTGTTTTGATGAATTCAATAGATTATTACCAGAAGTGCTT
TCTGTGTGCTCTGTTTAGTTCAAGGCTGTCACTGATGCTATTAAGCAAAATGTTGAACGT
TTTATTATCGAAGGTGATGAAATTTCTTTAGATCCCACTTGTGGTGTCTTCATTACAATG
AATCCTGGTTATTTAGGTCGTGCAGAATTGCCTGAAGGTTTGAAGGCACTTTTCCGTCCT
ATTACTGTCGTTGTTCCTGATTTGGAATTAATTTGCGAAAATATGCTTATGGCTGAAGGT
TTTATTGAAGCTAAAATTCTTGCCAAAAAATTCGTTACCCTTTATATGCTTTGCCGTGAT
TTACTCTCTAAATAACTTCACTATGATTGGGGTCTCCGTGCCATTAAGTCTGTCTTGGTC
GTCGCTGGTGGTTTCAAACGTTCTGAACCTGAAATTGCTGAATAAGCCTTGCTTATGAGA
GCTTTAAGAGATTTCAATATTCCTAAAATTGCTTTCTAAGATTTGTATGTCTTCCACGGC
CTTTTAGGTGATCTCTTCCCTGGTATCAATATTAAGCCTAAGAAAGATCTTGATTTTGAA
AAAATTATTACAGATGTTTGCATTGAAAATAAGCTTGACCCTGATCCAGAATTTGTATTG
AAGGTTGTTTAGCTTAGTGAATTACTTGCTATTCGTCACTGTGTCTTCGTTATGGGCCCT
CCTGGAGCTGGTAAATCTACTACTTGGAAGATTCTTGCTAAGGCTTAAGATAAGACCAAC
AAGAAGACTACTTTAATTGATATTGATCCTAAAGTCGTCTCAACAAAGGACTTTTATGGA
TATAACTTACCTTCAAAAGAATGGAAGGATGGTTTATTCTCAAAAATGTTACGTTCATTA
GCTGAATAGCCTGATACCAATCCTAAATGGATTTGCCTAGATGGTGATCTTGATGCTAAT
TGGATCGAATCTATGAACTCTGTTATGGATGACAATAAGATTTTGACACTTGCCAATAAC
GAGCGTATTCCTCTTAAGCCTCACATGAGAGCTCTTTTCGAAATTCGTGATTTACGTTTT
GCCACTCCTGCTACTGTCTCTCGTGCTGGTATTCTTTATATTTCTGATGAAGTTGGATAC
TAATGGCGTTCATATGTTAAATCTTGGATTAAGTAAGAATTTAGCTAAGATTAGGAAATG
TCCAAGAACCTTGATACTCTTTTTGGCAAATATGTTCCTGATACTCTTGACCACATTAAA
AAACACTGCAGATTCTTAGTTCCAGTCTCACCTATCTCCTAAGTCATTTCAATTTGTAAG
TCTCTTCAAACTTTACTTAAAGGAGATGTTAAAAATCTTGAATATCTTTTTGTATATGCT
CTTATTTGGGCTATTGGTGGTGCTCTTGCTGAAAAGGATTCTATTGATTATCGTAAAGAT
TTCTCTACTTGGTGGAAAGGTGCATGGAAAACTGCAGTAAAATTCCCAAGTAAAGGTACT
ATTTTCGATTACTATGTTGACTAATCTGGAGATTCTTCTAAATTCGTTGAATGGAGTAAG
AGATTAGAAAATAAGGAATTTGATCCTTAAGTCGAAACTATGGGTAATATAACAGTTAAC
ACTATCGAAACTCTTGCTACTACAGAATTTATTAAGTCTTACTTGATGGTAAAACACCCT
TCTCTTCTTATAGGTAACTCTGGTTGTGGTAAGACTCAACTTGCTAAGGGTATTCTCAAA
GAAATTGTGCAAGCAAAGCCTGAAAACTATGCTTATTAGTTAATCAATTTCAACTATTAC
ACAGATTCAACTTATCTTTAGGGTTAAATTGAACAAACTTTAGAAAAGAAAGCTGGTCGT
CAATATGGTCCCCCAGGTAAAGTCCAATTAATTTACTTCATTGATGACTTGAATATGCCT
TAACTTGATGCCTATGATACTCAAACTGCTATTGCACTTCTTCGTTAATTAGCTGATTAT
GGCCACTTCTATGATGTTAGTAAGCTTGCTCTTAAGGATATCATTAATACATAAGTACTT
GCTGCTATGAATCCTTCAGCTGGTTCTTTCTTTGTTAATCCTCGTTATTAGCGTCATTTC
TGGACTATTTCTATTCCATTCCCAGACAATGAATCACTTTCACTAATTTATATTACATTC
CTTAATGGTCACTTAAAGAGATTCAAATCTACCATTTAAGAATACTCCAATATCATAGTC
CGTGCCTCATTGATGCTTCACTAAGCTGTTACCTAAAATTTCCGTAAAACAGCTATCAAT
TTCCACTATGAATTCAACCTTCGTCATATGTCCAATGTATTCTAGGGTCTTCTTCTTTCT
GATCCTAACAAATTTACTGAACCTGATAAATTAATTAAGCTTTGGATCCATGAGTGTGAA
CGTACATATGGTGATCGTTTGGTTTCTACTGATAACCTTAAGACTTATAAAGAAAATATT
TTTGATATTGTTAAAAAGTCCTTTTCTAAATTCAACTTCTCACGTTACTTTGGTAATAAC
CCAGAAAATCTCATTTATTGCAACTTTATAGCAGGTATAAACTCTGATCGTTTCTACGAC
TAAATGCCTAACAATGAAATGGAAAAGCACATTTCTGAAGCTCTAAAGGAATACAATGAT
AACAATGCTTTTATGGGTCTTGTCCTTTTCGAAGATGCTATGAAGCATGTTTGCAGAATA
TGCCGTATTGTTCTTCCTTCTTCAGGACATGCTTTACTTGTAGGTGTTGGTGGTTCTGGT
AAGTAATCTCTATCTAAATTAGCTTCATTCATTATGGGTTATACAACTTTCTCTATCACA
ATTTCTGCTACCTACTCCATGGTTGATCTTCGTAATGATTTATAATAATTATACTTCAAG
TGTGGTCCTAAAGAAGAAGGTATTCTTTTCCTCTTTACTGAAGGTTAAATTACTAATGAA
CGTTTCCTTGTGTACATTAACGATCTTCTTTCCTCTGGTGAAATTGCTGAACTTTACACA
CTTGATGAAAAAGAAGCCATGATCAACTAAGTCCGTGCAAAGGTTAAGGGTGAGGGTAAA
CCTGATACTCGTGAAAACTGTTGGAATTGGTTTATTGATCAAGTTAAAAAGAATCTCCAC
ATGGCTATTTGTTTCTCTCCTGTTGGTGATATGCGTCGTCGTGCTCGTTAATTCCCTGCT
CTTGTTAATTGTACTGTTATCGATTGGTTCTAACCTTGGCCTTATGAGGCACTTTTCAAT
GTCGCTAAATCTTTCCTTGAACCAGTTGATTTAGGTGATGATAAGGTACGTGAAGCCGTC
GTTAAATTCATGCCTTTCTCTTTCACTCTAGTCAATGATTTGGGTCTTAAACTTCTTGAA
TAAGAACGTCGTTATGCCTATACCACTCCTAAATCTTTCCTTGAACTTATTTCCTTATTC
ACAAATATGCTTGCTTAAAAACGTGAGTCTCTAGAAAGAAACAAGGAACGTTATGAAACA
GGTCTTGTAAAACTCAAAGAAACTGCTGAATAAGTCGCTATTATTGAAGTTGAAGTCAAA
GAAAAGTAAGTAGAAGCTGAAGCTAAGAAGAAAGAAGCTGATGCCTTCGCAGAAGTTGTA
GGTCGTGAAAAAGATAAAGTAGAAAAAGAAAATTCTAAAGCCACAATTGAAGCAGATAAG
TGTGGTCTCATTAAATAAAATGTAGAAGCTCAAAAATCCTCTACCTAATAGGATCTAGAT
GCAGCCCAACCTCTTGTCGAATAAGCCAAGTCTGCTCTTAACTCTATTTCTAAAAAAGAT
TTCTAATAAGCTAAATCTTTTGCAAGTCCTCCTGCAGGTGTGCCAGAAGTGTTTGCTGCT
ACAATTTATCTCCTTGCTGGTTATTTCAATGAAGCTATTGAAATTGATAAGAACAAAAAG
CCTAAGGATGTCTCATGGAAGAGTTCCTTAAAGCTGATGAAGTCCCCTGAAGAATTTATG
GAAAAATTACTCAATTTCAAGGATGTCGTAGATGCAAACTAAGTTCCTGCAGCTAATGTC
AATATTGTAAAGAATCAATATCTCAATATGCCTTCTTTCACTCCTGAATAGATGGCTTCA
AAGTCAGCTGCTGCCAAGGGTATTTGTTCTTGGGTCGTTAATATTGTTAAATATTACGAT
GTTATTTAAGATGTTGAACCTAAGCGTAAAGCTCTTAAGGAAGCTACAGAATAACTTGAA
GAAGCTACTGTTAAGCTTAATGAAGTCGAAGAAGTTGTTAGAAAGCTTAATGAAGAATTG
AATAAGCTTAAAGCTGAAAACGATAAGGCTATTGCTGAAAGAAATGCAGCTATTTCAGAA
GCTGAAAGATGTGCCAGAAGACTTAATTTAGCATAAAGATTAGTAACAGCTCTTTCCAGT
GAAAATGAACGTTGGGGTAAATCTATCATTCAATTAGAAGATTAACTCAAACTTATGGTT
GGTGATGTCCTCGTTGCCTCTTCTTTCGTCAGTTATTCTGGTCCTTTCAACAAGAAATTC
CGTAATATTATGATTAACCAGAACTTCATGAAATTCATGAAAGAGCATACCATTCCTATG
TCTCCTGATCCAAATCCTATTAAAATTTTAACTGATGAATCAACCATCGCTCTTTGGAAC
AAATAAAAACTTCCAAGTGACTCTGTCTCTATAGAAAATGGTACAATTCTCACAAACTCT
GCAAGATATCCTTTGATGATTGATCCTCAATTATAGGGTATTACTTGGATTCGTGAAAAG
GAAAAAGCAAACAACTTGAAGATCCTTCGTCTTGGCTCAAAGAATATTAACAGAGATCTT
GAATTATCCATTGAAAATGGTTACTCTGCCATCATCGAAAATATGAATGAACGTATTGAT
GCTATATTGATGCCTATTATTGCACGTTCTTTCATTAAGAGAGGTAAAAATAAAATTATT
AAATTCGCTGGTAAAGATTTGATCCTTCACCCCAACTTCAAACTTTTCCTCCATACCAAA
CTTTCAAATCCTCACTATCCTCCTGAAATTTAAGCAGAAGCTGCTCTTATTAACTTCACT
GTCACAGAAGCTGGTTTAGGAGATTAACTTCTTTCTTTGGTCGTAGCTCGTGAACGTCCT
GATTTAGCTAAAATGAAGATTGAACTTATCACTCAACAAAATGATTTCAAGATTAAATTG
AAAGATCTTGAAGATGAATTATTATACAAGCTTGCTAATGCTAAGGGTGATATTCTTGAT
GATATTGAATTGATTGAAAATCTTGAATATTCTAAGAAGCTTTCAGTAGAAATTGCTGAA
AAAGTTGCAGCTGCAAAGATTACTGAAGCTAAGATCAATGAAACTTCTGAAAATTACAGA
CCCGCAGCTTCACGTGGTGCTCTTTTCTATTTCTTACTTTCAGATTTGTCAAAGGTTCAC
TCTTTCTACAAATACTCATTAGAATCTTTCATCGTTGTCATCAATCGTGCTATTGATGCT
ATTTCTGAAAATAAGATTTACGGTAAAACTACAATGGTTCCATATGGTGATGAAACCTAT
GCCTCAAATTAACATGAAAAAGAAGAAGAAGAAGAGGAAGAAGAACATTAATAAGCTCAA
TAATAATAGAATTAAGAAGAATAATAAGAATAAAAGGATGAAGAAAACAAAGGACCAGTT
GAAGAAGAATAGCCTGAAGGAGAAAATAAAGGGCCAGTAGAAGAAGAAGGAGCTGAAGGT
TAAAACGAAGGTCCTGTAGAAGAAGAAAATGCTGAAAACTAAGAAGGAGAAGGTGAAGAA
GAAGGAGAAAAACAACAAAAGGCAAAAGATTCTGATGAGCCTATGAGTCCCAGATCTTTG
AAGAAGCGTGTTGACGAACTAATTGAATCACTTACTTACACTGCATATCAAACCACTCGT
CGTGGTCTATTTGAAAGCCATAAGCTCATTGTTGCAGCTATGCTTTGTCTTAGAGTTTTA
TTGCGTTCAGAAGAACTTAATTCAGATGAAGTTGATCACCTCATCATTGGTAAAGTCGAT
GTCAATCCTACTCCTATGCCTGATGCTCTTAAATCATTCTTGAACGATAATATTTGGGCT
GCTTGCAAGGCTCTTGAAACTATTCATCAATTCTAAGGTTTCTGCTAATCTCTTGAAACT
GATGTTTTGTAATGGAAGAAGTGGTACAGTGAAGAAAAGGCAGAAACAGCTGATTTACCT
AAGGCCTTTAAGGAATTATCAAAGTTCCACAGATTACTTCTTTTACGTGCTTTACGTCCT
GACAGACTTCCATCTGCTTTGAGCTAATTCGTTCATGATAAGATGGGTGAAAGATATATT
GAATAACCTCCTTTCAATATCTTTGAAACATTCTAAGAAACTTCCAAAACAGTACCCATT
TTCTTCGTACTTTTCCCTGGTGTTGATCCTACACCTGATGTTGAAAGAGTCGCAGCTACT
TTTGATGTTTCCGCAAATAACGGCCGTTTCATTAATATTTCTATGGGTCAAGGTTAAGAA
GATAGAGCTAAAAAGGCTCTCTTTGATTGTGCTTAAAAAGGACACTGGATTATGCTTTAA
AATGTACATCTTATGCAAAGTTGGTTGTATGGACTTAATGGTCTTGAAGGTTTCCTTGAG
AGTGTGTTTGCTTCACCTAAAACTCATCCTAATTTCCGTGTCTTCATTTCTTCCGAACCT
CCTAATGTCTTACTTCCTCTTATGTAAATTATTCCTGAATCTATTTTACAAGGATCTCTC
AAGATTGCAAATGAAGCTCCTTAATATTTAAAGGCTAACCTCCGTCGTGCCTATAATAAA
TTCGATCAAGAATTCTTAGATAAATGTGATAAGAAACCAACTGAATTTAAGTCTTGTCTC
TTCGCTCTTTGCTTCTTCCACAGTCTTATGCTTGGACGTAAGAAATTCGGTACTTAAGGT
TGGTCAAGAGTATATAACTTCAATGATGGTGATCTTACAATTTGTGCAGACGTACTCTAC
AATTATCTTTCTAAGTATGACTAAGTACCTTGGGATGATTTACGTTACATTTTCGGTGAA
ATTATGTATGGTGGTCATATTACAGATGTAAAATTAATTTTATTTATTTTTGAAGCAATG
TTTATTAATTTTAATATTTTTTTAAAAAGGATTGGGATAGAAGAACAAATAGAACATATT
TGAAGGTATTGATTAGATCTGAATTGCTTCAATAAAACTTCAACTTAGCTCCTCAATTCA
AGTCACCTGATCCCAGTAAATTTGATTATGAAGCATATAGAAAATACATAGAAGAAAAAT
TACCAATTGAATCTCCTTAAATGTTTGGTATGCATCCTAACGCTGAAATTGGTTACTTAA
CATAGACTTGCGACTAGGTCTTTAATACCATCCTAGAAGTCCAAGGTGGTTCTTCAGGTG
GTGGTGCTTCTAAAAAGGATGATGGTGTCATGGTTACTTTAACTGACTTTAAGACAAGAT
GCCCTCACGATTTCAATATGCTTCTTATTGAAGAAAAGGTTAAAGAAAAAACTCCTTATA
TTGTTGTTTGCTTACAAGAATGCGAACGTATGAATGGACTACTTAAAGAAATAAAGACTT
CATTGGAAGATCTCCGTCTTGGTTTAACAGGTGCACTTAACATGACAGATGCTATGGAAA
GCTTACAATAATCACTTTCTTTCAACAAGGTTCCAGACACTTGGGAAAAGAAGGCTTATT
TCTCTAAAAAACCATTATCTTCTTGGTTTGCTGATCTTATTGAAAGAAATATATAACTCT
AAGAATGGTGTAAAGAATTGGTTACTCCTACCTCTTTATGTATTTCATATCTATTCAATC
CTATGTCTTATCTTACTGCTATTATGCAGTTCACAGCAAGAGCTTAGGGATTACCTCTCG
ATGGTGTAAATAAAATTTTTATTTTTATTCAAAAATAGTTTTTTGGTTATCATTTAAATA
TCATTTTAATATTTAATAATATAGATCACTATCTAAACTAACGTTACTGCTATGAAGGGT
CCTGAAGATGTTGTAAATCCAGCTGAAAATGGTGCTTACATTCACGGTCTCTTCTTAGAA
GGAGCTGCTTGGGAAATTGGTGGTTAAGGACAAGATGGTTACTTAATTGAACAAAAACCA
AAAGAGTTACATCCTAAGATGCCAGTTATAAATGCAGTTGCAGTTCCTCTTGATAAAAAG
AAGAAGAATGGTTAATATGACTGCCCAACTTATGTTACTTCTGCCAGAGGTCAAACATTT
GTATTCACTGCTAACTTAAATATGGAAAGTGATGATTCTGACCCTAATAAGTGGATTCTC
TCAGGTACTTGCATGCTTATGAGTGATGATTGA