Identifiers and Description

Gene Model Identifier

TTHERM_00193520

Standard Name

DYH24 (Heavy chain subunit of ciliary single-headed inner arm dynein (IAD)")

Aliases

PreTt06635 | 16.m00291

Description

Dynein heavy chain family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01365 ) RIH domain
  • ( PF04212 ) MIT domain
  • ( PF00435 ) Spectrin repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF03028 ) Dynein heavy chain
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR00517 ) acyl carrier protein
  • ( PF04935 ) Surfeit locus protein 6
  • ( TIGR00206 ) flagellar M-ring protein FliF
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( PF00806 ) Pumilio-family RNA binding repeat
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( TIGR02481 ) hemerythrin-like metal-binding domain
  • ( PF02367 ) uncharacterised P-loop hydrolase UPF0079
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00193520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_283520
WormBaseWBGene000004859.997093137033517e-262locus:che-3 Cytoplasmic dyne
in 2 heavy chain 1 status:Pa
rtially_confirmed UniProt:Q1
9542 protein_id:CAA99830.2
Tetrahymena borealisEI9_02318.19.997093137033517e-262dynein heavy chain family prot
ein (4310 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig2564.0.g1059.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00193520(coding)
ATGTAAAATCAAGAGGATTTATACTAGCAAAAGCAATAGCTTATTTAGCGCTTATATAGG
AATAGTAGCTAAAATAGTCTTTCAAATCCTCTCCCTGGTTTGAGATTACCTTAAGGAAAG
AGCGGAAGTCAAAGAACTTAGAGAAATGAAAGTACAATAATAGGGCAGGGAAAGTCTTTA
AATACAACAATGGCAAATAGGTATATGCTATAGGAATCTGAATTGGTACCAAAGATTGTG
AAATATAACAAATTGCCACCACTTCAAGACACTTCTAGTTTACCTGTGATATTTAATAAG
GGTAAAATATTGGTTAATTCAACCAAAAACTATGGATCATAGAGCTCTCTACTTATTGGA
AATATACTAAGCACTCACAATTAGCAAAATTCAAACATAATTAATTTCAATCAGTCATCT
GTGATTGATTAGTCTTCTATAAATATTTTAACTAATCCATTTCCTCACAATCGCTCAGTC
AAACATCTTGATCAAATTAATAGATCACAATTATCTATAAATGCTCAAAGGATTTTAGAT
GATGTTAATTTAACTAAAGATTCTATCCCACAATAAGATCAAAAATTAAAGGAACAAGAA
GCATAGAAAAATAAAAAAACTCATTTCAGAATTAAAAAGGGATAAAAACAAAAAAAGAAT
AAAGATGATGATGGTTCTAAGATGTAAGATTATTTAACTCCTATGGATTTTATACATCTA
ATTCGAACTGATCCTGAAATGGCTGACGAATTTTGCTACTTAAATAAGAATTCTAATCCT
TATGATTTTAAGATAGTAGAGTTCGATGCTCGTAATCCAAAAGAATATATGACTATTTCT
GCAAGAGGAATAACTCATTTTATAGACGACTAAGCTGAATTTAAAACTATCGAAGAATGG
GAAAGAGAATCGAAAATGTTCCACTAACTACTCGAAATAGAGTTCTTTAAGCAATATAAG
AAATGGAAAAATTTCTCATTATGGAAAAAGCTTATGAGAAGAAATATGATGAGAGAATGC
TCACATGTTTTAAGCCAGTAATTGTTTTCTGTTGACAGAAATCTTTAACCTGCTCTACTT
GAAATTAGAGGCTTGTGTCTTATGAGCTAGGAATTCAGATACATGGAAATGAATATCAAT
CAACCATTAAAATATGAAGAATTTAAAAAAACATAGGAAAGTTATAGAGTTACAGCTACA
GATTATAAGTTAGATAAGTTAGAAAACGGTATTAAAGAATTAGTTATGAGCAACTGTAAA
AGAAGTTTATAAGCATTCAAAGAGGAAAATCGTATTCCATCAAATGATGCAAACGATACT
GATGAGCTTAAAGAAAAGGCTCCTTTGTTGGTAGGTGATGAGACAGGAAAAGAAATGCCA
TACACTTAAGAAGCAACCATCCGCACACATTATAAAAGACTTAATAAATTTGTACGTCTC
GTTGATTATTTAATAGTTGATTCAAAGATTTAAATGATAAACAATTCCACTTCTTCGATT
GTTAGACATATTGAAGATTTAAATGATAGTATAGGAGATAAATACCAATCTGTAAATAGC
ATGATTATGGTGGAAGCCTCTAACATAGGACCTGAGTTAGTGTTTACCCCAAACAGAGAT
ATTTTAAGAAAAATGTTTGAAGAAATAATTAGCAAAAGTGTATAAAGAATATGCAACAAG
CATAAAATGCTTGTAAATGTACAAGAACTTAGAGATTATATTAGGATTGAAGATTCAGAA
GATAGAAATGGTGAAGATAGTATAGATTTATATCAGATAGTACATAACGATGGCTTGTAT
AAGCAAAGTCAAGTAGACATAATAAATGTTTTAAATAAATCTTTTGATTTCGTTGAAGAA
TACTCTAAGATTCTTATTCCATTTATTTAGATATACATCACCAATAGCAATATTAATTGG
AATTAAGTAGAATAAATGGAAAATGAATTCTTTAAAAAAATGATTGAATAATTCCGTGAA
GAGGATAACAGATTTTAGTCAATAGAACCTAATAAAGAGCTTGGTTTAATCTTTTTCGAT
AACATTCATCTCAAAGATAAAATCAAAAATATTTCTATCAATTGCTTGACAGAATTGACC
AAAATGATGCCAGATCTGCTTTTTAAAAAGGCTAAAAACTTTTATACAAAGTTGCATGCA
TTCAATTAAAAGATTGCCCTTGCACCAGTCAATGTAGAATAGTTTGTTTAGTATAATGAA
TATATCTCCGAAATTAGCAATAATCTTGAAGAAATGACTTCAGAAAATGCAGAAATTACA
GAATTATTATTTTTAATAGAAGAATATAAAATTAAATTACCTGAATCCTATAAAGCAAAA
GTCAAAGAAGCTTCTCAACAAATTTAAACTCTCAGAACAAAAATAAGTGATGCATAAGCT
TCTGCAGATTAAAATTCTAAAAAATTCTAAAAATAACTGGATTAAATGATTCCAGGAATC
AAGGAAGATGTAAAAGAGCTCGAAGAATAGCTCATTAAAGTTGATTATGCTAAAGTAGAA
GCAAATATAAACTAAACATGTGGCCAAATACAAGAAATCAGTAACAGATTGGCAGAAATC
GTTAAGCAATCTAAGAAAATTAACGATTTCTAAATTGCTATGTAATTGGAATTAACTATA
TTTGAGAAACTAGACATATTCGTTAGAGAATTTGGTATGATAGAAAAATTATGGATGAGC
AGAAAGGAGTGGAAGAGAGAATACGATAGATGGGATATTTAGCCATTTTTCGAAATAGAT
ATAGAAGATGTCAGTAATAAGGTTGAAAAACTAGGAAAAGCTGCTAATCACTGTGCAAAA
GAAATGGAAACTAATGAAGTTGCTCGTGTTTTTAAAAATTAAGTTGAAGAATTTAGAAAT
GTCTTATCCCTATTACAATCCCTCAGAGACCCAGCTTTGTAAGAAAAGTGGGATGATGTA
AGGAGCTTAATAAAGGAAAATAGAGCATGGGAAAAGGAGCCATTCCATGACATAAAAGAT
TCTATGTACACTCTAGGATGGATTAATAAACATAATTTAGTTGAATATAAAGATAAAGTA
GCTGAAATTGCATTAAAGGCTGCCAAGGAAGCTGAATTAAATAAGATGTATAAGGGAGTT
GAAGCATTCTGGACTATGAGTTAATTGACAGTCAATAGCTATAAAGACAGATAAGATGCT
TCTATTTTGGGAAATAACGATGATTTAATTGCTAAATTGGATGATGCTCTGTTAACTGTA
AATAACATATTAGCTTCAAGATTCGTTGAATCAATTGCTACTAAAGTTGAAGCTAAACAA
AAAAGTTTAAGATAATTTTAAGAATTAATGGATGAGTGGATGATGCACTAAAGAAATTGG
CTTTATTTAGAGCCTATTCTTACTTCTCCTTATGCTGTTAAGACAATGGCAAAAGAAGTA
AAAAGTTTTAATAACGCTGATGCCTAGTGGAAAAGAATCATGAAAGCAGCAAGAGATAAT
CCTTAGCTAAGAAGATTCAATGATGAATTAATCAAGACAACACTTACAACTTTAAGAAAT
AACAATGCTGCTTTTGAAATTATACAAAAAGCTTTAGATGAACTGCTTGAGAAAAAGAGA
GAAATCTTCTAAAGATTCTTCTTCTTATCAAATGATGAATTATTGGAAATTTTAAGTTAA
GCTAAAAATATCAAGTCGGTCATTCCTCACTTACGTAAATGTTTTGAAAATATTGTCAAG
TTAGAGTTCGACCATTTGGACACTGCAGTTGGAATGATATCTGCTGAAGGTGAAAAGGTT
GTCTTAAAAGGTTACTAAGCAAGAGGTGAAGAAGTTGAAAACTGGTTTAAAGATTTGGAA
GAAGCTATGAAAAATTCATTGAGATATGTGATGAGATCTGCTCTTCTTAAGTACGATGAT
GAAGACACCCAAAGATCTCAATGGGTAATATCTTTCCCATCATAAGTCGTCCTTGCTCTT
GATGCTATATATTGGACAAAAATCACAGAAGAAAATTATTTAAGTCCAGAATCTGAAGGC
GATTTATACGATTGGCTGGAAGGGTAGATGTCCTAATTAGAAGAATTAACTACTTTAATC
CGTGGTGATCTAACTGAATTATAAAGAAAGACCCTATCAGCTTTAGCTGTATAAGATGTT
CATTACAGAGATATCATAGAAGAGCTAGCTTAAGAAGGAGTCGAATCAACAACTGAATTC
AAATGGCAGTAGTAACTAAGATTCTACATTGAAGATGAATCTATTTGGTGCAAATAAGTA
AATGCTAAACTTCCTTATGGCTATGAGTATCTTGGTGCTTCTCCAAGATTGGTTATTACT
CCATTAACAGATAGATGTTGGATGACTATAACTGGAGCTCTTGGTATCAAACTTGGAGCA
GCTCCTGCTGGCCCAGCTGGAACTGGTAAAACAGAATCTTGCAAGGATTTGGCAAAAGCA
CTTGGTAAATATTGTATTGTTTTTAACTGCTCAGAGTAAATTAATGTAAAAATGATGGAA
AAATTATTCATGGGTCTTTGCTACACAGGATCATGGACTTGTTTGGATGAATTTAACCGT
ATTGATATCGAAGTATTATCAGTTATAGCTCAATAAGTACTAACAATTAGAGAGGCTCAT
TTAAGATTATCGGCCTCTTCTGGAAACGATAGATAATTCAACTTCTTTGGAAAAATGGTA
ACTTTAGCTTTAACTGCTGACATGGGTATATTCACTACCATGAATCCAGGTTATGCTGGT
AGAACAGAACTTCCTGATAACTTAAAAGTACTCTTCAGACCTGTAGCTATGATGGTTCCT
GATTATGCACTTATTGCAGAAATTATGTTATTTGCTGAAGGTTTTTCAAATGCAAAGGAT
TTATCACGTAAAATGACTAAACTATATACTCTAAGTTCTGAATAACTTTCATAGCAGGAT
CACTATGATTTTGGTATGAGAGCTGTAAAGAGTGTTTTGGTCATGGCTGGTGCATTGAAG
AGAGCTGAGCCAAATATTTCTGAAGATATTGTTCTTATTAGAGCCATGAGAGATTCAAAT
GTGCCTAAATTCTTGAGTCATGATATTCCTCTATTTAATGCAATTGTTTAAGATTTATTC
CCTGGATTAGATATTCCTCCTATCTAAAATAAATAATTGGAAGATGTCATTAGACAAAAT
ATATCTGATGAAAACCTTGTGCCTTGTAATACATTCATAGAAAAAGTTTTGCAATTCCAT
GAAACTCTTAAAGTACGTTTTGGAGTTATGGTTGTAGGACCAACTATGGGAGGTAAATCT
AAAGTTATAGATGTTTTGAGATTGTCATACTGTGAGCTTAACAAAAGAATAAGAGGTGAT
AATGAAAAAACTGTTAATAACCATCCTGACTTTTAAAATATTTAAATGACTGTTCTCAAT
CCTAAGTCTATTTCTATGGAGGAATTATATGGAGACTTTGATCCTCTTTCATAAAGTTGG
ACTGATGGTTTGGCCTCAACAATCATGAGGTAATACGTATCTCTTGAATCAACTGACAAA
AGATGGGTAATTTTTGATGGCCCTGTCGATGCTCTGTGGATTGAAAATATGAATACAGTG
CTTGATGATTCAATGACACTCTGCTTATCAAATGGTGAGAGAATCAAACTTAAGCCATAA
TTAAGAATGCTCTTTGAAGTATAGGATCTCGCTGTTGCCAGTCCTGCCACAGTAAGTAGA
TGTGGTATGGTCTATATAGATCAAGATGTTGTTGGCTATGAAGCTATTGTAGAAAGTTAC
TTTTAGAAAGAAATATTCCCCCTTTTGAAGAAAGAATAGCACAAAGAATAACTGAAGAAC
AGTTTCAATATTAGTTTCAAAAAGATTCTAAATCATATGAAGAAGAAAAAGATTTAACAA
ACTATACCAACAGTTGAAGCTAACATTGCGATTTCAGTTTGTAGAAATATAAAACTTATA
TTAGAACTAGATTAAAAAGATAATCTTGAAAATGAAAACTCTAAGAAAGCTATTGATAAG
TTACTTCTCTGGGCTATAGGCTGGGGTATTGGAGCAACTGTTTCTACATTGAACATTAAA
GAGTTCTAAGATGGTCTCTCAGAAGCATTCACTGCTGATATTTCTCCTCGTGGATCTCTA
TTTGAGTATTATTACACTATCGGTAAGGGAGAAGGAGATTTTATTGCTTGGTCAGAAATT
ATTCCTGAATTTTCATATTCCCCTGAAATGTCTTATTTCTAACTTGTGGTACCTACAACT
GACACAGTTTGTTATTCATGGTTCTTAGATAAAAATATATAACTTTTGCATCCTATTTTC
TTAACAGGTTTAACTGGTACAGGTAAGACTATTATCACATCTAGTACTCTTAACACTTTG
AAAGATTAAAATTTAGTTGCTACTTGTGAACTTACTTTTTCAGCAAAAACTTCTTCCTTA
TCAACCTAAGGTTAAATTGAAAATAAGCTACAGACTCAAAGAAAAAATAAAAAGGTAATT
TTAATGCCTCCTCCTGGACGTAAGCTTGTTGTATTCATAGATGATATTAACATGCCTTCT
GTAGAAATATATGGAGCCTAACCTCCAATTGAATTATTGAGATAATTTATGGATTACAAA
GGCCTATATGATAGGAAAACTTTACAATGGAAGTAAATTGATTCAACTGTCTTAATTGCT
GCTGCTGCACCTCCTGGAGGTGGTAGAAGTTCTCTCACTGCAAGATTCACAAGACATTTT
TCAATTATGACAGTACCAGATAGCTAAGCTGCTTCATTAACACACATTTTTAGTAGTATC
TTCAATAACTTTTTGAGAGTGAAAAAATTCAGAAAGGAAATTACTGAGCTAGGAGAAAAT
GAAAGTGTAGTTAATGCTACTTTGAATATTTATAGATACATATCTGAAGAACTTTTACCT
ACACCTTCAAAGCAGCATTATGTTTTTAATTTAAGAGATGTGTCAAAAGTATTTTAAGGT
CTTCTATTAGCAAAACCCCACATTATATTGAATGTAGATTCTCTTGTTAAATTGTGGATT
CACGAAATGTCCAGAGTCTTCTGTGATAGATTGATTAACGAATAAGACAGAAACTGGTTT
ATGGATACAATTTAAAAATAACTTTTTATCAACTTTAAACTAGACTGGAAAAAAGAGGAT
GTATTTAACGAGGTACCTCTTATTTTCTCTGATTTTTTGAAGCGTAATATCGAATTTGAA
GACAGGGTTTATGAAGAAGCTAAGGATTTCTAAAGACTAACTAAGATTATTGAAGAATAT
ATGAATGAAGATACTAAGCTGCAATTAATTCTTTTCAAAGATGCTGTCGAGCATATGTCT
AGAATAGCCAGAGTTCTTAGTTTACAGAGAGGACATTTCATGATTGTTGGTGTTGGTGGC
TCAGGAAAGAAGAGTATCACAACTCTCGCATCAGCTCTTGCTGGGTGTGAGTTAGATAGT
ATTGAACCCAAAAAATAATATGGTAAAAAGGAATTCAAAGAGGATTTACTTAGAATGATG
AAGAAAGTAGGTATTGAAAATAAGAGATTAACTTTCTTATTTGCAGACACTCAAATACTT
TAAGAAGGATTTTTAGAGGATGTAAATAATTTGCTAAATAGTGGTGAAGTTCCTAATATG
CTTCAAAAAGATGAAGTTGAAGATATTATTTAGTAGTTATCTTAAGAAGCTAGGGAGCAC
AAGATTACAGACATATACTAGTATTTTGTAGAAAAAGTGAGAAGCTAAATGCATATTGTT
TTGGCACTTTCTCCTGTAGGTAACGCCCTTAGAGTTCGTATGCGTATGTTCCCTTCTATT
GTAAACTGCTGTACTATTGATTGGCTTAATCCCTGGCCTTAAGAAGCACTTATGACAGTG
GCAAAGATGTTCTTGGAAAATTTAGAATTCGAAGGACTTACGAAAGAGAGAAAAGAATAA
CTTTCAGAGTGTTGTGTGTTTGTACATTAATCTGTAGAAGAAATGACTGAAACCTACTTC
AAAAATTTAAAGAGAAGAGTTTATATCACCCCTAAAAGTTATATCGATCTTATAGAAAGT
TATAAATAATTAATTAAAATGAAATAAGATTAACTTGAGAGCTAAAAAAATAAACTTTCA
AATGGTCTTTATAAATTAAAAGAAGCTAATGACACAATTGCCTCATTAAAAGAAAAACTT
ACTGAGTTGCAACCTGTTTTGTAAAAGAAAACAATTGAGCAGGATGAATTGATTAAAAAA
TTAGAAGTAGATAGCTATGAAGCAAATAAAGTTAGATCAGTTGTCAAGGAAGAAGAAGCA
TAAGTAAATGAAAAAGCTTCTGAAATCAGAGAAATGAAAGTTGAAGCAGATAAAGTTCTT
TAGGCTGCTCTTCCTATGCTTTAAGCTGCCAATGAAGCACTAAATATTTTGGATAGAAAA
GTTATTTCTGAAATTAAAGCTAATAATAACCCTAATGAGCTTGTTCTCTTTACACTTTAA
TGTGTTTGTTGTTTATTTGATGAAAAGTAAGATTGGGATAGCATTAAGAAGCTTCTTGCA
GATCCAAATTTGGTATCTCGTATGAAAAACTTAGATGTTTACAATATAAGTCCCAAAGTA
GAAAAAAATATTAAGGCAAAAATAGCAACAAATGAAAATTTCAACCCTCAAAAATTAGCA
ACTATCTAAGCAGCTGCAAAGGCTATTTGTGAATGGGTTATTGCCGTTGCCAACTTTACA
GATGTCAATAAATAAATTCAATCTAAAAAGAATGTTGTAGATAAAATGAACTAAGAGTTA
GATAAGGCTAACAAAGAACTTAGTGTAAAGCAAGCTGAATTACAAAAAGTAGAAGATAAA
GTTGCTAAACTTGAAAAAGAATACAACGATAACAAATTAGAAAAAGATAGATTAGACAAA
GAAATTCAAACCACTGCAGATAGACTTGTTAGAGCTGAAGAACTTACTTAAGGTTTAGCA
GATGAATAAATTAGATGGAAAGAAACAGTGGGAACTTTAGGAGATCAAATTAAACTTTTA
GTTGGAGATGTTTTCGTAGCAGGTGCCTCTGTGACTTATTATGGACCTTTCCCTGGTACT
TATAGAGAAGATTTAGTTAAATAGTGGCTCTAAAAATGTGAATAAATGGAGATACCCAAA
AGTGAAAATTATGTTCTTGAAAACGTACTTGGAGATCCAGTCGAAATAAGAAATTGGAAT
GCAAAAGGATTACCATCAGATAGCGTTTCTATTAATAACGGTATTTTAGTTCATTCATGC
AGAAATTATCCTCTTTTAATAGATCCACAACTTTAAGCTTCTAAATGGATTAAAAATTTG
AATTCTGAATCTAACATGATGTGCACTAAAATGAGTGATGAAAAGCTTTTCTAGACCTTA
GAAGTTTGTATAAGAATGGGTTAACCATTGATGATAGAAGATATGGAAGATACTCTTGAT
ACCATACTAGAGCCTCTTTTACTGAAATAGTTTACTATTAATAATAGAAGAAAAATGATA
AAAGTTGGTGATGCAGATGTTGAATTTGATAATAATTTCAAGCTTTACATTCAAACAAAG
AGTCCTAATCCAAACTTTTTGCCAGAAATATTTATTAGAGTGACTGTAATCAATTTTACT
GTTACTGAATTAGGTTTGGAGGAATAATTATTAGGAGATGTTGTAAGGAAGGAAATGCCA
GAAGTAGAATTAACCAAAAATGAGCTTATTATCTCTATTGCTCAAGGTAAAACTTAGTTA
AAGAAAAATGAAGACAGAATTTTAGAATTACTGACTAGCTCTAAAGGTATGATTCTTGAT
GATGTTGAATTGATTGAAAATTTGAAGCTATCAAAGAAGACTTCAGAAATTGTGAAAGAA
AAGATTACTGAAGCTGAAGAGAAGAAAGTAGAAATAGAAGAAGCTCGTTCATAATACAAG
CCTGTTGCTCAAAGAGGCTCTTATCTTTACTTTGTTATTGCTGATTTAGCTTTGATTGAT
CCTATGTACTAATTCTCATTAGCCTATTTTAGCAGATTATTTAATTTGATTATTGAAAAT
TCAGAAAAGAGTCCAGAAATTACTCAAAGAGTTGAGATATTAATAAATTCAATAACACAA
ACTATTTTCTTAAATGTGTGTCGAGGCTTGTTCAACGATCACAAGCGTATATTCTCATTT
TTAGTCTCTGCTACCATTTAGTAGAGAAGTGGAATCATCACTAAACAAGAGTGGAATCTC
TTTTGTAGAGGTGCTCCAATACTCAAAGAAAAAGCTCCAGCAATTCCTCAGGGACTTTAA
ATCAACTAAAAAACATGGAATAGTATATTTAGTGCTTCTTAGGTAATTTCTAACTTTGGT
ACATGGTTCTAGAATTTAAAAGAACATTATAAAGAATGGGATGCATGGATTAATTGTGCT
GAACCTTTTACTACTCCATTCCCTAAATAATTTAAGGGTGAAATTACACCATTTTAACGC
TTAATTCTTGTAAGACTTTTAAGAGAAGAGAAATCATTGTATGCTATGACTTACTATGTA
GAATAGTCATTAGGGTCTAAATTTTCATCAAACAATGCAGCAATAATGGAAGAGGTTTAC
AAAGATACAGATTATAAAACACCTTTGATTTTCATTTTATCTTAGGGTGCTGATCCTCTA
TTAAATTTACTGAGATTCGCTAAGGATACGAAAATCTCTTCTGAAAAGTTAGTGGTAATA
TCTTTAGGTTAAGGCTAAGGACCAATAGCTCAAAAAGCTATCGAAAACGGTTTGAAAAAT
GGTGGATGGGTAATATTACAAAACTGCCATTTAGGTAAATCTTTTATGCCAAAGCTTGAA
GAGCTGATAGCAGGATTTAATAATGAAGATTAAGAATTTAATACCGAATTTAGATTATTC
TTAACATCTATGCCTTGTGATTATTTCCCTGTATCAATCCTGTAAAACGGAGTTAAGCTT
ACTAACGAACCACCAAAAGGAATAAAATCAAACATCTAAAAGAGCTATGCAGAACTATCA
GAAGAAAGATTTGAAAGCTGCACTAAAGAAAAACCATGGAAGAAATTGCTTTATTCTATA
TCATTCTTCCATGCCATTATTTAAGAAAGAAGAAAGTTTGGTCCTTTGGGATGGAATATT
AGATATGAATTTAATGATTCAGATTTGGATACAAGTATCACTATTCTGCGTGATATGTTA
GAAGTGAATGAAGAAATTCCTTGGGATGCACTCAGATATGTTATAGGTTAAATTACTTAT
GGTGGTCGTGTTACAGATGATTGGGACAGAAGAACATTGATGGCTATTCTAAATAGTTTC
CTTAATGAAGAAGTGCTTTTAGATACTTATAAATTTTCTGAGTCAGGAATTTATATGTCA
TCTAAAATAGGAAAGCTGAAAGATTATAGATCATTAATTGAAAAATACCCTGCCTTTGAG
TCACCTGAAGTGTTTGGTATGCACGAAAATGCTAACATAACATTCTAGCTGAAGGAATCA
AAAATAGCTCTTGACACCATCTTAAATATGCAGCCAAGAGAAAATACTGCAAGTGGAGAA
GGTTAGAAGACTCCTGACCAAATTATAGAAGAAATGTGCAATATGTTTGAAGAAAGATTG
CCTCCTCCTCTTAAGAAAGAAGTATTCACTTCTAAAAAACCTGAATCAATCGATTCTTTG
CAAGTTTGCATGAATCAAGAGTGTGAGAGATTTAACAAATTGCTTTCAGTTATGAAATAG
AGTTTGAGTAATTTGAAAAAAGCTATTAAGGGTGAGGTTGTTATGAGCGCCGAACTTGAT
AAGACATATACAAGTATGATGAATAACACAGTGCCTGAAATGTGGAAGGCTCGCTCTTAT
CCTTCGCTTAAGCCTTTGCAAAGTTGGTTTGAAGATCTTGTAAAGAGAACTGAATTTTTC
CGCTAGTGGCTTAACTTGGATGGAAAGCCCAAAGTGTATTGGCTTCCCGCTTTCTTCTTC
CCTCAAGGTTTCTTAACATCAGTTTTGCAAAACTTTGCTCGTTAAAATAAAATTGCAATT
GACGTGCTCAATTTCGGATTTAAATTTAGTAAATATACTGAACCTGAATAGGTAATAGAA
ATGTCTATTACTGGAGCTTACATATACGGTCTATTTATAGAAGGCTGTTAATTTGATGTA
AGTAAGGGTATTTTAGAAGATAGTAGTCCTGGTGTAATGTATACTTCAGCTCCTGTAATT
GAATTTGTGCCTAACGAAAATTATTAGTCAAAATAAGAAGATTATAGAATGCCTGTATAT
AAAACAACTTCAAGAGCAGGTACACTTTCAACAACCGGTCATTCAACTAACTTTATTATA
GGTATTGATACACCAACTAAAAAGAAGCCAGAATATTGGATTTTAAAGGGAGCTGCTTAT
ACTTGTGCTTTGAATGATTGA


>TTHERM_00193520(protein)
MQNQEDLYQQKQQLIQRLYRNSSQNSLSNPLPGLRLPQGKSGSQRTQRNESTIIGQGKSL
NTTMANRYMLQESELVPKIVKYNKLPPLQDTSSLPVIFNKGKILVNSTKNYGSQSSLLIG
NILSTHNQQNSNIINFNQSSVIDQSSINILTNPFPHNRSVKHLDQINRSQLSINAQRILD
DVNLTKDSIPQQDQKLKEQEAQKNKKTHFRIKKGQKQKKNKDDDGSKMQDYLTPMDFIHL
IRTDPEMADEFCYLNKNSNPYDFKIVEFDARNPKEYMTISARGITHFIDDQAEFKTIEEW
ERESKMFHQLLEIEFFKQYKKWKNFSLWKKLMRRNMMRECSHVLSQQLFSVDRNLQPALL
EIRGLCLMSQEFRYMEMNINQPLKYEEFKKTQESYRVTATDYKLDKLENGIKELVMSNCK
RSLQAFKEENRIPSNDANDTDELKEKAPLLVGDETGKEMPYTQEATIRTHYKRLNKFVRL
VDYLIVDSKIQMINNSTSSIVRHIEDLNDSIGDKYQSVNSMIMVEASNIGPELVFTPNRD
ILRKMFEEIISKSVQRICNKHKMLVNVQELRDYIRIEDSEDRNGEDSIDLYQIVHNDGLY
KQSQVDIINVLNKSFDFVEEYSKILIPFIQIYITNSNINWNQVEQMENEFFKKMIEQFRE
EDNRFQSIEPNKELGLIFFDNIHLKDKIKNISINCLTELTKMMPDLLFKKAKNFYTKLHA
FNQKIALAPVNVEQFVQYNEYISEISNNLEEMTSENAEITELLFLIEEYKIKLPESYKAK
VKEASQQIQTLRTKISDAQASADQNSKKFQKQLDQMIPGIKEDVKELEEQLIKVDYAKVE
ANINQTCGQIQEISNRLAEIVKQSKKINDFQIAMQLELTIFEKLDIFVREFGMIEKLWMS
RKEWKREYDRWDIQPFFEIDIEDVSNKVEKLGKAANHCAKEMETNEVARVFKNQVEEFRN
VLSLLQSLRDPALQEKWDDVRSLIKENRAWEKEPFHDIKDSMYTLGWINKHNLVEYKDKV
AEIALKAAKEAELNKMYKGVEAFWTMSQLTVNSYKDRQDASILGNNDDLIAKLDDALLTV
NNILASRFVESIATKVEAKQKSLRQFQELMDEWMMHQRNWLYLEPILTSPYAVKTMAKEV
KSFNNADAQWKRIMKAARDNPQLRRFNDELIKTTLTTLRNNNAAFEIIQKALDELLEKKR
EIFQRFFFLSNDELLEILSQAKNIKSVIPHLRKCFENIVKLEFDHLDTAVGMISAEGEKV
VLKGYQARGEEVENWFKDLEEAMKNSLRYVMRSALLKYDDEDTQRSQWVISFPSQVVLAL
DAIYWTKITEENYLSPESEGDLYDWLEGQMSQLEELTTLIRGDLTELQRKTLSALAVQDV
HYRDIIEELAQEGVESTTEFKWQQQLRFYIEDESIWCKQVNAKLPYGYEYLGASPRLVIT
PLTDRCWMTITGALGIKLGAAPAGPAGTGKTESCKDLAKALGKYCIVFNCSEQINVKMME
KLFMGLCYTGSWTCLDEFNRIDIEVLSVIAQQVLTIREAHLRLSASSGNDRQFNFFGKMV
TLALTADMGIFTTMNPGYAGRTELPDNLKVLFRPVAMMVPDYALIAEIMLFAEGFSNAKD
LSRKMTKLYTLSSEQLSQQDHYDFGMRAVKSVLVMAGALKRAEPNISEDIVLIRAMRDSN
VPKFLSHDIPLFNAIVQDLFPGLDIPPIQNKQLEDVIRQNISDENLVPCNTFIEKVLQFH
ETLKVRFGVMVVGPTMGGKSKVIDVLRLSYCELNKRIRGDNEKTVNNHPDFQNIQMTVLN
PKSISMEELYGDFDPLSQSWTDGLASTIMRQYVSLESTDKRWVIFDGPVDALWIENMNTV
LDDSMTLCLSNGERIKLKPQLRMLFEVQDLAVASPATVSRCGMVYIDQDVVGYEAIVESY
FQKEIFPLLKKEQHKEQLKNSFNISFKKILNHMKKKKIQQTIPTVEANIAISVCRNIKLI
LELDQKDNLENENSKKAIDKLLLWAIGWGIGATVSTLNIKEFQDGLSEAFTADISPRGSL
FEYYYTIGKGEGDFIAWSEIIPEFSYSPEMSYFQLVVPTTDTVCYSWFLDKNIQLLHPIF
LTGLTGTGKTIITSSTLNTLKDQNLVATCELTFSAKTSSLSTQGQIENKLQTQRKNKKVI
LMPPPGRKLVVFIDDINMPSVEIYGAQPPIELLRQFMDYKGLYDRKTLQWKQIDSTVLIA
AAAPPGGGRSSLTARFTRHFSIMTVPDSQAASLTHIFSSIFNNFLRVKKFRKEITELGEN
ESVVNATLNIYRYISEELLPTPSKQHYVFNLRDVSKVFQGLLLAKPHIILNVDSLVKLWI
HEMSRVFCDRLINEQDRNWFMDTIQKQLFINFKLDWKKEDVFNEVPLIFSDFLKRNIEFE
DRVYEEAKDFQRLTKIIEEYMNEDTKLQLILFKDAVEHMSRIARVLSLQRGHFMIVGVGG
SGKKSITTLASALAGCELDSIEPKKQYGKKEFKEDLLRMMKKVGIENKRLTFLFADTQIL
QEGFLEDVNNLLNSGEVPNMLQKDEVEDIIQQLSQEAREHKITDIYQYFVEKVRSQMHIV
LALSPVGNALRVRMRMFPSIVNCCTIDWLNPWPQEALMTVAKMFLENLEFEGLTKERKEQ
LSECCVFVHQSVEEMTETYFKNLKRRVYITPKSYIDLIESYKQLIKMKQDQLESQKNKLS
NGLYKLKEANDTIASLKEKLTELQPVLQKKTIEQDELIKKLEVDSYEANKVRSVVKEEEA
QVNEKASEIREMKVEADKVLQAALPMLQAANEALNILDRKVISEIKANNNPNELVLFTLQ
CVCCLFDEKQDWDSIKKLLADPNLVSRMKNLDVYNISPKVEKNIKAKIATNENFNPQKLA
TIQAAAKAICEWVIAVANFTDVNKQIQSKKNVVDKMNQELDKANKELSVKQAELQKVEDK
VAKLEKEYNDNKLEKDRLDKEIQTTADRLVRAEELTQGLADEQIRWKETVGTLGDQIKLL
VGDVFVAGASVTYYGPFPGTYREDLVKQWLQKCEQMEIPKSENYVLENVLGDPVEIRNWN
AKGLPSDSVSINNGILVHSCRNYPLLIDPQLQASKWIKNLNSESNMMCTKMSDEKLFQTL
EVCIRMGQPLMIEDMEDTLDTILEPLLLKQFTINNRRKMIKVGDADVEFDNNFKLYIQTK
SPNPNFLPEIFIRVTVINFTVTELGLEEQLLGDVVRKEMPEVELTKNELIISIAQGKTQL
KKNEDRILELLTSSKGMILDDVELIENLKLSKKTSEIVKEKITEAEEKKVEIEEARSQYK
PVAQRGSYLYFVIADLALIDPMYQFSLAYFSRLFNLIIENSEKSPEITQRVEILINSITQ
TIFLNVCRGLFNDHKRIFSFLVSATIQQRSGIITKQEWNLFCRGAPILKEKAPAIPQGLQ
INQKTWNSIFSASQVISNFGTWFQNLKEHYKEWDAWINCAEPFTTPFPKQFKGEITPFQR
LILVRLLREEKSLYAMTYYVEQSLGSKFSSNNAAIMEEVYKDTDYKTPLIFILSQGADPL
LNLLRFAKDTKISSEKLVVISLGQGQGPIAQKAIENGLKNGGWVILQNCHLGKSFMPKLE
ELIAGFNNEDQEFNTEFRLFLTSMPCDYFPVSILQNGVKLTNEPPKGIKSNIQKSYAELS
EERFESCTKEKPWKKLLYSISFFHAIIQERRKFGPLGWNIRYEFNDSDLDTSITILRDML
EVNEEIPWDALRYVIGQITYGGRVTDDWDRRTLMAILNSFLNEEVLLDTYKFSESGIYMS
SKIGKLKDYRSLIEKYPAFESPEVFGMHENANITFQLKESKIALDTILNMQPRENTASGE
GQKTPDQIIEEMCNMFEERLPPPLKKEVFTSKKPESIDSLQVCMNQECERFNKLLSVMKQ
SLSNLKKAIKGEVVMSAELDKTYTSMMNNTVPEMWKARSYPSLKPLQSWFEDLVKRTEFF
RQWLNLDGKPKVYWLPAFFFPQGFLTSVLQNFARQNKIAIDVLNFGFKFSKYTEPEQVIE
MSITGAYIYGLFIEGCQFDVSKGILEDSSPGVMYTSAPVIEFVPNENYQSKQEDYRMPVY
KTTSRAGTLSTTGHSTNFIIGIDTPTKKKPEYWILKGAAYTCALND


>TTHERM_00193520(gene)
ATGTAAAATCAAGAGGATTTATACTAGCAAAAGCAATAGCTTATTTAGCGCTTATATAGG
AATAGTAGCTAAAATAGTCTTTCAAATCCTCTCCCTGGTTTGGTAAATATTTTATTAGTT
CTCTTCATTTCATATCTAAGCAATTAGATGCTAAAATATTAAAGCATAAAAAAATGAAAC
AGCTTTCAATTTAGGAGACCTACTTCTACTTTTGTAGAATTTAGATTTTAATAAGCATAA
GATATATTAATTAGAATATGATTCTTTTTTAGGGGATTTTTATTATCAACATTTATCAAA
AAAAAAACTATTTTTTTAGCAAGTTTTGGTTGAGTTATTCATGTTTATTTTTAAATAAAA
AAGAGATTACCTTAAGGAAAGAGCGGAAGTCAAAGAACTTAGAGAAATGAAAGTACAATA
ATAGGGCAGGGAAAGTCTTTAAATACAACAATGGCAAATAGGTATATGCTATAGGAATCT
GAATTGGTACCAAAGATTGTGAAATATAACAAATTGCCACCACTTCAAGACACTTCTAGT
TTACCTGTGATATTTAATAAGGGTAAAATATTGGTTAATTCAACCAAAAACTATGGATCA
TAGAGCTCTCTACTTATTGGAAATATACTAAGCACTCACAATTAGCAAAATTCAAACATA
ATTAATTTCAATCAGTCATCTGTGATTGATTAGTCTTCTATAAATATTTTAACTAATCCA
TTTCCTCACAATCGCTCAGTCAAACATCTTGATCAAATTAATAGATCACAATTATCTATA
AATGCTCAAAGGATTTTAGATGATGTTAATTTAACTAAAGATTCTATCCCACAATAAGAT
CAAAAATTAAAGGAACAAGAAGCATAGAAAAATAAAAAAACTCATTTCAGAATTAAAAAG
GGATAAAAACAAAAAAAGAATAAAGATGATGATGGTTCTAAGATGTAAGATTATTTAACT
CCTATGGATTTTATACATCTAATTCGAACTGATCCTGAAATGGCTGACGAATTTTGCTAC
TTAAATAAGAATTCTAATCCTTATGATTTTAAGATAGTAGAGTTCGATGCTCGTAATCCA
AAAGAATATATGACTATTTCTGCAAGAGTAAATCATTATATTTAATAAAATCATAAATGC
ACACAAATAAAATACTGATTCAAGATCAATATTGATATCAATTGATTATTTTAAGCACAA
TTAAATAATTTTCAAATACCTAGCTGATTTTATATTTAGGAAAAATATTTGTAATTACAA
GCAAGCAGTCAAGAAATTAATTAAATCAAAAAGCGTTTCATTCACAAAAATAATAAATAA
ATTAATATATAAATAAAGCTACGTTATTTTAAAATTAATTTTTATTTTATTAGAGAATTT
TTATCAAATTGTTTGAATAACATTTTAAAAAATTATATTTTAGGGAATAACTCATTTTAT
AGACGACTAAGCTGAATTTAAAACTATCGAAGAATGGGAAAGAGAATCGAAAATGTTCCA
CTAACTACTCGAAATAGAGTTCTTTAAGCAATATAAGAAATGGAAAAATTTCTCATTATG
GAAAAAGCTTATGAGAAGAAATATGATGAGAGAATGCTCACATGTTTTAAGCCAGTAATT
GTTTTCTGTTGACAGAAATCTTTAACCTGCTCTACTTGAAATTAGAGGCTTGTGTCTTAT
GAGCTAGGAATTCAGATACATGGAAATGAATATCAATCAACCATTAAAATATGAAGAATT
TAAAAAAACATAGGAAAGTTATAGAGTTACAGCTACAGATTATAAGTTAGATAAGTTAGA
AAACGGTATTAAAGAATTAGTTATGAGCAACTGTAAAAGAAGTTTATAAGCATTCAAAGA
GGAAAATCGTATTCCATCAAATGATGCAAACGATACTGATGAGCTTAAAGAAAAGGCTCC
TTTGTTGGTAGGTGATGAGACAGGAAAAGAAATGCCATACACTTAAGAAGCAACCATCCG
CACACATTATAAAAGACTTAATAAATTTGTACGTCTCGTTGATTATTTAATAGTTGATTC
AAAGATTTAAATGATAAACAATTCCACTTCTTCGATTGTTAGACGTAAGATAATAAATAG
TTAAAATGCTTTTATTTATTTTTTATTGAAAAACAGATATTGAAGATTTAAATGATAGTA
TAGGAGATAAATACCAATCTGTAAATAGCATGATTATGGTGGAAGCCTCTAACATAGGAC
CTGAGTTAGTGTTTACCCCAAACAGAGATATTTTAAGAAAAATGTTTGAAGAAATAATTA
GCAAAAGTGTATAAAGAATATGCAACAAGCATAAAATGCTTGTAAATGTACAAGAACTTA
GAGATTATATTAGGATTGAAGATTCAGAAGATAGAAATGGTGAAGATAGTATAGATTTAT
ATCAGATAGTACATAACGATGGCTTGTATAAGCAAAGTCAAGTAGACATAATAAATGTAT
TAAAAATTAATTTAACTATTTAACTAAATATCTTATTAAAATTATAAACTAATTAAAGGT
TTTAAATAAATCTTTTGATTTCGTTGAAGAATACTCTAAGATTCTTATTCCATTTATTTA
GATATACATCACCAATAGCAATATTAATTGGAATTAAGTAGAATAAATGGAAAATGAATT
CTTTAAAAAAATGATTGAATAATTCCGTGAAGAGGATAACAGATTTTAGTCAATAGAACC
TAATAAAGAGCTTGGTTTAATCTTTTTCGATAACATTCATCTCAAAGATAAAATCAAAAA
TATTTCTATCAATTGCTTGACAGAATTGACCAAAATGATGCCAGATCTGCTTTTTAAAAA
GGCTAAAAACTTTTATACAAAGTTGCATGCATTCAATTAAAAGATTGCCCTTGCACCAGT
CAATGTAGAATAGTTTGTTTAGTATAATGAATATATCTCCGAAATTAGCAATAATCTTGA
AGAAATGACTTCAGAAAATGCAGAAATTACAGAATTATTATTTTTAATAGAAGAATATAA
AATTAAATTACCTGAATCCTATAAAGCAAAAGTCAAAGAAGCTTCTCAACAAATTTAAAC
TCTCAGAACAAAAATAAGTGATGCATAAGCTTCTGCAGATTAAAATTCTAAAAAATTCTA
AAAATAACTGGATTAAATGATTCCAGGAATCAAGGAAGATGTAAAAGAGCTCGAAGAATA
GCTCATTAAAGTTGATTATGCTAAAGTAGAAGCAAATATAAACTAAACATGTGGCCAAAT
ACAAGAAGTAAATTTGAAAAAAAATAATTTTTGTTAAATATTTTTGATAAAATAAAGATC
AGTAACAGATTGGCAGAAATCGTTAAGCAATCTAAGAAAATTAACGATTTCTAAATTGCT
ATGTAATTGGAATTAACTATATTTGAGAAACTAGACATATTCGTTAGAGAATTTGGTATG
ATAGAAAAATTATGGATGAGCAGAAAGGAGTGGAAGAGAGAATACGATAGATGGGATATT
TAGCCATTTTTCGAAATAGATATAGAAGATGTCAGTAATAAGGTTGAAAAACTAGGAAAA
GCTGCTAATCACTGTGCAAAAGAAATGGAAACTAATGAAGTTGCTCGTGTTTTTAAAAAT
TAAGTTGAAGAATTTAGAAATGTCTTATCCCTATTACAATCCCTCAGAGACCCAGCTTTG
TAAGAAAAGTGGGATGATGTAAGGAGCTTAATAAAGGAAAATAGAGCATGGGAAAAGGAG
CCATTCCATGACATAAAAGATTCTATGTACACTCTAGGATGGATTAATAAACATAATTTA
GTTGAATATAAAGATAAAGTAGCTGAAATTGCATTAAAGGCTGCCAAGGAAGCTGAATTA
AATAAGATGTATAAGGGAGTTGAAGCATTCTGGACTATGAGTTAATTGACAGTCAATAGC
TATAAAGACAGATAAGATGCTTCTATTTTGGGAAATAACGATGATTTAATTGCTAAATTG
GATGATGCTCTGTTAACTGTAAATAACATATTAGCTTCAAGATTCGTTGAATCAATTGCT
ACTAAAGTTGAAGCTAAACAAAAAAGTTTAAGGTATATTATTTATTAATTTAATTATTTT
TAAAAATATTATTTCTATTAGATAATTTTAAGAATTAATGGATGAGTGGATGATGCACTA
AAGAAATTGGCTTTATTTAGAGCCTATTCTTACTTCTCCTTATGCTGTTAAGACAATGGC
AAAAGAAGTAAAAAGTTTTAATAACGCTGATGCCTAGTGGAAAAGAATCATGAAAGCAGC
AAGAGATAATCCTTAGCTAAGAAGATTCAATGATGAATTAATCAAGACAACACTTACAAC
TTTAAGAAATAACAATGCTGCTTTTGAAATTATACAAAAAGCTTTAGATGAACTGCTTGA
GAAAAAGAGAGAAATCTTCTAAAGATTCTTCTTCTTATCAAATGATGAATTATTGGAAAT
TTTAAGTTAAGCTAAAAATATCAAGTCGGTCATTCCTCACTTACGTAAATGTTTTGAAAA
TATTGTCAAGTTAGAGTTCGACCATTTGGACACTGCAGTGTAAATATTTATAAAACCATT
TAAAATAATAAAATCCTTTTTTTTTATATCTTATTTTTAGTGGAATGATATCTGCTGAAG
GTGAAAAGGTTGTCTTAAAAGGTTACTAAGCAAGAGGTGAAGAAGTTGAAAACTGGTTTA
AAGATTTGGAAGAAGCTATGAAAAATTCATTGAGATATGTGATGAGATCTGCTCTTCTTA
AGTACGATGATGAAGACACCCAAAGATCTCAATGGGTAATATCTTTCCCATCATAAGTCG
TCCTTGCTCTTGATGCTATATATTGGACAAAAATCACAGAAGAAAATTATTTAAGTCCAG
AATCTGAAGGCGATTTATACGATTGGCTGGAAGGGTAGATGTGTAATAACTTCTAAAATT
TTTAATTCTATCAATAAATAAATAATTATTCTTTAAAATTATAAAAATAGCCTAATTAGA
AGAATTAACTACTTTAATCCGTGGTGATCTAACTGAATTATAAAGAAAGACCCTATCAGC
TTTAGCTGTATAAGATGTTCATTACAGAGATATCATAGAAGAGCTAGCTTAAGAAGGAGT
CGAATCAACAACTGAATTCAAATGGCAGTAGTAACTAAGATTCTACATTGAAGATGAATC
TATTTGGTGCAAATAAGTAAATGCTAAACTTCCTTATGGCTATGAGTATCTTGGTGCTTC
TCCAAGATTGGTTATTACTCCATTAACAGATAGATGTTGGATGACTATAACTGGAGCTCT
TGGTATCAAACTTGGAGCAGCTCCTGCTGGCCCAGCTGGAACTGGTAAAACAGAATCTTG
CAAGGATTTGGCAAAAGTAAGAAAAAAATTAATATTTAAAAAATCTTTCAATTTATTTTA
TGAATTAATTTTAGGCACTTGGTAAATATTGTATTGTTTTTAACTGCTCAGAGTAAATTA
ATGTAAAAATGATGGAAAAATTATTCATGGGTCTTTGCTACACAGGATCATGGACTTGTT
TGGATGAATTTAACCGTATTGATATCGAAGTATTATCAGTTATAGCTCAATAAGTACTAA
CAATTAGAGAGGCTCATTTAAGATTATCGGCCTCTTCTGGAAACGATAGATAATTCAACT
TCTTTGGAAAAATGGTAACTTTAGCTTTAACTGCTGACATGGGTATATTCACTACCATGA
ATCCAGGTTATGCTGGTAGAACAGAACTTCCTGATAACTTAAAAGTACTCTTCAGACCTG
TAGCTATGATGGTTCCTGATTATGCACTTATTGCAGAAATTATGTTATTTGCTGAAGGTT
TTTCAAATGCAAAGGATTTATCACGTAAAATGACTAAACTATATACTCTAAGTTCTGAAT
AACTTTCATAGCAGGATCACTATGATTTTGGTATGAGAGCTGTAAAGAGTGTTTTGGTCA
TGGCTGGTGCATTGAAGAGAGCTGAGCCAAATATTTCTGAAGATATTGTTCTTATTAGAG
CCATGAGAGATTCAAATGTGCCTAAATTCTTGAGTCATGATATTCCTCTATTTAATGCAA
TTGTTTAAGATTTATTCCCTGGATTAGATATTCCTCCTATCTAAAATAAATAATTGGAAG
ATGTCATTAGACAAAATATATCTGATGAAAACCGTAATTTATTTTTAAACTTAATTTAAT
CAATTAATTAATTAATATTTAATTTTTAAATTTTATATTAGTTGTGCCTTGTAATACATT
CATAGAAAAAGTTTTGCAATTCCATGAAACTCTTAAAGTACGTTTTGGAGTTATGGTTGT
AGGACCAACTATGGGAGGTAAATCTAAAGTTATAGATGTTTTGAGATTGTCATACTGTGA
GCTTAACAAAAGAATAAGAGGTGATAATGAAAAAACTGTTAATAACCATCCTGACTTTTA
AAATATTTAAATGACTGTTCTCAATCCTAAGTCTATTTCTATGGAGGAATTATATGGAGA
CTTTGATCCTCTTTCATAAAGTTGGACTGATGGTTTGGCCTCAACAATCATGAGGTAATA
CGTATCTCTTGAATCAACTGACAAAAGATGGGTAATTTACTTTATGATCTTCATATATGT
CATTAAGTTTTTTTCTTTTTAAAGGTAATTTTTGATGGCCCTGTCGATGCTCTGTGGATT
GAAAATATGAATACAGTGCTTGATGATTCAATGACACTCTGCTTATCAAATGGTGAGAGA
ATCAAACTTAAGCCATAATTAAGAATGCTCTTTGAAGTATAGGATCTCGCTGTTGCCAGT
CCTGCCACAGTAAGTAGATGTGGTATGGTCTATATAGATCAAGATGTTGTTGGCTATGAA
GCTATTGTAGAAAGTTACTTTTAGAAAGAAATATTCCCCCTTTTGAAGAAAGAATAGCAC
AAAGAATAACTGAAGAACAGTTTCAATATTAGTTTCAAAAAGATTCTAAATCATATGAAG
AAGAAAAAGATTTAACAAACTATACCAACAGTTGAAGCTAACATTGCGATTTCAGTTTGT
AGAAATATAAAACTTATATTAGAACTAGATTAAAAAGATAATCTTGAAAATGAAAACTCT
AAGAAAGCTATTGATAAGTTACTTCTCTGGGCTATAGGCTGGGGTATTGGAGCAACTGTT
TCTACATTGAACATTAAAGAGTTCTAAGATGGTCTCTCAGAAGCATTCACTGCTGATATT
TCTCCTCGTGGATCTCTATTTGAGTATTATTACACTATCGGTAAGGGAGAAGGAGATTTT
ATTGCTTGGTCAGAAATTATTCCTGAATTTTCATATTCCCCTGAAATGTCTTATTTCTAA
CTTGTGGTACCTACAACTGACACAGTTTGTTATTCATGGTTCTTAGATAAAAATATATAA
CTTTTGCATCCTATTTTCTTAACAGGTAAAAGTCATCAATTAATTAATTTATCTAATTTG
AATTGTATTTCTATATAGGTTTAACTGGTACAGGTAAGACTATTATCACATCTAGTACTC
TTAACACTTTGAAAGATTAAAATTTAGTTGCTACTTGTGAACTTACTTTTTCAGCAAAAA
CTTCTTCCTTATCAACCTAAGGTTAAATTGAAAATAAGCTACAGACTCAAAGAAAAAATA
AAAAGGTAATTTTAATGCCTCCTCCTGGACGTAAGCTTGTTGTATTCATAGATGATATTA
ACATGCCTTCTGTAGAAATATATGGAGCCTAACCTCCAATTGAATTATTGAGATAATTTA
TGGATTACAAAGGCCTATATGATAGGAAAACTTTACAATGGAAGTAAATTGATTCAACTG
TCTTAATTGCTGCTGCTGCACCTCCTGGAGGTGGTAGAAGTTCTCTCACTGCAAGGTATA
GTTTAAACAAATTTAATAGAATAAAATAATAACTTATTTTTGAAATTAGATTCACAAGAC
ATTTTTCAATTATGACAGTACCAGATAGCTAAGCTGCTTCATTAACACACATTTTTAGTA
GTATCTTCAATAACTTTTTGAGAGTGAAAAAATTCAGAAAGGAAATTACTGAGCTAGGAG
AAAATGAAAGTGTAGTTAATGCTACTTTGAATATTTATAGATACATATCTGAAGAACTTT
TACCTACACCTTCAAAGCAGCATTATGTTTTTAATTTAAGAGATGTGTCAAAAGTATTTT
AAGGTCTTCTATTAGCAAAACCCCACATTATATTGAATGTAGATTCTCTTGTTAAATTGT
GGATTCACGAAATGTCCAGAGTCTTCTGTGATAGATTGATTAACGAATAAGACAGAAACT
GGTTTATGGATACAATTTAAAAATAACTTTTTATCAACTTTAAACTAGACTGGAAAAAAG
TAAATAAAATCTTTTAGAGAAGCATTTAAATTAAAAATTTTTTTATTACATAAAAAAGGA
GGATGTATTTAACGAGGTACCTCTTATTTTCTCTGATTTTTTGAAGCGTAATATCGAATT
TGAAGACAGGGTTTATGAAGAAGCTAAGGATTTCTAAAGACTAACTAAGATTATTGAAGA
ATATATGAATGAAGATACTAAGCTGCAATTAATTCTTTTCAAAGATGCTGTCGAGCATAT
GTCTAGAATAGCCAGAGTTCTTAGTTTACAGAGAGGACATTTCATGATTGTTGGTGTTGG
TGGCTCAGGAAAGAAGAGTATCACAACTCTCGCATCAGCTCTTGCTGGGTGTGAGTTAGA
TAGTATTGAACCCAAAAAATAATATGGTAAAAAGGAATTCAAAGAGGATTTACTTAGAAT
GATGAAGAAAGTAGGTATTGAAAATAAGGTAAATTTTTTTATTTATTATTGTGATTAATG
AAAAATTAATTAATCTTGCGAAAATAAAAAAAGAGATTAACTTTCTTATTTGCAGACACT
CAAATACTTTAAGAAGGATTTTTAGAGGATGTAAATAATTTGCTAAATAGTGGTGAAGTT
CCTAATATGCTTCAAAAAGATGAAGTTGAAGATATTATTTAGTAGTTATCTTAAGAAGCT
AGGGAGCACAAGATTACAGACATATACTAGTATTTTGTAGAAAAAGTGAGAAGCTAAATG
CATATTGTTTTGGCACTTTCTCCTGTAGGTAACGCCCTTAGAGTTCGTATGCGTATGTTC
CCTTCTATTGTAAACTGCTGTACTATTGATTGGCTTAATCCCTGGCCTTAAGAAGCACTT
ATGACAGTGGCAAAGATGTTCTTGGAAAATTTAGAATTCGAAGGACTTACGAAAGAGAGA
AAAGAATAACTTTCAGAGTGTTGTGTGTTTGTACATTAATCTGTAGAAGAAATGACTGAA
ACCTACTTCAAAAATTTAAAGAGAAGAGTTTATATCACCCCTAAAAGTTATATCGATCTT
ATAGAAAGTTATAAATAATTAATTAAAATGAAATAAGATTAACTTGAGAGCTAAAAAAAT
AAACTTTCAAATGGTCTTTATAAATTAAAAGAAGCTAATGACACAATTGCCTCATTAAAA
GAAAAACTTACTGAGTTGCAACCTGTTTTGTAAAAGAAAACAATTGAGCAGGATGAATTG
ATTAAAAAATTAGAAGTAGATAGGTAAAATAAGCGTTAATAAATTAAATTTTATTTATAA
ATAAATATTAACTAAATAAATAGCTATGAAGCAAATAAAGTTAGATCAGTTGTCAAGGAA
GAAGAAGCATAAGTAAATGAAAAAGCTTCTGAAATCAGAGAAATGAAAGTTGAAGCAGAT
AAAGTTCTTTAGGCTGCTCTTCCTATGCTTTAAGCTGCCAATGAAGCACTAAATATTTTG
GATAGAAAAGTTATTTCTGAAATTAAAGCTAATAATAACCCTAATGAGCTTGTTCTCTTT
ACACTTTAATGTGTTTGTTGTTTATTTGATGAAAAGTAAGATTGGGATAGCATTAAGAAG
GTATTTATTCTTTTTTTGTATTTATAATATATCCTTCAACTCTTTTTTTTAATCAGCTTC
TTGCAGATCCAAATTTGGTATCTCGTATGAAAAACTTAGATGTTTACAATATAAGTCCCA
AAGTAGAAAAAAATATTAAGGCAAAAATAGCAACAAATGAAAATTTCAACCCTCAAAAAT
TAGCAACTATCTAAGCAGCTGCAAAGGCTATTTGTGAATGGGTTATGTAATTCTTTTTGA
TTTAATTTTTAAACTTAAGTTTTTAATTATGAAATTTTATTTAAAAGTGCCGTTGCCAAC
TTTACAGATGTCAATAAATAAATTCAATCTAAAAAGAATGTTGTAGATAAAATGAACTAA
GAGTTAGATAAGGCTAACAAAGAACTTAGTGTAAAGCAAGCTGAATTACAAAAAGTAGAA
GATAAAGTTGCTAAACTTGAAAAAGAATACAACGATAACAAATTAGAAAAAGATAGATTA
GACAAAGAAATTCAAACCACTGCAGATAGACTTGTTAGAGCTGAAGAACTTACTTAAGGT
TTAGCAGATGAATAAATTAGATGGAAAGAAACAGTGGGAACTTTAGGAGATCAAATTAAA
CTTTTAGTTGGAGATGTTTTCGTAGCAGGTGCCTCTGTGACTTATTATGGACCTTTCCCT
GGTACTTATAGAGAAGATTTAGTTAAATAGTGGCTCTAAAAATGTGAATAAATGGAGATA
CCCAAAAGTGAAAATTATGTTCTTGAAAACGTACTTGGAGATCCAGTCGAAGTAATTTTT
CTCAAAAAAGGAATATTTTATTTAAATAATTTTTAAATTTAGATAAGAAATTGGAATGCA
AAAGGATTACCATCAGATAGCGTTTCTATTAATAACGGTATTTTAGTTCATTCATGCAGA
AATTATCCTCTTTTAATAGATCCACAACTTTAAGCTTCTAAATGGATTAAAAATTTGAAT
TCTGAATCTAACATGATGTGCACTAAAATGAGTGATGAAAAGCTTTTCTAGACCTTAGAA
GTTTGTATAAGAATGGTATTTATTTTCATTGATTAATTTGTGTTAAAGACAAAAATTGAT
TTTTTTATTTAATAGGGTTAACCATTGATGATAGAAGATATGGAAGATACTCTTGATACC
ATACTAGAGCCTCTTTTACTGAAATAGTTTACTATTAATAATAGAAGAAAAATGATAAAA
GTTGGTGATGCAGATGTTGAATTTGATAATAATTTCAAGCTTTACATTCAAACAAAGAGT
CCTAATCCAAACTTTTTGCCAGAAATATTTATTAGAGTGACTGTAATCAATTTTACTGTT
ACTGAATTAGGTTTGGAGGAATAATTATTAGGAGATGTTGTAAGGAAGGAAATGCCAGAA
GTAGAATTAACCAAAAATGAGCTTATTATCTCTATTGCTCAAGGTAAAACTTAGTTAAAG
AAAAATGAAGACAGAATTTTAGAATTACTGACTAGCTCTAAAGGTATGATTCTTGATGAT
GTTGAATTGATTGAAAATTTGAAGCTATCAAAGAAGACTTCAGAAATTGTGAAAGAAAAG
ATTACTGAAGCTGAAGAGAAGAAAGTAGAAATAGAAGAAGCTCGTTCATAATACAAGCCT
GTTGCTCAAAGAGGCTCTTATCTTTACTTTGTTATTGCTGATTTAGCTTTGATTGATCCT
ATGTACTAATTCTCATTAGCCTATTTTAGCAGATTATTTAATTTGATTATTGAAAATTCA
GAAAAGAGTCCAGAAATTACTCAAAGAGTTGAGATATTAATAAATTCAATAACACAAACT
ATTTTCTTAAATGTGTGTCGAGGCTTGTTCAACGATCACAAGCGTATATTCTCATTTTTA
GTCTCTGCTACCATTTAGTAGAGAAGTGGAATCATCACTAAACAAGAGTGGAATCTCTTT
TGTAGAGGTGCTCCAATACTCAAAGAAAAAGCTCCAGCAATTCCTCAGGGACTTTAAATC
AACTAAAAAACATGGAATAGTATATTTAGTGCTTCTTAGGTAATTTCTAACTTTGGTACA
TGGTTCTAGAATTTAAAAGAACATTATAAAGAATGGGATGCATGGATTAATTGTGCTGAA
CCTTTTACTACTCCATTCCCTAAATAATTTAAGGGTGAAATTACACCATTTTAACGCTTA
ATTCTTGTAAGACTTTTAAGAGAAGAGAAATCATTGTATGCTATGACTTACTATGTAGAA
TAGTCATTAGGGTCTAAATTTTCATCAAACAATGCAGCAATAATGGAAGAGGTAATAATT
ACTTAAAACATATTCAAATTATTTATATATTTATACTGATTTTGATTAATAAATAAATAA
TAGGTTTACAAAGATACAGATTATAAAACACCTTTGATTTTCATTTTATCTTAGGGTGCT
GATCCTCTATTAAATTTACTGAGATTCGCTAAGGATACGAAAATCTCTTCTGAAAAGTTA
GTGGTAATATCTTTAGGTTAAGGCTAAGGACCAATAGCTCAAAAAGCTATCGAAAACGGT
TTGAAAAATGGTGGATGGGTAATATTACAAAACTGCCATTTAGGTAAATCTTTTATGCCA
AAGCTTGAAGAGCTGATAGCAGGATTTAATAATGAAGATTAAGAATTTAATACCGAATTT
AGATTATTCTTAACATCTATGCCTTGTGATTATTTCCCTGTATCAATCCTGTAAAACGGA
GTTAAGCTTACTAACGAACCGTAAAATCAATTAAATTATTTAAAATTTATATATTAAAAT
TATTTATTTAATATTAGACCAAAAGGAATAAAATCAAACATCTAAAAGAGCTATGCAGAA
CTATCAGAAGAAAGATTTGAAAGCTGCACTAAAGAAAAACCATGGAAGAAATTGCTTTAT
TCTATATCATTCTTCCATGCCATTATTTAAGAAAGAAGAAAGTTTGGTCCTTTGGGATGG
AATATTAGATATGAATTTAATGATTCAGATTTGGATACAAGTATCACTATTCTGCGTGAT
ATGTTAGAAGTGAATGAAGAAATTCCTTGGGATGCACTCAGATATGTTATAGGTTAAATT
ACTTATGGTGGTCGTGTTACAGATGATTGGGACAGAAGAACATTGATGGCTATTCTAAAT
AGTTTCCTTAATGAAGAAGTGCTTTTAGATACTTATAAATTTTCTGAGTCAGGAATTTAT
ATGTCATCTAAAATAGGAAAGCTGAAAGATTATAGGTAATTTATTATTTTATTTTTATAA
TATTAAAATTATTTATTTATTTATAACAAAAGATCATTAATTGAAAAATACCCTGCCTTT
GAGTCACCTGAAGTGTTTGGTATGCACGAAAATGCTAACATAACATTCTAGCTGAAGGAA
TCAAAAATAGCTCTTGACACCATCTTAAATATGCAGCCAAGAGAAAATACTGCAAGTGGA
GAAGGTTAGAAGACTCCTGACCAAATTATAGAAGAAATGTGCAATATGTTTGAAGAAAGA
TTGCCTCCTCCTCTTAAGAAAGAAGTATTCACTTCTAAAAAACCTGAATCAATCGATTCT
TTGCAAGTTTGCATGGTAAAAATAAATAAATAAATTCATAAAATTTATTCAAATAAAAAT
TCCTAATTTTATTTATTCGTTTTAAATATTCATGTTTCATAAAAAAATAAAATAGAATCA
AGAGTGTGAGAGATTTAACAAATTGCTTTCAGTTATGAAATAGAGTTTGAGTAATTTGAA
AAAAGCTATTAAGGGTGAGGTTGTTATGAGCGCCGAACTTGATAAGACATATACAAGTAT
GATGAATAACACAGTGCCTGAAATGTGGAAGGCTCGCTCTTATCCTTCGCTTAAGCCTTT
GCAAAGTTGGTTTGAAGATCTTGTAAAGAGAACTGAATTTTTCCGCTAGTGGCTTAACTT
GGATGGAAAGCCCAAAGTGTATTGGCTTCCCGCTTTCTTCTTCCCTCAAGGTTTCTTAAC
ATCAGTTTTGCAAAACTTTGCTCGTTAAAATAAAATTGCAATTGACGTGCTCAATTTCGG
ATTTAAATTTAGTAAATATACTGAACCTGAATAGGTAATAGAAATGTCTATTACTGGAGC
TTACATATACGGTCTATTTATAGAAGGCTGTTAATTTGATGTAAGTAAGGGTATTTTAGA
AGATAGTAGTCCTGGTGTAATGTATACTTCAGCTCCTGTAATTGAATTTGTGCCTAACGA
AAATTATTAGTCAAAATAAGAAGATTATAGAATGCCTGTATATAAAACAACTTCAAGAGC
AGGTACACTTTCAACAACCGGTCATTCAACTAACTTTATTATAGGTATTGATACACCAAC
TAAAAAGAAGCCAGAATATTGGATTTTAAAGGGAGCTGCTTATACTTGTGCTTTGAATGA
TTGA