Identifiers and Description

Gene Model Identifier

TTHERM_01276420

Standard Name

DYH3 (DYnein Heavy chain )

Aliases

PreTt28305 | 304.m00025

Description

Dynein heavy chain family protein; Heavy chain subunit of ciliary three-headed outer arm dynein (OAD); serves to position the dynein complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF00004 ) ATPase, AAA family
  • ( PF03028 ) Dynein heavy chain
  • ( TIGR01257 ) rim ABC transporter
  • ( PF07719 ) tetratricopeptide repeat
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( PF02841 ) Guanylate-binding protein, C-terminal domain
  • ( TIGR00449 ) tRNA-guanine transglycosylases, various specificities
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01276420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_47380
WormBaseWBGene000009629.997093137033517e-262locus:dhc-1 Dynein heavy cha
in, cytoplasmic status:Parti
ally_confirmed UniProt:Q1902
0 protein_id:CCD64267.1
Tetrahymena borealisEI9_21062.19.997093137033517e-262dynein heavy chain family prot
ein (4617 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig1360.1.g269.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28069381: Edamatsu M (2017) Establishment of a mutation system in Tetrahymena outer arm dynein and P-loop functions of the alpha heavy chain (Dyh3p). Biochemical and biophysical research communications 483(1):24-31
  2. Ref:14983522: Toba S, Gibson TM, Shiroguchi K, Toyoshima YY, Asai DJ (2004) Properties of the full-length heavy chains of Tetrahymena ciliary outer arm dynein separated by urea treatment. Cell motility and the cytoskeleton 58(1):30-8
  3. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  4. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  5. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  6. Ref:10568033: Xu W, Royalty MP, Zimmerman JR, Angus SP, Pennock DG (2000) The dynein heavy chain gene family in Tetrahymena thermophila. The Journal of eukaryotic microbiology 46(6):606-11
  7. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_01276420(coding)
ATGCTGTCCTCAAAGTACTCAAAGAGAATAGCATGGATGAAGACTACCATTTGTGATAGT
CTTCAACTTAAGGATATGATTGTCGAAGAATCATTTTAATATGAGAAGAATAAAAATTTG
CTTGAGTAATTCTTAAGCGGAGAAGGTTTAAATAAGATCTTCGCTTACTACCAAGTATAA
GAATAAGCTTAAAACGATGATATTAAAGATACAGGTGCTCAAGATCCAGTCTTGTTTTTC
ACTACCGGAGACCTTGAAAAGATTCAAGATAAAGCAGTTTGGTTCTTGCGTATCACAAAT
CCCGCTGATGATAAAAAGAAAGCATCATAATAGGATGGTAATGACAATGATATCATTTTT
GGTGAAATCACTCCTAATACAGTTCCTATGTTAAATGCTTTAATGGAAAGTGTTTACTCT
CGCTAAATTGATCATATTATTACTGAAAAAATCTAATTTTGGGGAGTAGCTGAAGAAGAA
CAAGTTTTAGAATTCTAACAACACTCTAATAAATTCTCCAGTGAAGTTAGAGAAGCTATT
AATTTAATGAGTCCTGGTACTGAGCACTTCAAATTAGATTATGAAGCTATCTCAGGATTA
AGTGAATCTGAAAAAATGCAACATTATGAAATGAAGTTTAATGAGTGGATCAACCTCATA
AGCAGCTAGCTCAATGATGACTCAGAAGTTCGCAAAGATGAAAAAGATGCAGGCCCTGCT
ACTGAATTAATTTATTGGAGAAGTAGAATGCAAAAGATCACAAATTGGTCTGAATAATTA
AAGAGCAAAGACTTCTAAATTGTTAAAGCAAGCCTCTAACGTCATAAAAATCATGATAAT
CAAAGACCACGTGGTGATGAATCACTCTCTAAACTAATGATGGAATATAATCGTTTGGAT
CTATTGCTTACTGATAAACTTAACGAAGCCAAAGATAATGTTAAATATTTAACTACTCTT
GAAAAGTTTATTGAGCCTCTCTATAATGGTACTCCTCAGCAAATTATTGATACCTTGCCT
GCCCTTATGAATGCAATCAAGATGATACACACTATAGCTAGATTCTACAATACTACTGAT
AAAATGACAGGACTATTTATCAAGATCACTAACTAAATGATAAAGAATTGCAAAGATCGC
ATTCTTAACAAAAAAGATAATGGTGATAATCCTTCCCTATACAAAATGATTTGGGAATAA
GATCCAGCTGAACTCATTGAAGTTTTAGGATCCTGCATTAAACTTTATTGTGAATATAAA
AAATGCTACAATGATACCAAAGAAAAAGTTGCTGATATGCCTAAGGGTAAGACTTTTGAT
TTTTCTGATGCTTAAATTTTCGGAAAATTTGATACTTTTGTAAGAAGATTATAAAAATTG
ATTGAAATCTTCTCTAACATCCAACAATTTAATGCCCTTGCTAAACACAATTTAGAAGGT
ATGGATGTCTTGACCAACAAGTTCAAAAAAATTATTGATGACTTTAAAAAGAAAGGCCAC
AATTTATTAGATACTGCTAACAATAAATTCGATAGAGATTGGGTTGAATTTAATGTTGAA
ATTTCTCACTTAGACGGTGAATTATAAAACTTCATTGATAACAATTTCAACCGTTTCAGA
AACATTGAATATTCTCTAAAATTGCTCCATAAGTTCCAATCTACAATCAAAAGAGATTCT
CTCAAGCACAATTTAACTTCTCGTTACAATGCTATTTTGCACAATTATGCTACTGAGTTA
GATACTATTTAACGTGTCTTCCAAGATTAAAAATCCAATCCCCCTCTTGTTAGAAATATG
CCACCTGAAGCTGGTAAAATTATTTGGGCTCGTCATTTATTCTAAAAGATTACTGGACCT
ATCAATATTTTCCCTGAAAATGTTATCAACTCAACTGAAATCCGTCGTTATTATGGTTCC
TACAACACTCTTGGTAAGTAGTTAACTATTTATGAAATGTGGTTCTATCAAGACTGGGTC
AATAAGATTGAACAATCTAAGGCTGCTCTTCAAGCTACTCTTATTGTTCGTCACGACGAA
AACAAGAAGCTTTATGTTAATTTTGACTTAGAAATTATGCAATTAATCCGTGAAGCTAAG
TGCTTAGATAGACAAGGCATTGAAATTCCTGAAAGTGCTCGTATTATTCTTTTGCAAGAA
GATAAATTTAAGACTTACTATAACGAACTTCTTTATGCTCTTAAAGAATATGAGCGCATT
AACTCCAAAATTAAACCTATTTGTAAGAATTTGCTTCTTCCTCATATTGAAGACTTAGAT
CTTAAGCTTCGTCCTGGTATGGTTACTTTAACTTGGACTTCTATGAACATAGAAAGCTAT
TTGTACTATGTTCACTAAGGTTTGAAGAAGCTAGAATAACTAATCATTAACGTTAATGAT
ATTATCGAAAATCGTATTGAAAATAATTTAAAGACTGTTTCTAAGGTTGTTCTTGTCCAC
CTTCCTCAAGATACTAAACCTCTTTCATTGGATTCTTTCGTCCAACTTCAAGAAGAATAT
ATTAATTCAAAGACCGATTTCTTAACTTCTAAGAACGTTGAAGTTGAAAGAGCAGTTGAT
GATTTATTATAAACTATTATGCTCTATCCTTTAGACCCTCATGTTGATCCTGTTCTCCCT
GAAGAAACCAAACGTATTAAGAGATATTATTTCTGGTATTTCTATCAAGCTTTACTTAAT
TCAACTTAAAATTCCTTAAATGCAATGAAGTATCGTGTTTGCGGTAAGAAGATTCCTGGT
GCTAACACTTTGTAAAACTTAAAACCTTTCTTCTAGGTAGAAGTTTAATTAAATGGAGAT
AAAGTAACCCTTAACCCTTCTTTGCAAGAAATTTAAAAATCTATTAACCGTGCTGCTACT
GCTGTCCTTAGATGCTCAAAGCACTTATATAATTGGGACTAATAGAATAAGGATTCTACT
GATAAGGCAACATTTTACGATATGATTGCTTGCGACAAAGAAATTGTTAAAGTCATTTTA
CTTTTGACTGGTTCTATTTAGGGAACTAAAAACAAAGTCAATGAATTCTTAAGCGGATTT
ACTAAATTTGAATGGTTATGCAAGGAATCCATCCAAGAATCTATCAAGAAATTCTCTAAG
AATGGACCTACACTTCAAAATTATGAAGACTAATTAAAAAAATTCTCTTAAATAGAAGAA
GAAATTGAAAAAATTGTGCCCACTTACAAAATCGGAGCTATGGAATTGATGACTCATAAT
ATTTGTACTTCATTATCTACTTGGGCCAAAGAATGGAAGCTTTAGTACTCCTAAGATTTA
CACAAGCGTGCTCGTTAACTCTTAGATAGTCTTACTGAATAAACTAAAATGCTTTCTACC
AAATTATCTAAGCCTGTCAAGGATATTGACTCCCTTGGTTATGTAATGGAGACCTTAGAA
TAAATTCGTAAAGAACAAGCAGAAATTGACATGAAGTTTAATCCTGTCTAAGAAATGTAT
TCCCTCCTTGATAACTATTTACCAGGAGGTATTACTGATAAGGATGAAATGGATGCTCGT
TCTCTTTTACGTAGAAATTGGGATATTCTTATCTAATAAGCTGAAATTAAAGGTAAAGAA
TATCAACACAAGCAAGCAATTTATCTGAAGGAACTTAAGCAATCAATTAAAGACTTCACA
AACTAAGTAAGCATCTTTAGAAGAGATTATGAAAAGAATGGTCCTATGGTTGAAGGTATC
AGTCCTGCAGAAGCCATGGAAAGACTCAGAAGATTTGAAGATGAATATGATGTTAAGTAC
TAAATGTACAAAATCAATGCTAGAGGTGAAAACTTATTCGGTTTACAAAATCAAAAATAT
CCCGAATTAGAAAAGACTGATGCTGAAATCAAGAACTTAAACAAACTATATAATTTATAT
GACTCAGTAATTAAGAATATCTAATAATTCAAAGAAAAATCTTGGTAAGATGTTAGTAAA
GATGATTTGGCAAAGATGGAAGAAGATGCAGGTAAATATGGTGAATAGTGCAGTAGATTA
CCAAAAGACTTAAAAGAATGGTAAGCTTATCGTGATCTTAAAAACTATATCGATTCTCTA
AGAGAATAATTACCTTTGATTATAAGTTTGAAGAAACCATCTATCATGCCTCGTCACTGG
GAAAAAATTAAAGAAATTACTAACACAAAGCTTAACTATGAAAACCCTGATCAATTCTAC
ATTGAAGAAATTATGGGAGCCAAATTACTTGATTTCAGAGAAGATATCGAAGATATCACT
GAATCTGCTGATAAATAATTAAAGATCCGTACTGGTTTAGATGAAATTAATCTTTACTGG
AATGATATGTAATTCTAGTTTGGTATTTGGGGTAAGAGAGATGTTCCTTGTATGCTTAAT
GGTCTCATTGTTGGTACCATTCTTGAAAGACTTGAAGAAGATTAACTTTAATTATCTACT
TTCAACTCCTAAAGACATGTTACTCCCTTCAAAGCAGAAGTTGAAAATTTGATCCGTACC
TTCTCTGACGTTAATGATACTCTTGATATGTGGGTTAAAGTACAAAAGTTGTGGACTTCA
CTTGAACCAGTTTTTACTGGTGGTGATATTGCCCGTTAAATGCCTTTACAAGCAAAGTAA
TTCCAAGGTATTGATAAAAATTGGATGAAAATTATGGAAAAAGCTGTTGAAACAAAGAAA
GTTATACCTTGTTGTCAAAATGACATGCTCAAGGATTTCTTGCCGGATCTTAATAGAAAG
TTAGAAGACTGTTAAAAAATGTTAGAAGCTTATTTAGAAGGTAAAAGAAAGAAATTCCCT
AGATTCTACTTTGTTTCTAACCCTACTTTATTAAAGATTCTTTCACAAGGTTCTGAACCT
ACTTCTATCTAAGAAGATTTTGAAAAGCTTTTTGATGCTATCACAAAAGTTACCTTTGAA
AGTGCCAAAGACAAGAAAAATCCTGCTCTTAAGCAAATTACTTAAATCCAATAAGTTATT
GGCCGTAATGAAGAAAATATTTCTCTTACTGGTTACTATGTTAAGTGTGAAGGAAATATC
GAAGACTGGCTAAAGAAGCTTGAATAAAATATGTAGCAGACTTTGAAGGATATTGCAAGT
GCTGCTGCATAACAAGTTTTCTAAGTTGGTTTGAAAGAGTTCGTTAGCTCTTAAGCCTCT
TAAATCGCTCTTCTTGGTCTTTAAATACTTTGGACATCAAAAGTTAATGAAGGTTTAGAA
AGACTTTCCCGTAACGAACGTAATGCTATGGATATTAAGAGAAATGAAATCAAAGAGCAC
ATGAATATTTTGTCAAGTATGTGTCTTGAAGATCTTAATGGTGCTGTCGAAAGAACTAAA
GTTGAAACTTTGGTCACAATTTAAGTCCATTAAAAAGATATTTCTATGGACTTGAAATGT
AAAGATGTCAATGATTTTGAATGGCAAAAGCAAACAAGAATTGCTTGGAAAACTGATATT
GATGAATGTATTATTTCTATCACTGATTGGGATTCTCCTTACTCATACGAATTCTTGGGT
GCTAAAGAGCGTTTATGTATTACTCCTCTTACTGATAGATGTTACATTACATTGGCTCAA
GCTATGTCTATGTACTATGGTGGTGCTCCTGCTGGTCCTGCCGGTACTGGTAAAACTGAA
ACTGTCAAGGATCTTGGTAGAACTTTGGGTGTCTTTGTCGTTGTCACTAATTGTTCAGAT
TAACACAGATATCGTGATATGGCTAAAATTTTCAAAGGTTTGGTTTAGAGTGGTCTTTGG
GGTTGTTTCGATGAATTCAATCGTATTGATTTGGAAGTCTTATCTGTCGTAGCAATGCAA
GTTGAATCAATTACAACTGCCAGAAAGTAACACATGAAGAAATTCATGTTCCCTGAAGAA
GAAATTGAAATTGAACTCATTCCAACTGTCTCTTACTTCATTACAATGAATCCAGGTTAT
GCTGGTCGTTAAGAATTGCCTGAAAATTTGAAAGTTCTCTTCAGAGGTGTATCTATGATG
GTTCCCGATAGAGAAATTATTATTAAGGTCAAGCTTGCTTCAGTAGGTTATCTTTAGATT
GACTTGTTGGCAAAGAAATTCAATGTCCTTTACAGATTGTGTGAAGAATAGCTTTCCAAG
TAGCGTCACTACGATTTTGGTTTACGTAATATCCTTTCAGTACTTAGAACAGCTGGTAAC
ACCAAGCGTTAAGAAATTAAGTCAGATGAAGAAATGTTACTGATGAGATCATTAAGAGAT
ATGAATCTTTCAAAGTTAGTTGCTGATGATATTCCTCTATTTAATGGTTTATTAGCTGAT
ATTTTCCCTAAATTAAAGGAAGTACCTAAGAAACTTTATCCTGATGTTGAAAAGAAGATC
CCTGAAGAAATAAATGCTGAAAGTTACTTGATTAACACACCTTCTTTCTAATTAAAGATT
ATTCAACTTTATGAAACCTGCTTGGTGCGTCACGGTTTTATGCTTGTCGGACCTACTGGT
TCTGGTAAATCAACTATTATGAAAATATTGACTGAAGTATTGACTAAGTTAGGTAGTCCT
CATAAAATTGTTATAATGAATCCTAAGGCCATCACTGCAGAATAGATGTATGGTGTCAAA
TCAGAAATTTCTGATGATTGGATTCCTGGTGTTTTCTCTACAATTTGGGCTAAGTCTAAT
AATCGTGCATTAAAGCATACAACTTGGATTACCTGTGATGGTCCAGTCGATGCTATTTGG
ATTGAAAATTTAAATACAGTACTTGATGATAACAAAATTCTCACATTAGCCAATGGTGAA
AGAATTGCTATGACTGAAAATTGTAAAGTCGTTTTCGAAGTAGAAAACTTAAACAATGCT
TCTCCTGCTACTGTATCTCGTTGTGGTTAAGTTTACGTTTCACCTACAGATTTAGGCTAT
GAAGCTGTTATTGAAGGTTGGATTCGTAACAGAAAAGCAAGTGGTAGAGCTGAAGAATCT
GATAAGCTTGGAAACATTTTGCGTAAATATTTAATCAATATGAGATTTATTGAATTACAA
AGCAAGGAATGCAAAGAGCCTATGATGGATACTTCTCCAGTTATTTCAGTTATTAACATT
CTTAACTTACTAACAGGTTGCTTATAATATTTCGTTCAAACATAACGTACTCTTTCTGAA
TAAGAATACGAAAAGTTTATTGTATACTCAATGGCATGGGCTATTGGTGGTATTTATGAA
GCTTAAGATAGAGTTCGTTTCCATGAATTGCTTCTTGCTAAGAATGCTCCAATCCCATAA
AAAGGTAAGGAAAATGAAACAGTTTTTGACTATTATGTTTCTTAGGATTACCTTGACTGG
AAGATTTGTAGTCCTGAAGAATGGGTTCCACCCCAATCTTTGTAATTCTCTCAACTTTTG
TTGCCCACTCTTGATTCTTTCCGTGCTGAAATGTTATTAAATTTCATTTTAACCTAACCT
AAGAGTCATACTTGCTCTAATTCAGCTCTCTTAATTGGTGGTTCTGGTACTGCTAAGACT
TCTTCAGTTCTTCTTTATTGCAACAAGTTTGATCCTCAAAAGATGCTTTTCAAGCGTACT
AACTTCTCATCTGCAACCAGTCCATTTATGTTCTAATCAACCATTGAAGCTGAATGTGAT
TTCAAGGTTGGTAAAGAATTTGCTCCTCCTGGAAACAAAATGATGACTATTTTCATTGAT
GATATGAGTATGCCCTTCGTAAATAAATGGGGTGATTAAATTACTTTAGAACTTGTCCGT
CAACTTATAGAAACTGGTGGTTTCTATATGTTAGATAAAACTCAAAGAGGTAACTAACGT
AAAATGAAGAACTTGCAATATATTGGTGCCATGAATCATCCTGGTGGTGGTCGTAACGAT
ATTCCCAATCGTCTCAAACGTTAATTCTTTATTTTTAATATGATTTTACCTCTTTCTATC
GAAGGTATTTATGGTCCTATTATTAAGCACATGTTCAAGCAAAAATATTTCTCAGATTCT
ACATACAAAGTTATTGAATCCTTAACAAGTGCTACCATTGCTCTCTGGAATAAAGTAAAG
AGCACAATGCTTCCTACTCCTGCTAAATTCCACTACGTATTTAACATGAGAGAATTGTCT
CGTATCTTTAAGGGTATTTTGACATGTAAGAAGGATACTATTAATGATGCCCCTAAATCA
ATGAAGATTAAACCTGAACTCTTCCTTGTTGGATTATGGCGTCATGAAGCTGAACGTGTC
TTGGCTGATAAGTTAGTCAACAATAAAGATAAAGACACTGTTATGGGATACATTTAAGAA
GTATCTTTAGAATCCTTCTCATAAATCGAAAATGAAATTCTTGAAAAGTATTCTTCTGAA
AAAACTTTCTTATTCTGTGATTTCCTCCGTCCTGATGTTATCAATGAAGATGGTATTATT
GAAGAAGAAGCTCCTAAAATTTATGAAGCTATAGACAGTCTTACTGAATTAAGAAAGCGT
TGCAATTTCTTACTTAGCTTCTATAACGATCGTAACCCTTCAAAGAAAATGCCACTTGTG
CTTTTCGATGATGCACTTAAACATTTGTTACGTATTTCTCGTATTATTCGTTAACCTCGT
TCTAGTGGTTTACTAGTTGGTGTTGGTGGTTCTGGTAAATAGAGTTTAACCCGTCTTGCT
GGTTTTATTGGAAAAAATTTAATATAGCAAATTATTGTAACAAAAACTTATTCTGATAAA
GATCTTAAAGAAGATATCAAGAAAGGTTTTGATGATGCAGGTCACTTGGGTAAGTAAGTT
ACCTTCCTTATGACTGATTCAGAAGTAAAGAAAGAAGAATTCTTAGAATATATTAATATG
GTCTTATCTACCGGTGAAATTCCAAACTTATTAGCAAAGGATGAACGTGAGGTATGGCTC
GGTGATATCAGTCAAGCTTATTGCAAAGAAAAGAATTTGGGTAACATTGATCCTCCTTAA
TCTGAACTTTGGACTTATTTCGTTGATCGTGTTCGTGATAACTTCCATATTATGCTTTGT
TTCTCTCCTGTTGGTCAGAAATTCCGTGAAAGAGCTCGTAAATTCCCTGCCCTTTTCAAC
GAATGTACTATTGATTGGTTCCTTCCTTGGCCAGAAGAGGCTCTAGTAAGTGTCGCTGAA
ACATTTATCAAGAACTTTGACAAGTTAGACACTAAAGAAGAAACCAAGTAAGAACTTATG
AAGCACATGGGTAATGTCCATTTGATGGTTAATGAAATTTGTGATGAATATTACCAAAAG
ATGAGACGTTAAGTCTACGTTACACCTAAGTCCTTCTTGTCTTACTTAAATTCATACAAA
ACTCTTTACATTGAAAAGTATGATGAACTTGATTAGTAAGAAGAATCATTTAAGATTGGT
CTTAATAAAATTTAAGAAGCTACTATAACTATCAACTAGATGGAAATTTCCCTTAAAGAA
GAAGAAATTTAACTTAATGAAGCTACTGAGAAAACCAATTAACTCCTTGCCAATCTTGAT
AAGGAAAGTAAGAAAGCTAACTAAAAGGGAGAAGAAGTTGCAGCTACTAACAAGTAATGT
GAAATTCAAGCTGAATAAATCTCTAAAGAAAAAGAAGAAGCTGAACGTGAACTTGAAGCT
GCCCTTCCTGCTTTGCGTCGTGCTTAAGAAGCCGTCGACTCTATTGAATCAAAGGATATT
GTTGAATTGAAGGCTAACAAGAAACCTCTTGATATTATTAAATACATCATGGATGCTGTA
CTTGTCTTTTTCAAGGCTCGTTTAATTCCCATTCAAATCGAAGAGCGTGTTTTCAACAAA
AAGGAAGGAAAGGCTGTTCTTTTCTTGAAAGAATCTTATGATGAATCTGGTATTTAAACT
CTTGGTGATATGAACTTTATGAAAAAATTAAAAGAATTCGAAAAAGACTCAATTAATGAA
GAAACTATTGAACTTCTTGAACCTTATCTTAATCAATCTGAAGATTGGTTTAATGATACT
TTTGCAACCAAGGCATCTAAGGCTGCTGCTGGTATCTTGAAATGGGCTTTCGCTATTTAT
GAATATCACTAAAAATCTAAGATTGTTAAACCTAAGCGTATTTAGGTGGCTATTGCAGAA
GGTAGACAAGCTATTGCACTCAAAGAACTTGAGAAGGCTCGTGAAGATCTAGCACAAATT
CAAGCCTATATTAAAAATCTTAAAGATGTCTACACTAAATAAATGGAAGAAAAGAATGAA
CTTGAAATGAAAGCTGCAAAGACCAAGAAGAAAATCAATACTGCTCGTACTTTGATTACT
TCTCTTTCAGGTGAAAAAGATCGTTGGGGCAAAGGTGCTTAAGATATTTCTGATCAAAAG
CGTAAATTAGTTGGTAACGTTTCTCTCTCAACTGCCTTTATTAGTTATTGTGGTCCTTTC
AATGCTGAATATCGTAACAAGCTTGCCCAATAAAGATTTGTTGTTGATATGAAGAAGCGT
GGTGTTCCAGTCACACCTGGCCTTGAATTAACTTCTTTCTTAATTGATGATGCTACTATT
GGTGAATGGAATCTTCAAGGTCTTCCTAAGGATGATTTATCTATCCAAAATGGTATCATG
GTTACAAACTCTGCTCGTTATCCTCTCTTCATTGATCCTCAAGGTCAAGGACAAAATTGG
ATTCGTAACAAGTTGTCTGCTTCAATTATCCCTGAACGTTGTATCACTACTCTTTCTCAT
CCCAAATTTAAGGATATGTTCTTGAAGTACTGTATGGAAAGTGGTTTAACTCTTATTGTT
GAAAATATCGAAAACGAAGTTGATCCTATGATGGACCCTGTACTTGAAAGATAAATTATT
GTTAAAGGTAAAACTTAATTCGTTAATGTTGCAGGTACAGAAATGGAACTTTCTAAGGAA
TTCAAGCTATTCATGACTTGTCGTCTTGCAAATCCTTCATTCTCACCTGAACTTTCAGCA
AAAACCACCATTATTGACTTTACAGTCACTCAATCTGGTTTAGAATAATAACTTCTTGGT
AAAGTTATTTCTAAAGAATAAAAGGCTCTTGAAGATTCTCTTAACTAGTTACTAGCTGAC
GTAAACCAAAACCAAAAAGATCTTCAACGTTTAGATAAGAACTTGCTAGAACGTCTTATT
AATTCTCAAGGTAATCTTCTTGATGATACTGAGCTCATGGATGTGCTTAATAATACCAAG
ACTCAAGCTAAGGAAGTTGCAGCTAAACTTATAGATGCTGAAATTAAAACAAAAGAAATT
AATGAAAAGAGAGAACAATATCGTCCTGTTGCTATTAGAGGTTCTGCTATTTACTTCACA
ATGATTGAAGTTTCTTTGGTAAATTGGATGTACAATTCATCTCTTGAATAATTCTTAAAG
CTTTTCATTGAATCAATAGATCTTTCTGAAAAAGCTCAACTCCCTTCCAACAGAGTTAAA
AATATTATTTCTTTCTTGACATTCCACGTCTACAGATATGTTAATCGTGGTCTTTTCGAA
AAGGATAAAATTACTTTTATTCTTATGATGGCTTTCAAGATTCTTACAACTGCTGGTACT
ATTTCAAGTGGTGATGTCTCTCTCTTCCTCAAGTCTGGTGATGCCCTTGATATTAAGTCT
GAACGTTAGAAACAAATATCATACCTTGAAGATAATTAATGGCTTAACATATTGGCTCTC
TCCAAGCACACTTTCTCAGGATAAACACTTCCATTCTTCAAAGAACTTCCTGATCTTATT
TCTCGCTCTGAAAACTAATGGCGTAATTGGATAGATAAGAACGATCCTGAAAATTTCCCC
ATTCCAGACTTTGCAGAAAGCATTAACCAAGAAAAGGAAATTGGTTCATTCATTTCACTT
TGTCTCGTTCGTTCATTAAGAAATGATCGTACTTTAATTGCAACATAAAACTTTATTTCT
AATGTACTTGGTAAGGAATTCACTGATCCTATTTCTTATCCTATTGAAGGTATCTGGTAA
GAATCTTCTAATATGGATCCTGTTCTTTTCTTACTTTCTGCTGGTGCTGATCCCACTTCA
TCAATTGATGAGTTAGCTAAGAAAAAGAAGAAATTCCCTTGTGAAAAAGTTTCTATGGGT
GAAGGATAAGAAAGAGTTGCTCGTTAAGTTATCATGAAAGGCTTCGTTGAAGGTGGTTGG
GTTATTCTCTAGAACTGTCATCTTGGTCTCAAGTTTATGGAAGAAATTGAAACTTTAGTC
TCACCTATTAACTAAATTCATGAAGATTTCCGTCTTTGGATTACTTGTGAGTAGCATCCT
AAATTCCCTCTTGGTCTTCTTTAAAAAACTCTCAAGGTTACTAATGAACCTCCCAAAGGT
CTTAAGGCTGGTCTTTACAAAACATTTACTACCATCATTACTCAGGAATTCATAGATAAG
GTTGATCACTCTAACTGGCGTTCTCTTATCTTTACTATTTGTTTCCTTCACTCAATTGTC
ATTGAAAGAAAGAAATTCGGTCCTCTCGGTTGGTGTGTACCTTATGAATATAACTACTCA
GATCTAGAAGCATCTCTCTTATATATTGAAAAGTATCTCACTAACTTGATGTCAACTCCT
CAACCTAACTCTCATAATCTTCCTATCTCAATGAATGTCGTTCGTTATATGATTTGTGAA
GTACAATATGGTGGTAGAATTACTGATGATCTTGATCGTGAATTGTTTATTACTTATGGT
GAAACTTATCTCAAGGATGGTATTTTCGGTAATGATTACTTCTTCTACGATATTATGGTT
GATGGTTCAGGTTAGAAGTTCAAATACAGAATTCCTCAAAACCCATCTGCAGAACTTATT
AAGTATTAAGAATATATTGCTAAGGTTCCTACAGTTGATAATCCTGAAGTTTTTGGTCTT
CACTCTAATGCTGATTTAACTTTCCGTCTCAAAGAAAGTAAGGAAATGATTAACACTGTT
ATGGAAACTCGTCCCAAGGATTCTTCAGTTGGTGGAGGTAAGACAAGAGAAGAAATTGTC
TAAGACAAAGCCAAAGATATGCTTAAGAACCTTCCTCCTGATTATAATGATGTTGAAGTA
AGAGAACTTGTTTCTAAACTTGGTGGACCTAATCCAAAGACAAGTACTGAAAGAGGTATG
ACAGTTCCTCTCAATATTTTCTTGTATCAAGAAGTTACCCGTATGCAAAGAGTTATTGGT
TTAGTTAGAAAGACTCTTCAAGACACTATTCTAGCTATTGATGGTTAAATTATTATGACA
CCTGAAATTCTTGAAGCTATTAATGCCATTTATGATGCAAAGGTACCTAACTCATGGTTA
TATGATCCTTCTGGTGCTGAAATTTCATGGCTTCTTCCTAACCTTGGTTCATGGAGTACA
TCTTTGTCTGATAGAAATAAATAACTCAATGATTGGTTGCGTAGTGGATAGAGACCTATA
TTGTTCTGGTTGACAGGTTTCTTCAATCCTCAAGGTTTCCTTACAGGTATGAAGTAAGAA
GTAACAAGAAACCACAAGAAAGGTGATGGTAAAGGTGGTGAAGCTTGGTCACTTGATGAT
GTCGTCTATTCAACTACAGTAAAAGAGAGAGAAAAAGAAAAAGATATTGAATAGCCTCCA
GCTGAAGGTGTCTACATTAAAGGTCTCTATCTCGAAGGTTGTAAATGGAGTAAGAATGGT
CTTGATGACAGTGATCCTAAAAAGATTTTCGCAGATCTTCCTATTCTTCACGTTAGTGCT
ATAAATAAGAAGAAAACCAACGAACAAGATAGAATGTCAAATACATATCTCTGTCCAGTA
TATAAGTATCCCAAGAGAACAGATAAATATCTCATTTTCAGAGTCGGTTTACCTTGTGAA
GGTTCAAACAATCCTTCCCATTGGAAATTAAGAGGTGTTGCTCTTCTTTGTTCAACTGAG
TGA


>TTHERM_01276420(protein)
MLSSKYSKRIAWMKTTICDSLQLKDMIVEESFQYEKNKNLLEQFLSGEGLNKIFAYYQVQ
EQAQNDDIKDTGAQDPVLFFTTGDLEKIQDKAVWFLRITNPADDKKKASQQDGNDNDIIF
GEITPNTVPMLNALMESVYSRQIDHIITEKIQFWGVAEEEQVLEFQQHSNKFSSEVREAI
NLMSPGTEHFKLDYEAISGLSESEKMQHYEMKFNEWINLISSQLNDDSEVRKDEKDAGPA
TELIYWRSRMQKITNWSEQLKSKDFQIVKASLQRHKNHDNQRPRGDESLSKLMMEYNRLD
LLLTDKLNEAKDNVKYLTTLEKFIEPLYNGTPQQIIDTLPALMNAIKMIHTIARFYNTTD
KMTGLFIKITNQMIKNCKDRILNKKDNGDNPSLYKMIWEQDPAELIEVLGSCIKLYCEYK
KCYNDTKEKVADMPKGKTFDFSDAQIFGKFDTFVRRLQKLIEIFSNIQQFNALAKHNLEG
MDVLTNKFKKIIDDFKKKGHNLLDTANNKFDRDWVEFNVEISHLDGELQNFIDNNFNRFR
NIEYSLKLLHKFQSTIKRDSLKHNLTSRYNAILHNYATELDTIQRVFQDQKSNPPLVRNM
PPEAGKIIWARHLFQKITGPINIFPENVINSTEIRRYYGSYNTLGKQLTIYEMWFYQDWV
NKIEQSKAALQATLIVRHDENKKLYVNFDLEIMQLIREAKCLDRQGIEIPESARIILLQE
DKFKTYYNELLYALKEYERINSKIKPICKNLLLPHIEDLDLKLRPGMVTLTWTSMNIESY
LYYVHQGLKKLEQLIINVNDIIENRIENNLKTVSKVVLVHLPQDTKPLSLDSFVQLQEEY
INSKTDFLTSKNVEVERAVDDLLQTIMLYPLDPHVDPVLPEETKRIKRYYFWYFYQALLN
STQNSLNAMKYRVCGKKIPGANTLQNLKPFFQVEVQLNGDKVTLNPSLQEIQKSINRAAT
AVLRCSKHLYNWDQQNKDSTDKATFYDMIACDKEIVKVILLLTGSIQGTKNKVNEFLSGF
TKFEWLCKESIQESIKKFSKNGPTLQNYEDQLKKFSQIEEEIEKIVPTYKIGAMELMTHN
ICTSLSTWAKEWKLQYSQDLHKRARQLLDSLTEQTKMLSTKLSKPVKDIDSLGYVMETLE
QIRKEQAEIDMKFNPVQEMYSLLDNYLPGGITDKDEMDARSLLRRNWDILIQQAEIKGKE
YQHKQAIYLKELKQSIKDFTNQVSIFRRDYEKNGPMVEGISPAEAMERLRRFEDEYDVKY
QMYKINARGENLFGLQNQKYPELEKTDAEIKNLNKLYNLYDSVIKNIQQFKEKSWQDVSK
DDLAKMEEDAGKYGEQCSRLPKDLKEWQAYRDLKNYIDSLREQLPLIISLKKPSIMPRHW
EKIKEITNTKLNYENPDQFYIEEIMGAKLLDFREDIEDITESADKQLKIRTGLDEINLYW
NDMQFQFGIWGKRDVPCMLNGLIVGTILERLEEDQLQLSTFNSQRHVTPFKAEVENLIRT
FSDVNDTLDMWVKVQKLWTSLEPVFTGGDIARQMPLQAKQFQGIDKNWMKIMEKAVETKK
VIPCCQNDMLKDFLPDLNRKLEDCQKMLEAYLEGKRKKFPRFYFVSNPTLLKILSQGSEP
TSIQEDFEKLFDAITKVTFESAKDKKNPALKQITQIQQVIGRNEENISLTGYYVKCEGNI
EDWLKKLEQNMQQTLKDIASAAAQQVFQVGLKEFVSSQASQIALLGLQILWTSKVNEGLE
RLSRNERNAMDIKRNEIKEHMNILSSMCLEDLNGAVERTKVETLVTIQVHQKDISMDLKC
KDVNDFEWQKQTRIAWKTDIDECIISITDWDSPYSYEFLGAKERLCITPLTDRCYITLAQ
AMSMYYGGAPAGPAGTGKTETVKDLGRTLGVFVVVTNCSDQHRYRDMAKIFKGLVQSGLW
GCFDEFNRIDLEVLSVVAMQVESITTARKQHMKKFMFPEEEIEIELIPTVSYFITMNPGY
AGRQELPENLKVLFRGVSMMVPDREIIIKVKLASVGYLQIDLLAKKFNVLYRLCEEQLSK
QRHYDFGLRNILSVLRTAGNTKRQEIKSDEEMLLMRSLRDMNLSKLVADDIPLFNGLLAD
IFPKLKEVPKKLYPDVEKKIPEEINAESYLINTPSFQLKIIQLYETCLVRHGFMLVGPTG
SGKSTIMKILTEVLTKLGSPHKIVIMNPKAITAEQMYGVKSEISDDWIPGVFSTIWAKSN
NRALKHTTWITCDGPVDAIWIENLNTVLDDNKILTLANGERIAMTENCKVVFEVENLNNA
SPATVSRCGQVYVSPTDLGYEAVIEGWIRNRKASGRAEESDKLGNILRKYLINMRFIELQ
SKECKEPMMDTSPVISVINILNLLTGCLQYFVQTQRTLSEQEYEKFIVYSMAWAIGGIYE
AQDRVRFHELLLAKNAPIPQKGKENETVFDYYVSQDYLDWKICSPEEWVPPQSLQFSQLL
LPTLDSFRAEMLLNFILTQPKSHTCSNSALLIGGSGTAKTSSVLLYCNKFDPQKMLFKRT
NFSSATSPFMFQSTIEAECDFKVGKEFAPPGNKMMTIFIDDMSMPFVNKWGDQITLELVR
QLIETGGFYMLDKTQRGNQRKMKNLQYIGAMNHPGGGRNDIPNRLKRQFFIFNMILPLSI
EGIYGPIIKHMFKQKYFSDSTYKVIESLTSATIALWNKVKSTMLPTPAKFHYVFNMRELS
RIFKGILTCKKDTINDAPKSMKIKPELFLVGLWRHEAERVLADKLVNNKDKDTVMGYIQE
VSLESFSQIENEILEKYSSEKTFLFCDFLRPDVINEDGIIEEEAPKIYEAIDSLTELRKR
CNFLLSFYNDRNPSKKMPLVLFDDALKHLLRISRIIRQPRSSGLLVGVGGSGKQSLTRLA
GFIGKNLIQQIIVTKTYSDKDLKEDIKKGFDDAGHLGKQVTFLMTDSEVKKEEFLEYINM
VLSTGEIPNLLAKDEREVWLGDISQAYCKEKNLGNIDPPQSELWTYFVDRVRDNFHIMLC
FSPVGQKFRERARKFPALFNECTIDWFLPWPEEALVSVAETFIKNFDKLDTKEETKQELM
KHMGNVHLMVNEICDEYYQKMRRQVYVTPKSFLSYLNSYKTLYIEKYDELDQQEESFKIG
LNKIQEATITINQMEISLKEEEIQLNEATEKTNQLLANLDKESKKANQKGEEVAATNKQC
EIQAEQISKEKEEAERELEAALPALRRAQEAVDSIESKDIVELKANKKPLDIIKYIMDAV
LVFFKARLIPIQIEERVFNKKEGKAVLFLKESYDESGIQTLGDMNFMKKLKEFEKDSINE
ETIELLEPYLNQSEDWFNDTFATKASKAAAGILKWAFAIYEYHQKSKIVKPKRIQVAIAE
GRQAIALKELEKAREDLAQIQAYIKNLKDVYTKQMEEKNELEMKAAKTKKKINTARTLIT
SLSGEKDRWGKGAQDISDQKRKLVGNVSLSTAFISYCGPFNAEYRNKLAQQRFVVDMKKR
GVPVTPGLELTSFLIDDATIGEWNLQGLPKDDLSIQNGIMVTNSARYPLFIDPQGQGQNW
IRNKLSASIIPERCITTLSHPKFKDMFLKYCMESGLTLIVENIENEVDPMMDPVLERQII
VKGKTQFVNVAGTEMELSKEFKLFMTCRLANPSFSPELSAKTTIIDFTVTQSGLEQQLLG
KVISKEQKALEDSLNQLLADVNQNQKDLQRLDKNLLERLINSQGNLLDDTELMDVLNNTK
TQAKEVAAKLIDAEIKTKEINEKREQYRPVAIRGSAIYFTMIEVSLVNWMYNSSLEQFLK
LFIESIDLSEKAQLPSNRVKNIISFLTFHVYRYVNRGLFEKDKITFILMMAFKILTTAGT
ISSGDVSLFLKSGDALDIKSERQKQISYLEDNQWLNILALSKHTFSGQTLPFFKELPDLI
SRSENQWRNWIDKNDPENFPIPDFAESINQEKEIGSFISLCLVRSLRNDRTLIATQNFIS
NVLGKEFTDPISYPIEGIWQESSNMDPVLFLLSAGADPTSSIDELAKKKKKFPCEKVSMG
EGQERVARQVIMKGFVEGGWVILQNCHLGLKFMEEIETLVSPINQIHEDFRLWITCEQHP
KFPLGLLQKTLKVTNEPPKGLKAGLYKTFTTIITQEFIDKVDHSNWRSLIFTICFLHSIV
IERKKFGPLGWCVPYEYNYSDLEASLLYIEKYLTNLMSTPQPNSHNLPISMNVVRYMICE
VQYGGRITDDLDRELFITYGETYLKDGIFGNDYFFYDIMVDGSGQKFKYRIPQNPSAELI
KYQEYIAKVPTVDNPEVFGLHSNADLTFRLKESKEMINTVMETRPKDSSVGGGKTREEIV
QDKAKDMLKNLPPDYNDVEVRELVSKLGGPNPKTSTERGMTVPLNIFLYQEVTRMQRVIG
LVRKTLQDTILAIDGQIIMTPEILEAINAIYDAKVPNSWLYDPSGAEISWLLPNLGSWST
SLSDRNKQLNDWLRSGQRPILFWLTGFFNPQGFLTGMKQEVTRNHKKGDGKGGEAWSLDD
VVYSTTVKEREKEKDIEQPPAEGVYIKGLYLEGCKWSKNGLDDSDPKKIFADLPILHVSA
INKKKTNEQDRMSNTYLCPVYKYPKRTDKYLIFRVGLPCEGSNNPSHWKLRGVALLCSTE


>TTHERM_01276420(gene)
ATGCTGTCCTCAAAGTACTCAAAGAGAATAGCATGGATGAAGACTACCATTTGTGATAGT
CTTCAACTTAAGGATATGATTGTCGAAGTAAATATATTTGTTTATGATAAATTAAAGCCC
TTTTTAAATAACCCACTACACTTTTTTTAAAATTTATTCATCTATCTCATTTAATTCAAA
TACTTAAAAGAGAGGAAAAATTAGAAACATTTAAATTTGAAAATATAAGTTTACTAAAAT
AAAATGTTACTTTTTCAAAATAAATTAGGAATCATTTTAATATGAGAAGAATAAAAATTT
GCTTGAGTAATTCTTAAGCGGAGAAGGTTTAAATAAGATCTTCGCTTACTACCAAGTATA
AGAATAAGCTTAAAACGATGATATTAAAGATACAGGTGCTCAAGATCCAGTCTTGTTTTT
CACTACCGGAGACCTTGAAAAGATTCAAGATAAAGCAGTTTGGTTCTTGCGTATCACAAA
TCCCGCTGATGATAAAAAGAAAGCATCATAATAGGATGGTAATGACAATGATATCATTTT
TGGTGAAATCACTCCTAATACAGTTCCTATGTTAAATGCTTTAATGGAAAGTGTTTACTC
TCGCTAAATTGATCATATTATTACTGAAAAAATCTAATTTTGGGGAGTAGCTGAAGAAGA
ACAAGTTTTAGAATTCTAACAACACTCTAATAAATTCTCCAGTGAAGTTAGAGAAGCTAT
TAATTTAATGAGTCCTGGTACTGAGCACTTCAAATTAGATTATGAAGCTATCTCAGGATT
AAGTGAATCTGAAAAAATGCAACATTATGAAATGAAGTTTAATGAGTGGATCAACCTCAT
AAGCAGCTAGCTCAATGATGACTCAGAAGTTCGCAAAGATGAAAAAGATGCAGGTAAATA
ATAATTTAAGTTTTACAATATATTTTTACTTAATAACTACCACTCTAATTAAATATCATA
ATAGAAAAATCAACTGAATAATTTAAAATTAAGATATTTTTAGAGAAAAATATGGCTAAG
TATTTTTGCTTTACTTGAAAAGTGATTATAAACAAAATAATTTAATTGAAAATCTAAAAT
AGATTTTGAAAATATTTTAAACAAAACACAATTTAATTTTAAATTTTATATAAAGATTGA
ATATTTTCATTTTTAAAACTGACAATATCAAAGAAATTTATCAATAAATAAGCGATAACT
AATTTAATTTATTAATTAATCAAGGTTTTTGATATAAGTTTTATTTTTCCTTTTTCTTAT
TCTTTTTTCTATACTCGTCCTTCATCATCAAGTTAATTAAAATCAAATTAAAAAAGAGGT
ATGTTTATACAACAATCTTCTTCATACAAACAAAATATTAATCAACCAATATTAATAAAT
AAATAGATAGATAGATATATTTTTAAAATATCTATTTGTCAAAATAAATCCATATATTTG
TTTATTACTTAATTAACTAATAAGCATTTATTTTTAAACTACAAATTTCAAAAATTAATT
TCAAAACTACTTTAAATTTTAAAAAATTTTTTATTTATTTTGTTTGCTATTTTAACTTTT
AATTGCTTCAATTTTTAAATAGTTTTGTTTTTTAAAGAAAGAAAAAAACATCCTATATTT
TATATCAAAATATTTTATTATTTTATTATTTTGCAATTTAATTTTTAAATATTTCATATT
AAAAAAGGCCCTGCTACTGAATTAATTTATTGGAGAAGTAGAATGCAAAAGATCACAAAT
TGGTCTGAATAATTAAAGAGCAAAGACTTCTAAATTGTTAAAGCAAGCCTCTAACGTCAT
AAAAATCATGATAATCAAAGACCACGTGGTGATGAATCACTCTCTAAACTAATGATGGAA
TATAATCGTTTGGATCTATTGCTTACTGATAAACTTAACGAAGCCAAAGATAATGTTAAA
TATTTAACTACTCTTGAAAAGTTTATTGAGCCTCTCTATAATGGTACTCCTCAGCAAATT
ATTGATACCTTGCCTGCCCTTATGAATGCAATCAAGATGATACACACTATAGCTAGATTC
TACAATACTACTGATAAAATGACAGGACTATTTATCAAGATCACTAACTAAATGATAAAG
AATTGCAAAGATCGCATTCTTAACAAAAAAGATAATGGTGATAATCCTTCCCTATACAAA
ATGATTTGGGAATAAGATCCAGCTGAACTCATTGAAGTTTTAGGATCCTGCATTAAACTT
TATTGTGAATATAAAAAATGCTACAATGATACCAAAGAAAAAGTTGCTGATATGCCTAAG
GGTAAGACTTTTGATTTTTCTGATGCTTAAATTTTCGGAAAATTTGATACTTTTGTAAGA
AGATTATAAAAATTGATTGAAATCTTCTCTAACATCCAACAATTTAATGCCCTTGCTAAA
CACAATTTAGAAGGTATGGATGTCTTGACCAACAAGTTCAAAAAAATTATTGATGACTTT
AAAAAGAAAGGCCACAATTTATTAGATACTGCTAACAATAAATTCGATAGAGATTGGGTT
GAATTTAATGTTGAAATTTCTCACTTAGACGGTGAATTATAAAACTTCATTGATAACAAT
TTCAACCGTTTCAGAAACATTGAATATTCTCTAAAATTGCTCCATAAGTTCCAATCTACA
ATCAAAAGAGATTCTCTCAAGCACAATTTAACTTCTCGTTACAATGCTATTTTGCACAAT
TATGCTACTGAGTTAGATACTATTTAACGTGTCTTCCAAGATTAAAAATCCAATCCCCCT
CTTGTTAGAAATATGCCACCTGAAGCTGGTAAAATTATTTGGGCTCGTCATTTATTCTAA
AAGATTACTGGACCTATCAATATTTTCCCTGAAAATGTTATCAACTCAACTGAAATCCGT
CGTTATTATGGTTCCTACAACACTCTTGGTAAGTAGTTAACTATTTATGAAATGTGGTTC
TATCAAGACTGGGTCAATAAGATTGAACAATCTAAGGCTGCTCTTCAAGCTACTCTTATT
GTTCGTCACGACGAAAACAAGAAGCTTTATGTTAATTTTGACTTAGAAATTATGCAATTA
ATCCGTGAAGCTAAGTGCTTAGATAGACAAGGCATTGAAATTCCTGAAAGTGCTCGTATT
ATTCTTTTGCAAGAAGATAAATTTAAGACTTACTATAACGAACTTCTTTATGCTCTTAAA
GAATATGAGCGCATTAACTCCAAAATTAAACCTATTTGTAAGAATTTGCTTCTTCCTCAT
ATTGAAGACTTAGATCTTAAGCTTCGTCCTGGTATGGTTACTTTAACTTGGACTTCTATG
AACATAGAAAGCTATTTGTACTATGTTCACTAAGGTTTGAAGAAGCTAGAATAACTAATC
ATTAACGTTAATGATATTATCGAAAATCGTATTGAAAATAATTTAAAGACTGTTTCTAAG
GTTGTTCTTGTCCACCTTCCTCAAGATACTAAACCTCTTTCATTGGATTCTTTCGTCCAA
CTTCAAGAAGAATATATTAATTCAAAGACCGATTTCTTAACTTCTAAGAACGTTGAAGTT
GAAAGAGCAGTTGATGATTTATTATAAACTATTATGCTCTATCCTTTAGACCCTCATGTT
GATCCTGTTCTCCCTGAAGAAACCAAACGTATTAAGAGATATTATTTCTGGTATTTCTAT
CAAGCTTTACTTAATTCAACTTAAAATTCCTTAAATGCAATGAAGTATCGTGTTTGCGGT
AAGAAGATTCCTGGTGCTAACACTTTGTAAAACTTAAAACCTTTCTTCTAGGTAGAAGTT
TAATTAAATGGAGATAAAGTAACCCTTAACCCTTCTTTGCAAGAAATTTAAAAATCTATT
AACCGTGCTGCTACTGCTGTCCTTAGATGCTCAAAGCACTTATATAATTGGGACTAATAG
AATAAGGATTCTACTGATAAGGCAACATTTTACGATATGATTGCTTGCGACAAAGAAATT
GTTAAAGTCATTTTACTTTTGACTGGTTCTATTTAGGGAACTAAAAACAAAGTCAATGAA
TTCTTAAGCGGATTTACTAAATTTGAATGGTTATGCAAGGAATCCATCCAAGAATCTATC
AAGAAATTCTCTAAGAATGGACCTACACTTCAAAATTATGAAGACTAATTAAAAAAATTC
TCTTAAATAGAAGAAGAAATTGAAAAAATTGTGCCCACTTACAAAATCGGAGCTATGGAA
TTGATGACTCATAATATTTGTACTTCATTATCTACTTGGGCCAAAGAATGGAAGCTTTAG
TACTCCTAAGATTTACACAAGCGTGCTCGTTAACTCTTAGATAGTCTTACTGAATAAACT
AAAATGCTTTCTACCAAATTATCTAAGCCTGTCAAGGATATTGACTCCCTTGGTTATGTA
ATGGAGACCTTAGAATAAATTCGTAAAGAACAAGCAGAAATTGACATGAAGTTTAATCCT
GTCTAAGAAATGTATTCCCTCCTTGATAACTATTTACCAGGAGGTATTACTGATAAGGAT
GAAATGGATGCTCGTTCTCTTTTACGTAGAAATTGGGATATTCTTATCTAATAAGCTGAA
ATTAAAGGTAAAGAATATCAACACAAGCAAGCAATTTATCTGAAGGAACTGTAAATCTTT
ATTTCATTATTCAATTTTAAATAAGTTTTATTTATTAATGCTGAAATTTATTTATTTTAA
AATTAGTAAGCAATCAATTAAAGACTTCACAAACTAAGTAAGCATCTTTAGAAGAGATTA
TGAAAAGAATGGTCCTATGGTTGAAGGTATCAGTCCTGCAGAAGCCATGGAAAGACTCAG
AAGATTTGAAGATGAATATGATGTTAAGTACTAAATGTACAAAATCAATGCTAGAGGTGA
AAACTTATTCGGTTTACAAAATCAAAAATATCCCGAATTAGAAAAGACTGATGCTGAAAT
CAAGAACTTAAACAAACTATATAATTTATATGACTCAGTAATTAAGAATATCTAATAATT
CAAAGAAAAATCTTGGTAAGATGTTAGTAAAGATGATTTGGCAAAGATGGAAGAAGATGC
AGGTAAATATGGTGAATAGTGCAGTAGATTACCAAAAGACTTAAAAGAATGGTAAGCTTA
TCGTGATCTTAAAAACTATATCGATTCTCTAAGAGAATAATTACCTTTGATTATAAGTTT
GAAGAAACCATCTATCATGCCTCGTCACTGGGAAAAAATTAAAGAAATTACTAACACAAA
GCTTAACTATGAAAACCCTGATCAATTCTACATTGAAGAAATTATGGGAGCCAAATTACT
TGATTTCAGAGAAGATATCGAAGATATCACTGAATCTGCTGATAAATAATTAAAGATCCG
TACTGGTTTAGATGAAATTAATCTTTACTGGAATGATATGTAATTCTAGTTTGGTATTTG
GGGTAAGAGAGATGTTCCTTGTATGCTTAATGGTCTCATTGTTGGTACCATTCTTGAAAG
ACTTGAAGAAGATTAACTTTAATTATCTACTTTCAACTCCTAAAGACATGTTACTCCCTT
CAAAGCAGAAGTTGAAAATTTGATCCGTACCTTCTCTGACGTTAATGATACTCTTGATAT
GTGGGTTAAAGTACAAAAGTTGTGGACTTCACTTGAACCAGTTTTTACTGGTGGTGATAT
TGCCCGTTAAATGCCTTTACAAGCAAAGTAATTCCAAGGTATTGATAAAAATTGGATGAA
AATTATGGAAAAAGCTGTTGAAACAAAGAAAGTTATACCTTGTTGTCAAAATGACATGCT
CAAGGATTTCTTGCCGGATCTTAATAGAAAGTTAGAAGACTGTTAAAAAATGTTAGAAGC
TTATTTAGAAGGTAAAAGAAAGAAATTCCCTAGATTCTACTTTGTTTCTAACCCTACTTT
ATTAAAGATTCTTTCACAAGGTTCTGAACCTACTTCTATCTAAGAAGATTTTGAAAAGCT
TTTTGATGCTATCACAAAAGTTACCTTTGAAAGTGCCAAAGACAAGAAAAATCCTGCTCT
TAAGCAAATTACTTAAATCCAATAAGTTATTGGCCGTAATGAAGAAAATATTTCTCTTAC
TGGTTACTATGTTAAGTGTGAAGGAAATATCGAAGACTGGCTAAAGAAGCTTGAATAAAA
TATGTAGCAGACTTTGAAGGATATTGCAAGTGCTGCTGCATAACAAGTTTTCTAAGTTGG
TTTGAAAGAGTTCGTTAGCTCTTAAGCCTCTTAAATCGCTCTTCTTGGTCTTTAAATACT
TTGGACATCAAAAGTTAATGAAGGTTTAGAAAGACTTTCCCGTAACGAACGTAATGCTAT
GGATATTAAGAGAAATGAAATCAAAGAGCACATGAATATTTTGTCAAGTATGTGTCTTGA
AGATCTTAATGGTGCTGTCGAAAGAACTAAAGTTGAAACTTTGGTCACAATTTAAGTCCA
TTAAAAAGATATTTCTATGGACTTGAAATGTAAAGATGTCAATGATTTTGAATGGCAAAA
GCAAACAAGAATTGCTTGGAAAACTGATATTGATGAATGTATTATTTCTATCACTGATTG
GGATTCTCCTTACTCATACGAATTCTTGGGTGCTAAAGAGCGTTTATGTATTACTCCTCT
TACTGATAGATGTTACATTACATTGGCTCAAGCTATGTCTATGTACTATGGTGGTGCTCC
TGCTGGTCCTGCCGGTACTGGTAAAACTGAAACTGTCAAGGATCTTGGTAGAACTTTGGG
TGTCTTTGTCGTTGTCACTAATTGTTCAGATTAACACAGATATCGTGATATGGCTAAAAT
TTTCAAAGGTTTGGTTTAGAGTGGTCTTTGGGGTTGTTTCGATGAATTCAATCGTATTGA
TTTGGAAGTCTTATCTGTCGTAGCAATGCAAGTTGAATCAATTACAACTGCCAGAAAGTA
ACACATGAAGAAATTCATGTTCCCTGAAGAAGAAATTGAAATTGAACTCATTCCAACTGT
CTCTTACTTCATTACAATGAATCCAGGTTATGCTGGTCGTTAAGAATTGCCTGAAAATTT
GAAAGTTCTCTTCAGAGGTGTATCTATGATGGTTCCCGATAGAGAAATTATTATTAAGGT
CAAGCTTGCTTCAGTAGGTTATCTTTAGATTGACTTGTTGGCAAAGAAATTCAATGTCCT
TTACAGATTGTGTGAAGAATAGCTTTCCAAGTAGCGTCACTACGATTTTGGTTTACGTAA
TATCCTTTCAGTACTTAGAACAGCTGGTAACACCAAGCGTTAAGAAATTAAGTCAGATGA
AGAAATGTTACTGATGAGATCATTAAGAGATATGAATCTTTCAAAGTTAGTTGCTGATGA
TATTCCTCTATTTAATGGTTTATTAGCTGATATTTTCCCTAAATTAAAGGAAGTACCTAA
GAAACTTTATCCTGATGTTGAAAAGAAGATCCCTGAAGAAATAAATGCTGAAAGTTACTT
GATTAACACACCTTCTTTCTAATTAAAGATTATTCAACTTTATGAAACCTGCTTGGTGCG
TCACGGTTTTATGCTTGTCGGACCTACTGGTTCTGGTAAATCAACTATTATGAAAATATT
GACTGAAGTATTGACTAAGTTAGGTAGTCCTCATAAAATTGTTATAATGAATCCTAAGGC
CATCACTGCAGAATAGATGTATGGTGTCAAATCAGAAATTTCTGATGATTGGATTCCTGG
TGTTTTCTCTACAATTTGGGCTAAGTCTAATAATCGTGCATTAAAGCATACAACTTGGAT
TACCTGTGATGGTCCAGTCGATGCTATTTGGATTGAAAATTTAAATACAGTACTTGATGA
TAACAAAATTCTCACATTAGCCAATGGTGAAAGAATTGCTATGACTGAAAATTGTAAAGT
CGTTTTCGAAGTAGAAAACTTAAACAATGCTTCTCCTGCTACTGTATCTCGTTGTGGTTA
AGTTTACGTTTCACCTACAGATTTAGGCTATGAAGCTGTTATTGAAGGTTGGATTCGTAA
CAGAAAAGCAAGTGGTAGAGCTGAAGAATCTGATAAGCTTGGAAACATTTTGCGTAAATA
TTTAATCAATATGAGATTTATTGAATTACAAAGCAAGGAATGCAAAGAGCCTATGATGGA
TACTTCTCCAGTTATTTCAGTTATTAACATTCTTAACTTACTAACAGGTTGCTTATAATA
TTTCGTTCAAACATAACGTACTCTTTCTGAATAAGAATACGAAAAGTTTATTGTATACTC
AATGGCATGGGCTATTGGTGGTATTTATGAAGCTTAAGATAGAGTTCGTTTCCATGAATT
GCTTCTTGCTAAGAATGCTCCAATCCCATAAAAAGGTAAGGAAAATGAAACAGTTTTTGA
CTATTATGTTTCTTAGGATTACCTTGACTGGAAGATTTGTAGTCCTGAAGAATGGGTTCC
ACCCCAATCTTTGTAATTCTCTCAACTTTTGTTGCCCACTCTTGATTCTTTCCGTGCTGA
AATGTTATTAAATTTCATTTTAACCTAACCTAAGAGTCATACTTGCTCTAATTCAGCTCT
CTTAATTGGTGGTTCTGGTACTGCTAAGACTTCTTCAGTTCTTCTTTATTGCAACAAGTT
TGATCCTCAAAAGATGCTTTTCAAGCGTACTAACTTCTCATCTGCAACCAGTCCATTTAT
GTTCTAATCAACCATTGAAGCTGAATGTGATTTCAAGGTTGGTAAAGAATTTGCTCCTCC
TGGAAACAAAATGATGACTATTTTCATTGATGATATGAGTATGCCCTTCGTAAATAAATG
GGGTGATTAAATTACTTTAGAACTTGTCCGTCAACTTATAGAAACTGGTGGTTTCTATAT
GTTAGATAAAACTCAAAGAGGTAACTAACGTAAAATGAAGAACTTGCAATATATTGGTGC
CATGAATCATCCTGGTGGTGGTCGTAACGATATTCCCAATCGTCTCAAACGTTAATTCTT
TATTTTTAATATGATTTTACCTCTTTCTATCGAAGGTATTTATGGTCCTATTATTAAGCA
CATGTTCAAGCAAAAATATTTCTCAGATTCTACATACAAAGTTATTGAATCCTTAACAAG
TGCTACCATTGCTCTCTGGAATAAAGTAAAGAGCACAATGCTTCCTACTCCTGCTAAATT
CCACTACGTATTTAACATGAGAGAATTGTCTCGTATCTTTAAGGGTATTTTGACATGTAA
GAAGGATACTATTAATGATGCCCCTAAATCAATGAAGATTAAACCTGAACTCTTCCTTGT
TGGATTATGGCGTCATGAAGCTGAACGTGTCTTGGCTGATAAGTTAGTCAACAATAAAGA
TAAAGACACTGTTATGGGATACATTTAAGAAGTATCTTTAGAATCCTTCTCATAAATCGA
AAATGAAATTCTTGAAAAGTATTCTTCTGAAAAAACTTTCTTATTCTGTGATTTCCTCCG
TCCTGATGTTATCAATGAAGATGGTATTATTGAAGAAGAAGCTCCTAAAATTTATGAAGC
TATAGACAGTCTTACTGAATTAAGAAAGCGTTGCAATTTCTTACTTAGCTTCTATAACGA
TCGTAACCCTTCAAAGAAAATGCCACTTGTGCTTTTCGATGATGCACTTAAACATTTGTT
ACGTATTTCTCGTATTATTCGTTAACCTCGTTCTAGTGGTTTACTAGTTGGTGTTGGTGG
TTCTGGTAAATAGAGTTTAACCCGTCTTGCTGGTTTTATTGGAAAAAATTTAATATAGCA
AATTATTGTAACAAAAACTTATTCTGATAAAGATCTTAAAGAAGATATCAAGAAAGGTTT
TGATGATGCAGGTCACTTGGGTAAGTAAGTTACCTTCCTTATGACTGATTCAGAAGTAAA
GAAAGAAGAATTCTTAGAATATATTAATATGGTCTTATCTACCGGTGAAATTCCAAACTT
ATTAGCAAAGGATGAACGTGAGGTATGGCTCGGTGATATCAGTCAAGCTTATTGCAAAGA
AAAGAATTTGGGTAACATTGATCCTCCTTAATCTGAACTTTGGACTTATTTCGTTGATCG
TGTTCGTGATAACTTCCATATTATGCTTTGTTTCTCTCCTGTTGGTCAGAAATTCCGTGA
AAGAGCTCGTAAATTCCCTGCCCTTTTCAACGAATGTACTATTGATTGGTTCCTTCCTTG
GCCAGAAGAGGCTCTAGTAAGTGTCGCTGAAACATTTATCAAGAACTTTGACAAGTTAGA
CACTAAAGAAGAAACCAAGTAAGAACTTATGAAGCACATGGGTAATGTCCATTTGATGGT
TAATGAAATTTGTGATGAATATTACCAAAAGATGAGACGTTAAGTCTACGTTACACCTAA
GTCCTTCTTGTCTTACTTAAATTCATACAAAACTCTTTACATTGAAAAGTATGATGAACT
TGATTAGTAAGAAGAATCATTTAAGATTGGTCTTAATAAAATTTAAGAAGCTACTATAAC
TATCAACTAGATGGAAATTTCCCTTAAAGAAGAAGAAATTTAACTTAATGAAGCTACTGA
GAAAACCAATTAACTCCTTGCCAATCTTGATAAGGAAAGTAAGAAAGCTAACTAAAAGGG
AGAAGAAGTTGCAGCTACTAACAAGTAATGTGAAATTCAAGCTGAATAAATCTCTAAAGA
AAAAGAAGAAGCTGAACGTGAACTTGAAGCTGCCCTTCCTGCTTTGCGTCGTGCTTAAGA
AGCCGTCGACTCTATTGAATCAAAGGATATTGTTGAATTGAAGGCTAACAAGAAACCTCT
TGATATTATTAAATACATCATGGATGCTGTACTTGTCTTTTTCAAGGCTCGTTTAATTCC
CATTCAAATCGAAGAGCGTGTTTTCAACAAAAAGGAAGGAAAGGCTGTTCTTTTCTTGAA
AGAATCTTATGATGAATCTGGTATTTAAACTCTTGGTGATATGAACTTTATGAAAAAATT
AAAAGAATTCGAAAAAGACTCAATTAATGAAGAAACTATTGAACTTCTTGAACCTTATCT
TAATCAATCTGAAGATTGGTTTAATGATACTTTTGCAACCAAGGCATCTAAGGCTGCTGC
TGGTATCTTGAAATGGGCTTTCGCTATTTATGAATATCACTAAAAATCTAAGATTGTTAA
ACCTAAGCGTATTTAGGTGGCTATTGCAGAAGGTAGACAAGCTATTGCACTCAAAGAACT
TGAGAAGGCTCGTGAAGATCTAGCACAAATTCAAGCCTATATTAAAAATCTTAAAGATGT
CTACACTAAATAAATGGAAGAAAAGAATGAACTTGAAATGAAAGCTGCAAAGACCAAGAA
GAAAATCAATACTGCTCGTACTTTGATTACTTCTCTTTCAGGTGAAAAAGATCGTTGGGG
CAAAGGTGCTTAAGATATTTCTGATCAAAAGCGTAAATTAGTTGGTAACGTTTCTCTCTC
AACTGCCTTTATTAGTTATTGTGGTCCTTTCAATGCTGAATATCGTAACAAGCTTGCCCA
ATAAAGATTTGTTGTTGATATGAAGAAGCGTGGTGTTCCAGTCACACCTGGCCTTGAATT
AACTTCTTTCTTAATTGATGATGCTACTATTGGTGAATGGAATCTTCAAGGTCTTCCTAA
GGATGATTTATCTATCCAAAATGGTATCATGGTTACAAACTCTGCTCGTTATCCTCTCTT
CATTGATCCTCAAGGTCAAGGACAAAATTGGATTCGTAACAAGTTGTCTGCTTCAATTAT
CCCTGAACGTTGTATCACTACTCTTTCTCATCCCAAATTTAAGGATATGTTCTTGAAGTA
CTGTATGGAAAGTGGTTTAACTCTTATTGTTGAAAATATCGAAAACGAAGTTGATCCTAT
GATGGACCCTGTACTTGAAAGATAAATTATTGTTAAAGGTAAAACTTAATTCGTTAATGT
TGCAGGTACAGAAATGGAACTTTCTAAGGAATTCAAGCTATTCATGACTTGTCGTCTTGC
AAATCCTTCATTCTCACCTGAACTTTCAGCAAAAACCACCATTATTGACTTTACAGTCAC
TCAATCTGGTTTAGAATAATAACTTCTTGGTAAAGTTATTTCTAAAGAATAAAAGGCTCT
TGAAGATTCTCTTAACTAGTTACTAGCTGACGTAAACCAAAACCAAAAAGATCTTCAACG
TTTAGATAAGAACTTGCTAGAACGTCTTATTAATTCTCAAGGTAATCTTCTTGATGATAC
TGAGCTCATGGATGTGCTTAATAATACCAAGACTCAAGCTAAGGAAGTTGCAGCTAAACT
TATAGATGCTGAAATTAAAACAAAAGAAATTAATGAAAAGAGAGAACAATATCGTCCTGT
TGCTATTAGAGGTTCTGCTATTTACTTCACAATGATTGAAGTTTCTTTGGTAAATTGGAT
GTACAATTCATCTCTTGAATAATTCTTAAAGCTTTTCATTGAATCAATAGATCTTTCTGA
AAAAGCTCAACTCCCTTCCAACAGAGTTAAAAATATTATTTCTTTCTTGACATTCCACGT
CTACAGATATGTTAATCGTGGTCTTTTCGAAAAGGATAAAATTACTTTTATTCTTATGAT
GGCTTTCAAGATTCTTACAACTGCTGGTACTATTTCAAGTGGTGATGTCTCTCTCTTCCT
CAAGTCTGGTGATGCCCTTGATATTAAGTCTGAACGTTAGAAACAAATATCATACCTTGA
AGATAATTAATGGCTTAACATATTGGCTCTCTCCAAGCACACTTTCTCAGGATAAACACT
TCCATTCTTCAAAGAACTTCCTGATCTTATTTCTCGCTCTGAAAACTAATGGCGTAATTG
GATAGATAAGAACGATCCTGAAAATTTCCCCATTCCAGACTTTGCAGAAAGCATTAACCA
AGAAAAGGAAATTGGTTCATTCATTTCACTTTGTCTCGTTCGTTCATTAAGAAATGATCG
TACTTTAATTGCAACATAAAACTTTATTTCTAATGTACTTGGTAAGGAATTCACTGATCC
TATTTCTTATCCTATTGAAGGTATCTGGTAAGAATCTTCTAATATGGATCCTGTTCTTTT
CTTACTTTCTGCTGGTGCTGATCCCACTTCATCAATTGATGAGTTAGCTAAGAAAAAGAA
GAAATTCCCTTGTGAAAAAGTTTCTATGGGTGAAGGATAAGAAAGAGTTGCTCGTTAAGT
TATCATGAAAGGCTTCGTTGAAGGTGGTTGGGTTATTCTCTAGAACTGTCATCTTGGTCT
CAAGTTTATGGAAGAAATTGAAACTTTAGTCTCACCTATTAACTAAATTCATGAAGATTT
CCGTCTTTGGATTACTTGTGAGTAGCATCCTAAATTCCCTCTTGGTCTTCTTTAAAAAAC
TCTCAAGGTTACTAATGAACCTCCCAAAGGTCTTAAGGCTGGTCTTTACAAAACATTTAC
TACCATCATTACTCAGGAATTCATAGATAAGGTTGATCACTCTAACTGGCGTTCTCTTAT
CTTTACTATTTGTTTCCTTCACTCAATTGTCATTGAAAGAAAGAAATTCGGTCCTCTCGG
TTGGTGTGTACCTTATGAATATAACTACTCAGATCTAGAAGCATCTCTCTTATATATTGA
AAAGTATCTCACTAACTTGATGTCAACTCCTCAACCTAACTCTCATAATCTTCCTATCTC
AATGAATGTCGTTCGTTATATGATTTGTGAAGTACAATATGGTGGTAGAATTACTGATGA
TCTTGATCGTGAATTGTTTATTACTTATGGTGAAACTTATCTCAAGGATGGTATTTTCGG
TAATGATTACTTCTTCTACGATATTATGGTTGATGGTTCAGGTTAGAAGTTCAAATACAG
AATTCCTCAAAACCCATCTGCAGAACTTATTAAGTATTAAGAATATATTGCTAAGGTTCC
TACAGTTGATAATCCTGAAGTAATAATTTTTTTTTTTTAACTTTTTATTAAATTTAATTA
CAAAAAAACAAAATAAATAAATAAACAATATAATAATATTAATTCATTTATCAATAGGTT
TTTGGTCTTCACTCTAATGCTGATTTAACTTTCCGTCTCAAAGAAAGTAAGGAAATGATT
AACACTGTTATGGAAACTCGTCCCAAGGATTCTTCAGTTGGTGGAGGTAAGACAAGAGAA
GAAATTGTCTAAGACAAAGCCAAAGATATGCTTAAGAACCTTCCTCCTGATTATAATGAT
GTTGAAGTAAGAGAACTTGTTTCTAAACTTGGTGGACCTAATCCAAAGACAAGTACTGAA
AGAGGTATGACAGTTCCTCTCAATATTTTCTTGTATCAAGAAGTTACCCGTATGCAAAGA
GTTATTGGTTTAGTTAGAAAGACTCTTCAAGACACTATTCTAGCTATTGATGGTTAAATT
ATTATGACACCTGAAATTCTTGAAGCTATTAATGCCATTTATGATGCAAAGGTAAATAAT
ATAAAATTGATTGTAAAACTTTTTTGTTAAAATGTTTAAATTTAAATTAAATTAGGTACC
TAACTCATGGTTATATGATCCTTCTGGTGCTGAAATTTCATGGCTTCTTCCTAACCTTGG
TTCATGGAGTACATCTTTGTCTGATAGAAATAAATAACTCAATGATTGGTTGCGTAGTGG
ATAGAGACCTATATTGTTCTGGTTGACAGGTTTCTTCAATCCTCAAGGTTTCCTTACAGG
TATGAAGTAAGAAGTAACAAGAAACCACAAGAAAGGTGATGGTAAAGGTGGTGAAGCTTG
GTCACTTGATGATGTCGTCTATTCAACTACAGTAAAAGAGAGAGAAAAAGAAAAAGATAT
TGAATAGCCTCCAGCTGAAGGTGTCTACATTAAAGGTCTCTATCTCGAAGGTTGTAAATG
GAGTAAGAATGGTCTTGATGACAGTGATCCTAAAAAGATTTTCGCAGATCTTCCTATTCT
TCACGTTAGTGCTATAAATAAGAAGAAAACCAACGAACAAGATAGAATGTCAAATACATA
TCTCTGTCCAGTATATAAGTATCCCAAGAGAACAGATAAATATCTCATTTTCAGAGTCGG
TTTACCTTGTGAAGGTTCAAACAATCCTTCCCATTGGAAATTAAGAGGTGTTGCTCTTCT
TTGTTCAACTGAGTGA