Identifiers and Description

Gene Model Identifier

TTHERM_00821980

Standard Name

DYH20 (DYnein Heavy chain)

Aliases

PreTt07756 | 140.m00071 | 3759.m00372

Description

Heavy chain subunit of ciliary single-headed inner arm dynein (IAD)"

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00821980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_128660
WormBaseWBGene000009629.997093137033517e-262locus:dhc-1 Dynein heavy cha
in, cytoplasmic status:Parti
ally_confirmed UniProt:Q1902
0 protein_id:CCD64267.1
Tetrahymena borealisEI9_17512.19.997093137033517e-262dynein heavy chain family prot
ein (4141 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig15709.0.g859.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00821980(coding)
ATGAGTCACTTTAGGACAAAATCTTTTAAGGTTGCAGCTCATAAAACTCCCTCAAAGTAT
GAAATTGAAGATGATCCTAATAAGGGACAGGATCAAAATAAGATTAGCAAGTTTAGTAAA
GAAAATTTTATGAGTCCATCTCCTAAAAAATAAAAATTCTCAAAATCTCCTGAGAGATCA
AAGCCTTTCAAGAAGTATGATTTGACCAAAATATCACCAGCACCTTAGAAATATGTAGGA
CCTAAAAAATATAAAGAGTATTGGATGCCATAAATTTTAGAGGAAAGTGGTATTGATTTT
GATTCATGTATTGTAGAACATAGTTACTTACCACTGAAAACATTCAACAATACAGATTAT
GACTTTTATTCTAATGAAGAAATCTTCTAAAAACTTCAAGAAAGAGGTGAAATGAGAGCA
CAAGCTATAATTTAAAGAGAAGAGAAAAGGTTTGAGTGGGAAGAAGTTTTAGTTATAAGT
TATGATCAAGAAAAAGAACTCTTCACAGTTTAGACAGAAGATTAGCTGAATTTCTTCTTA
AATCGTATTGAGCTTATTTTTGTTGAGGAAGAGGATCCTTTTTAATACACTCAAAAGCTT
ATAAATGCCTGGAATATGAGAACATTTATGGATTCTATTCTTAGATATAATTTTTATTTA
GATAACATGCCTTGCCATGATATGGAATATATAGATGAACAAACAGAAAGAAATATTTTA
AGTTTAGTTTTTAACAAATCCATTCTCTAATAGGGTGATGTAACCTAGCTTTTGGAAGAA
GTAAATTAATAATATGTAAGAACATAAAATAAGCTCGTATTCAATAAATACTTATCTACT
AATGCATCTGACATATTCCCTACTCCTCTGATATTACCTCCTGTAGAAGAAAAGATAGTC
CCTGAAAAAGGTAAACTTATGTTAGAAAGACTAAAAGGAGCTAAAGAATTAGTAGTTTAT
GAAAGCGGCGTAACATAAAGATTCAAAGCAAAAGTTTTTGAAGAAATTAGAAAAGATTTT
GCAAATCATTCAATTTACAGCATAAAAGAAGTTATTTAATGTCTTGCAAAGCTTGAGAAT
GAATGCCAATAAATTGAAGGAGAGGAAATATTTGTATATTTCTTTGATAAGCCATAGGAA
ATTAATGAATTTAGAATTTCATAAGATTCTCATATTGATAGAAAGCAAGATTTAATTTGC
AATAAGTGGCCTGAAAGGTTAGAAAAAGTATTTGAGAGAACCCTCTAAATCTCTAAGAAT
AAAAGCAGAATAGTTGATGACGATAAGTTGGAAAGAGTTATGGCTCTAGTTAGATATAAA
ATGCAAGACACCATTTATAATATCTGCAACTATTCATTCAACAAACTCTATGAATTCCTT
TTTTCATTTGTTCCAGATTAAGTAAAAATTGTTAATTCTGGAGATGTATAAAATATTTAC
GATTCTAAGACCAATACTCTTTAAACATCACCTAGAGTAATTACAATAGAGAGTTAAAAT
GGAATGAATTCAATGGCTTCTTTAGTTGACTACCAAGAAAAACCTAAAAAAGAATTTGCT
CTTTATAAAATTGCAGTAGTAAGCAAGGATGATACTTTTTAGTATTCTTATGATTCTAAT
TTCTTCTTAGAAATGCTTTAAGGTTATTTCAAGAATACCCTAAACAAATTTCAAAAAATA
GCAGATATTGAGTTTAAACTGAATTCTAACTTTTAATTTGTGCATAAAACGAAGCAGTAT
GTAAAAGCCCCTTAACTTCCTAATTAAGAACCTAGGAGAGCTAACTTAAATGAGACAGGA
GATAATAGAGTTGATGATGAAAATTTATGGGTTTGGGACTTATGGGTAGACTTAACATAG
TTAATCAAGAAATGTGTTGATCCACTAGATGAGTACTTAACTCATTTCAAGAAATTTGAA
AATATCCTAAGATTAAACCCTGATACATACTCTAAAGAGTTTGAGGGAACAGAAGAAAAT
CCTAGAGATATTTAAGAAATAAAAGAAGAAATTATTTAAACATTAATCAAAGAAGAGGAA
ACAAAAAAACTTTTACCTGAACTCATAAAGGTGTCTATTTTTGAAATTGACTTAAAAATT
ATCAGCAATACTTTGGCTGGAAAATACAAGAAATTATCAAATAATTTGAAGGACATCATT
TGTTAGAGAGCAAAGAAATTAACAAATAATATAATCACTGAATTCTAAGAAATGCACTTC
ACAATAAATAAGCAACCCTCAAATATTGAAGAGTTAACTGATATTTAAAATTTTATAAGC
AATGTTCCAACTGAAATGGAGAAAAAAAAAGTAGAAATTGAAAGAATATTAGAAATTTAT
GATATCTTAGATGAATTTATGTACAGATTAGAGAAAGAGGCAATCAAGAGCAAACAAGAA
ATGCAATTCCTTCCTAAGAAAACTTTATAAATGCTAGAAAAGAGAAGTAATCTTCTTGAT
GATATCAAATCTAATTTCTTGAGAGATTAGTAGAAAGATTAAGATATGTTTAGGAAAGCT
ATTGATGCTGCCCAAAAAAAGATTATGACTTTCCATAGCTACACCAATATCAATCAACAT
GAAGAAGTAGCTCAAAAAGCCACTGAATTATATAATGAATTAGCCAAAATGATTGAACAA
TCTCGTAAATTCAACACAAGAGAACAACTCTTTGGTTAGCAAATGACAGATTATTCCAAA
ATTATTTAAATGCAAAAGGACTTCACTCCTTATTATAATTTGTGGACTATATCTAGCAAA
TGGTTTGAAAATATTTAAATATGGCTTTATAGCAGTTGGGATAAATTAGATGCTCCTTAT
TGTGAAAAATTTGTTGAAGATGGATTTAGAACTTTGGGCTAGACAATTAGATTCTTTAAA
GAAAAGAATCTTTCTGCTGTACAAAAAATAGCTGAGAAAGTTAAAAAGGAGTTTGATGAA
TTCCGTCCAAAAGTCCCTTTGATGGTTGCACTTAAGAAATAAGGAATGAAAGATAGACAT
TGGGATGCAATTACAAATAAAGTTGGATTCGAGGTTAGACCTGATAATAGTTTCAACTTT
TAAAAAGTTTTAGATATGGGCTTGATGACTCATATTGAACAGTGTGTAGAAATAGGTGAA
TAAGCAGCAAAAGAATACACTATCGAAGAAATGTTAAAAAATATGAAATCAAAATGGGCT
ACTGTGGAATTTGATCTAATGACCTACAAACATTTGTTTATCATCAGGGGATCTGATGAG
ATTTAAGCTCTCTTGGATGAACATTTAGTAAATACTTAAGCAATGCAGTTTTCTCCTTAT
AAAAAACCATTCGAAGAAGAAATCATAGAATGGAATAATCAACTTAAATTGATGAGTGAT
ATTTTGGAAGAATGGATTAAAGTGCAGCTGTAGTGGATGTATCTTTAACCTATTTTTGAC
AGCAAAGATATAGCAAAATAACTTCCTCATGAAACAAGAAAGTTCAAATAAGTTGACGAT
ATTTGGAAAAAAGCTATGATTTAAGCTAGAGATAAAAAATTAGTTATAAGAGTATGTAGT
GAGCCTAACTTACTAGAAAATCTTCGAAATGCTAATGAAAAATTTGATTAAATACAAAAA
GAGCTAAATAATTACCTTGAAAAGAAGAGAGAAAAGTTTGCTCGTTTTTATTTCTTATCC
AATGATGATCTACTCGAAATTCTTTCTTAAACCAAAGAGCCTACTGCTGTCTAGCCTCAT
TTGAAGAAGGTTTTTGAAAATATTCATTAAATTGAATTCGATGATTAAAAAATCATTCAT
GCTATGTTTTCAGCTGAAAAAGAAAAAATTAACTTTGTCAAAACTGTAAACCCTAATCAT
AAAAATGTAGAAGAGTGGATGGGTGAAGTAGAAAATATGATGAAAGCCTCTGTAAGATTT
GAGCTCTTTAACTCATATCAAAAGTATCCAGACACACCTAGAACTCGTTGGGTTGTTTCT
CATCCAGGTTAGTGTGTTCTCAATGGTTCTTAGATGCACTGGACTCTAGAAGTAGAATAA
GCTTTAAAATAAAATTCTGTTAAGAAATATTGGGATGTCCTTAGCTCTCAACTTAATGAT
TTAGTTGATTTAGTTAGAACAAAGCTTACAAAGTAACAGATGGTTACAATTAATGCACTT
ATTGTCATTGATGTGCATGCAAAGGATGTGACTGAGATTTTGTGGAGAAATGAAATCACT
GACATTAGTGCTTTTGAGTGGATATCGTAGCTAAGATATTATTGGGAAAAAGAAAATTGT
ATGGTCAAATGTATTTAAACCTCATTCCCTTATGGTTATGAGTATTTGGGTAATACTCTT
AGATTAGTTATTACTCCTCTTACTGATAAGTGTTACATGACTTTGATGGGTGCTCTCAAA
TTAAATTTAGGAGGTGCCCCTGCAGGACCTGCCGGTACAGGTAAAACAGAATCGACAAAA
GATCTTGCTAAAGCACTTGCAAAGTAGTGTGTAGTATTTAATTGTTCTGATAGTATGGAT
TATATTATGCTTGGTAAGTTCTTTAAGGGTTTAGCTAGTGCTGGTGCTTGGTGCTGTTTT
GATGAGTTTAATCGTATCAATATTGAAGTATTGTCAGTTATTGCATAGTAATTGCTAATT
CTATTTGGTGAAAAAGCAAAAGGTTCTTCCTAGTGTGAGTTTGAAGGAAGTATAATAAAA
ATCTAACCTACATTTTGTGTCTTCATCACTATGAATCCAGGTTATGCTGGTCGTACTGAA
TTGCCAGACAACTTAAAGGCCCTCTTCAGAGCAGTAGCTATGATGGTTCCTGATTATGCT
ATGATTGGTGAAATCATGCTTTACAGTTTTGGTTTCAAATAGGGTAGAGATTTAGCTAAG
AAAATGGTTGCTACTTTTAAGTTATCTTCAGAATAATTATCATCTTAAGACCATTATGAT
TATGGTATGAGAGCAGTTAGAAGTGTCATTAATGCAGCTGGTCTTTTGAAAGCAGCAGAG
CCTGATATGAATGAAGAACAACTCTTACTTAGAGCCTTAAGGGATGTTAATGTGCCCAAA
TTCCTTAAAGATGATCTTCCTCTATTCGAAAATATTATTTTAGATCTTTTCCCAGGAGTT
GAGAAGCCTGTAATTAACTATGGAGAATTGCTTGATGCAATGTCAAAGTAAAGTAAAGTA
TTAGGATTATAGCCCGTTAAGCCTTTCCTTGATAAAGTTATTTAGCTTTATGATACAATT
TAAGTTAGACATGGTCTCATGCTTGTTGGACCAACAGGAGGTGGTAAAACTTCAAATTAC
AGAGTTCTCTAAAAGGCTATGACTTCATTAGAGAAAAAGGGATAAGCAAAAGTTAATACT
CATATTATGAATCCTAAATCAATCACTATGGGATAGTTATATGGATAGTTTAATGATGCC
ACTCATGAGTGGTCTGACGGTGTTCTTGCTTATATTATTAGAGAAACAGTCAAGGATTAA
TCAAGTGATAGACATTGGATTGTTTTTGATGGTCCAGTTGATGCTATTTGGATTGAATCT
ATGAATACAGTGCTTGATGATAATAAGAAATTATGTTTAAATAGTGGCTAAATTCTCACA
CTTACTCCTTACATGACTATGATGTTTGAAGTAGAAGACTTAGCGGTTGCTTCTCCTGCT
ACAGTTAGTCGTTGTGGAATGGTTTATATGGAGCCAAGTACAATGGGTTTAACTCCTTTA
GTTAATAGCTGGATGGACTTTAGAATCACTGAGTCTTTCAGAGCAAATAAGCTTTTTGTT
CCTAAATTGCAGTCATTATTTGAAGAATATTTAGAATTTTGCATCGATTTTATTAGAAAA
AATTGCATAGAAATAGTTGATTCTATGAACAACAACCTTGCTTAGTCACTAATGCGTAAT
CTAAACTGTTTCTTAGTTAATTATGTTGATACAGATTTTAAAAAAATACCTGCTGAAGAA
ATTGAAAAATTACTTGACCATCTTGAATAAATATTTATTTTTAGCTTGATTTGGTCAATA
GGATGCACAATCACTTATGAAGGCAGGGTTAAATTTGACAATTATCTTAGAGGTCTTATG
AAATAAAATCAATGCTCTTTTAGTTTCCCTTAAGAAGGCTTGGTTTATGATTATTAATAT
ATTGAGAAAATTGGTGAATTTTAACATTGGAAGGAGAATTTTAAGGATTTTGCCATTAAT
GATAAGCTAGGTTACCATGAAATTATGATTCCAACAGCAGATTCCACCAGAAATATGTAT
TTTACTAAAATTCATTTAACTATTGGATAGCACGTTATGTCACCTGGCCCAACTGGTACA
GGTAAGAGTTTAAATCTCTTTTAACTTCTTGGTTCTTAAATGGATGAATAATTCTAATAT
ATTGCTCTTGCTTTTAGTGCTTAGACTAGTGCTAATTAAACTTAGGATACAATTGATAGC
AAAATGGATAAGAGAAGAAAAGGCTACTATGGCCCACCTATCGGAAAAAAATGCATTATC
TTTATTGATGATTTGAACATGCCTAAAAAGGAAACTTATGGAGCTTAGCCTCCTATTGAA
CTTATTCGTTAATTCATCGATCATAGAGGTTGGTATAATAGAAAGGATCTCCAGTTTATG
AAATTAGAAGATATTATTCTTCTTACTGCTATGGGCCCTCCTGGTGGTGGTCGTACATTT
ATAACAAACAGATTTGTCAGACATTTTAACATTCTAGCTTACACTGAATTAGATGAAGGA
ACAATTAAACAAATTTTTGGAACTATGTCCTCCTTTTTCTTAAATAAATTCGAAGAACCT
ATTAAAAAGTGCATTTAATTGGTTGTTGACACTTCTTATAATGTTTATTAGAGAGTAAGA
GAAGAATTGCTCCCTACTCCTTCAAAATCTCACTACACATTTAATTTAAGAGACATTAAT
AAAGTCTTTTAAGGTGTTTGCAATGCATCCTCAAAGCATGTTACTGAATGTGCATAATTA
GTAAGACTTTGGTTCCATGAAAATATGAGAGTTTATCATGACCGTTTAACAACAGAAGAA
GACAGATAATACTTAAAGAATCTCTTGATTGGATATTTTGAGCAATTCGGCTTGAACTAA
AAAGATGTTTTAGACATGGATAGAATCATTTTTGGTGATTTTGTTTAAGGCAGAGATTCT
GATTCACGTCCTTATTAATAAGTACCTGACTTGAATGAATTACTAACTAAAATGAATGAT
TTCTAAGATGAATATAACAACGAAGTCGGAGTTCATTCAAAAAAAGCTATGAAACTAGTT
ATGTTCTTAGATGCCTGTGAACATATTTCCAGAATAGCCCGTATAATTAGATAGCCTCTT
GGTAATGCATTACTTCTTGGTGTTGGAGGTTCAGGACGTCAGTCTCTTTCTAAAATGGCA
ACCTTCATTTGCAACTATAAGCTTTTCCAAATTGAAGTAATAAAGAACTATTCTATGAAA
AATTGGAGAGAAGATATCAAGGAAGTATTGAAAATAGCAGGTATTGAAAATGTTCCTGTT
ACATTCCTTTTCGTAGATACTTAAATTATCAATGAATAAATGTGCGAAGACTTGAACTCT
ATTTTGAATTCTGGAGATGTCACAAATATATATAACGATAAAGATATGGAAGAAATAATG
GATGCATGCAAAGGTGAGTGCATTAAAAAGAATTTGTAACCCAACAAAATGAATGTTTTC
ACTTAATATCTAGCAAGAGTAAAAAATAATATCCATCTCGTAATAGCTATGTCACCATTA
GGTGAAGCTTTTACAACTCGTTTAAGAAGATTCCCCTCATTTGTAAGTTGTTCAACTATT
GACTGGTTTACTGAGTGGCCTGAGGAGGCCCTTATTGGTGTTGGTCTCGGAGCATTAAGA
GAAGTTGACCAAGAACTTGGTATTGAAGAATAAGTAGATTCACTTGTTGATATGTTTAAG
ATTATTCACAAGAGTGTTGAAAAGATAAGTATTAAATATTTAAATGAGTTAAGAAGACAC
AATTATGTGACACCTACTTCTTACTTGGAGCTTTTACAAATGTATAAGCAGATACTCAAA
GAAAAAAAGACAAAATAAAAGAATGCTATACTTAGACTTTAAAATGGTCTCGATAAATTA
CACGCAGCTAATTAAGCTACAGTTGAATTGTAAGTTAAATTGGGAGATATGAAACCGTTG
TTGGAAAAAGCGTCTATAGAAACAGAGTAAGTTATGGCAAAATTATCAGTTGACTAAAAG
GAAGCAGAAGAAGCTGAGAAACTTGTTGCTGCTGAAGAAAAAATAGCCAAAGCTCAACAG
TAAGATGCAACTGATTTAGCTGAAAAAGCTTCTGCTGCAGTCGCTGATGCAAATAAAATT
TTGGATGCCACACTCTAAGAAGTACAAAAATTGAAAAAAGATCACTTGGTTGAAGTTAAA
GCTCTACCTAATCCTCCTAAAGCTGTGAAGGTTGTCCTTGGTGGTATTGTGATATTGAAT
TTAGATTACATCAAAAAATGTGGTGGAAATATTATTACAAAGAAAGTAGAAGGTACCTTG
AATTAAAAAGAAGAAGATTACTTCGAAACTGCCAAAAAGTTTTTACTAAATGATCCAGCA
GGTTTATTGGATATGCTAAAAGGTTTTGATAAAAATAATATTAATCCAAACAATATATAG
AAATTAGAAAAAACTATCATGCCTGATCCTGATTTTACATTAAGCAGAGCACAAACTTGT
TCTTATGCTGTGCAGTTCTTATTCTAATGGGTAAAGGCTATGTATGATTACAATAAAGTA
TATTTAGAAACTAAACCTCTCCGTGACAAGCTTGATGAGACTTAGAAAATTTTAGATGAG
AAAACAAAAGAACTTAATGAAAAGAAAGCTAAGCTTGATAAGATTTAACAACAAATCAAA
GGTTTAGAAGATTTATATAACTCAAAAGTATAGTTAAAAGAACAGTTAACTAACTAAATG
AATGATTGTTAAATTAAGCTTGAAAGAGCTATTAAATTAACAAGTGGATTATCAGGAGAG
TAGAAAAGATGGAATTAAGAAATTCTTAATCTAAAAGATGGTGAGCTTTATCTTGCAGGT
AACTCTGTTATTGGTGCAGCTATGGTTGCTTATTCTGGGCCCTTCACAAGTCATTACAGA
ACTGAACTAGAATAGCAGTGGGTTAGACAGTTAACTCTTCATTCTATTATGCACACAGAA
AAAATCACAATGCGTCAGTTCTTAGGAGAAGCAGTAAAAATTCAATAGTGGAACATTGCA
GGTCTTCCAAAAGATGACTCTTCCACTGAAAATGGTATTATAATAGATCAGTCAAGAAGA
TGGACTCTTATGATAGATCCTTAAACTTAGGCAAATAAATTTATCAAAAATCTCGGTAAA
GACCATGCTGAAGGTTTAGATGTTCTTAAGATTTCCAATCCTTAATTAATGAGAACTTTA
GAATTAGCAATATAATTTGGTAAGAGAGTTCTCCTTGAAAACGTAGGTAGAGACTTGGAT
CCATCTTTAGAGCCTATCCTTCAACAATAAGTTGTAAAAGTTGGTTCATAGTTAAGCATA
ACAATCGGTGAAAAGAATCTAACTTACAACCCTAATTTCAAACTTTATATGACAACTACT
ATCCCAAATCCTCACTACCCTCCTGAAACATTTGTAAAAGTTACAATAATCAACTTTGGT
ATCACTCCAAGCGGATTAGAAGAATAAATGCTTGCTCAAATTGTAGCTCTAGAAAATCCT
CAACTTGAACAGAAAAAATTAGATATTGTAATTAAGAATGCAAACGATAAGAGATAGCTA
TTGAATATCGAAGATTCAATTCTTTAAGAATTATCCAGCATCAAAGGAGGTATTGAAGAA
GTACTGAAAGATGAAAATTTAATTGAAAAGTTGCAAAACTCCAAGAAGTTTGCTGAAGAA
ATTAATAAGAGAGTAGAGGAAAGTAAAATCACAGAAGCTTAAATCGACGAGGCAAGAGAA
GGATATAGACCAGTTGCTTTCAGCTCATCTTGGTTATTCTTCTGTATTTTAGATCTTTGC
TTAATTGATCCAATGTACTAATATTCTTTATAATGGTTTATGAACCTTTTTGTTATGGCA
GTTGAAAACTCTGAGGTATCTAATATACTTGAAGAACGTCTTGATAACTTAGATAAGTTC
TTTACATATTCCCTCTATGAAAACATTTGCAGATCTCTCTTTGAAAAGCACAAACTTTTA
TTCTCTTTAATGTTAACTGTCAAGATTTTGCAAGGAAAAGATTTAATGAATAAAGAAGAA
TGGAGATACTTACTTGCAGGTCCATCTGGTGATATCAAGGTACCCGAAAATCCAACTTAA
TGGATTAGTGAAAATTCTTGGCCAGATATTTATAGATAAATATTTGGTATGAACCATATT
GAAGCTTTCAAAGGCATCGAAGAACATTTTATGAAACGCCCTGATGATTTTAAGATATTA
TTTGATTCATTAACTCCTTAAACTGAACCTTTACCTGGAGACTGGGAGAAGAAACTTAAT
TAATTTGAGAAAATAATTGTTTTGAAATCATTTAGACCTGATAAAGTAGTTCCAGCCATC
TAGAATTGGATTGAAAAAATTATGGGTAAAAAATTCATTATGGCTCCTGGCTTTGATCTT
CCTAAATGCTTTAAGGATTCAACTTAAGCCACTCCATTAATTTTTGTTCTCTCAACTGGT
TCAGATCCTGTTGCTGATTTTATGAGATTTGCTGAGGAATAAAGTATGTTATAGATGTTT
GAATCTATTTCTCTAGGACAAGGATAGGGTGTCAAAGCAGAAAGAATGATTCGTGAAGCT
GTATAAAAAGGCACTTGGGTATTGCTTTAGAATTGTCATTTGGCTTCAAGTTGGATGAGT
GAATTAGAAAGATTATGTGAAGAATTAGATGGTGATAATGTCCAAAAAACATTCAGATTA
TGGTTAACCAGTATGCCATCTAAGGATTTCCCAATCAGTGTTTTATAAAATGGTGTTAAA
ATGACTTTAGAACCACCTTAAGGTCTTAGAAACAATCTGTTAAGAACATACAATAATTTA
GATTCTAAAGACTTTGAAGAATGTCAAAAACCACTTGAGTTTAGAAGATTGCTGTTTGGT
TTTTGTCTTTTCCATGCAATTATCTAAGATAGAAGAAAGTTTGGCCCTATTGGTTGGAAT
ATCGCATATGAGTTTACCAACGAAGATTTGACAGTATGTAGAAGGTAATTGAGAATGCTT
TTGGATGAATACGAATTAGTTCCATATAAAGTGCTCAACTTTTTAGGTGCCGAAATCAAT
TATGGTGGTAGAGTCACTGATGATAAAGATGTCCGTTTAATAAAAACGATTTTACAAAAT
TACGTCTGCAGCTAAGCATTAGATGAAGGTTATAAGTATTCTAAATCTGGCATTTATTAT
CAACCAAAAGCAGAAACCATAGACGATTATATTAGGTATATCACAGACCTACCTCTAAAT
CCTGAGCCTGAAGCGTTCGGATTGCATGATAATGCAGAAATCACAAATAGTTAAAATACA
ACAAGAGAATTACTTGAAACTATATTGAGTGTATAACCTCGTTCAAGTTCATCTGGAGCC
AAAAGTAGAGAATAATAGATAGAAGAAATTGCTGACTATGTTTAATCTCGTACTCCAGAA
GTGTTTAATTTCTAAGAGATTTATAAAAAATACCCTACAAAGTATGAAGAAAGTATGAAT
ACTGTACTTGTCCAAGAAATTATTAGATACAATCGTTTACTTGCGATCATGAAAGAAAGC
TTGATCAATGTCAAGAAAGCACTGAAAGGTTTAGTCGTAATGAGTGAAGAATTAGAGTTG
TTAGCAAATAGCTTATTCGACAATTAGGTCCCAATAATGTGGGAAGAAAAGGGCTTTTTA
AGTCTGAAACCACTTAGTTCATGGACTCAAGATTTAAATGATAGAGTTAATTTCTTAAAT
GAATGGATTGAAAACGGTACACCAAAAGTTTTCTGGATTTCAGGATTCTTCTTCCCTCAG
GCTTTCATAACAGGAACTTTGTAGAATTTTGCAAGATAAGAGATTATTGCTGTTGATAAA
TTATCATTCGAATTCAAAATTCTTGATAACTTACATTACACAGATATTCAACAAAAACCT
AAAAGTGGGTGCTATATCTATGGAATTTATCTTGAAGGAGCTAAATGGAATTATAAGACT
CATATGATTGATGATCCCTAACCAAAAGAATTATACTCTGATCTACCCTTAATTCATTTA
GTGCCTAAAGAAAATAGGTAGGTACCTGAAAATGGAATTTATAACAGTCCTCTTTACAAA
GTAGTTTCCAGAAGAGGTACTTTAAGTACTACAGGTCACTCAACTAATTTCGTTATGTTT
TTGGAGCTGCCAACTGATAAAAAATAGGAGGTTTGGATCACTGCAGGTGTTGCTGCCTTT
TTATCATTAAGATATTGA


>TTHERM_00821980(protein)
MSHFRTKSFKVAAHKTPSKYEIEDDPNKGQDQNKISKFSKENFMSPSPKKQKFSKSPERS
KPFKKYDLTKISPAPQKYVGPKKYKEYWMPQILEESGIDFDSCIVEHSYLPLKTFNNTDY
DFYSNEEIFQKLQERGEMRAQAIIQREEKRFEWEEVLVISYDQEKELFTVQTEDQLNFFL
NRIELIFVEEEDPFQYTQKLINAWNMRTFMDSILRYNFYLDNMPCHDMEYIDEQTERNIL
SLVFNKSILQQGDVTQLLEEVNQQYVRTQNKLVFNKYLSTNASDIFPTPLILPPVEEKIV
PEKGKLMLERLKGAKELVVYESGVTQRFKAKVFEEIRKDFANHSIYSIKEVIQCLAKLEN
ECQQIEGEEIFVYFFDKPQEINEFRISQDSHIDRKQDLICNKWPERLEKVFERTLQISKN
KSRIVDDDKLERVMALVRYKMQDTIYNICNYSFNKLYEFLFSFVPDQVKIVNSGDVQNIY
DSKTNTLQTSPRVITIESQNGMNSMASLVDYQEKPKKEFALYKIAVVSKDDTFQYSYDSN
FFLEMLQGYFKNTLNKFQKIADIEFKLNSNFQFVHKTKQYVKAPQLPNQEPRRANLNETG
DNRVDDENLWVWDLWVDLTQLIKKCVDPLDEYLTHFKKFENILRLNPDTYSKEFEGTEEN
PRDIQEIKEEIIQTLIKEEETKKLLPELIKVSIFEIDLKIISNTLAGKYKKLSNNLKDII
CQRAKKLTNNIITEFQEMHFTINKQPSNIEELTDIQNFISNVPTEMEKKKVEIERILEIY
DILDEFMYRLEKEAIKSKQEMQFLPKKTLQMLEKRSNLLDDIKSNFLRDQQKDQDMFRKA
IDAAQKKIMTFHSYTNINQHEEVAQKATELYNELAKMIEQSRKFNTREQLFGQQMTDYSK
IIQMQKDFTPYYNLWTISSKWFENIQIWLYSSWDKLDAPYCEKFVEDGFRTLGQTIRFFK
EKNLSAVQKIAEKVKKEFDEFRPKVPLMVALKKQGMKDRHWDAITNKVGFEVRPDNSFNF
QKVLDMGLMTHIEQCVEIGEQAAKEYTIEEMLKNMKSKWATVEFDLMTYKHLFIIRGSDE
IQALLDEHLVNTQAMQFSPYKKPFEEEIIEWNNQLKLMSDILEEWIKVQLQWMYLQPIFD
SKDIAKQLPHETRKFKQVDDIWKKAMIQARDKKLVIRVCSEPNLLENLRNANEKFDQIQK
ELNNYLEKKREKFARFYFLSNDDLLEILSQTKEPTAVQPHLKKVFENIHQIEFDDQKIIH
AMFSAEKEKINFVKTVNPNHKNVEEWMGEVENMMKASVRFELFNSYQKYPDTPRTRWVVS
HPGQCVLNGSQMHWTLEVEQALKQNSVKKYWDVLSSQLNDLVDLVRTKLTKQQMVTINAL
IVIDVHAKDVTEILWRNEITDISAFEWISQLRYYWEKENCMVKCIQTSFPYGYEYLGNTL
RLVITPLTDKCYMTLMGALKLNLGGAPAGPAGTGKTESTKDLAKALAKQCVVFNCSDSMD
YIMLGKFFKGLASAGAWCCFDEFNRINIEVLSVIAQQLLILFGEKAKGSSQCEFEGSIIK
IQPTFCVFITMNPGYAGRTELPDNLKALFRAVAMMVPDYAMIGEIMLYSFGFKQGRDLAK
KMVATFKLSSEQLSSQDHYDYGMRAVRSVINAAGLLKAAEPDMNEEQLLLRALRDVNVPK
FLKDDLPLFENIILDLFPGVEKPVINYGELLDAMSKQSKVLGLQPVKPFLDKVIQLYDTI
QVRHGLMLVGPTGGGKTSNYRVLQKAMTSLEKKGQAKVNTHIMNPKSITMGQLYGQFNDA
THEWSDGVLAYIIRETVKDQSSDRHWIVFDGPVDAIWIESMNTVLDDNKKLCLNSGQILT
LTPYMTMMFEVEDLAVASPATVSRCGMVYMEPSTMGLTPLVNSWMDFRITESFRANKLFV
PKLQSLFEEYLEFCIDFIRKNCIEIVDSMNNNLAQSLMRNLNCFLVNYVDTDFKKIPAEE
IEKLLDHLEQIFIFSLIWSIGCTITYEGRVKFDNYLRGLMKQNQCSFSFPQEGLVYDYQY
IEKIGEFQHWKENFKDFAINDKLGYHEIMIPTADSTRNMYFTKIHLTIGQHVMSPGPTGT
GKSLNLFQLLGSQMDEQFQYIALAFSAQTSANQTQDTIDSKMDKRRKGYYGPPIGKKCII
FIDDLNMPKKETYGAQPPIELIRQFIDHRGWYNRKDLQFMKLEDIILLTAMGPPGGGRTF
ITNRFVRHFNILAYTELDEGTIKQIFGTMSSFFLNKFEEPIKKCIQLVVDTSYNVYQRVR
EELLPTPSKSHYTFNLRDINKVFQGVCNASSKHVTECAQLVRLWFHENMRVYHDRLTTEE
DRQYLKNLLIGYFEQFGLNQKDVLDMDRIIFGDFVQGRDSDSRPYQQVPDLNELLTKMND
FQDEYNNEVGVHSKKAMKLVMFLDACEHISRIARIIRQPLGNALLLGVGGSGRQSLSKMA
TFICNYKLFQIEVIKNYSMKNWREDIKEVLKIAGIENVPVTFLFVDTQIINEQMCEDLNS
ILNSGDVTNIYNDKDMEEIMDACKGECIKKNLQPNKMNVFTQYLARVKNNIHLVIAMSPL
GEAFTTRLRRFPSFVSCSTIDWFTEWPEEALIGVGLGALREVDQELGIEEQVDSLVDMFK
IIHKSVEKISIKYLNELRRHNYVTPTSYLELLQMYKQILKEKKTKQKNAILRLQNGLDKL
HAANQATVELQVKLGDMKPLLEKASIETEQVMAKLSVDQKEAEEAEKLVAAEEKIAKAQQ
QDATDLAEKASAAVADANKILDATLQEVQKLKKDHLVEVKALPNPPKAVKVVLGGIVILN
LDYIKKCGGNIITKKVEGTLNQKEEDYFETAKKFLLNDPAGLLDMLKGFDKNNINPNNIQ
KLEKTIMPDPDFTLSRAQTCSYAVQFLFQWVKAMYDYNKVYLETKPLRDKLDETQKILDE
KTKELNEKKAKLDKIQQQIKGLEDLYNSKVQLKEQLTNQMNDCQIKLERAIKLTSGLSGE
QKRWNQEILNLKDGELYLAGNSVIGAAMVAYSGPFTSHYRTELEQQWVRQLTLHSIMHTE
KITMRQFLGEAVKIQQWNIAGLPKDDSSTENGIIIDQSRRWTLMIDPQTQANKFIKNLGK
DHAEGLDVLKISNPQLMRTLELAIQFGKRVLLENVGRDLDPSLEPILQQQVVKVGSQLSI
TIGEKNLTYNPNFKLYMTTTIPNPHYPPETFVKVTIINFGITPSGLEEQMLAQIVALENP
QLEQKKLDIVIKNANDKRQLLNIEDSILQELSSIKGGIEEVLKDENLIEKLQNSKKFAEE
INKRVEESKITEAQIDEAREGYRPVAFSSSWLFFCILDLCLIDPMYQYSLQWFMNLFVMA
VENSEVSNILEERLDNLDKFFTYSLYENICRSLFEKHKLLFSLMLTVKILQGKDLMNKEE
WRYLLAGPSGDIKVPENPTQWISENSWPDIYRQIFGMNHIEAFKGIEEHFMKRPDDFKIL
FDSLTPQTEPLPGDWEKKLNQFEKIIVLKSFRPDKVVPAIQNWIEKIMGKKFIMAPGFDL
PKCFKDSTQATPLIFVLSTGSDPVADFMRFAEEQSMLQMFESISLGQGQGVKAERMIREA
VQKGTWVLLQNCHLASSWMSELERLCEELDGDNVQKTFRLWLTSMPSKDFPISVLQNGVK
MTLEPPQGLRNNLLRTYNNLDSKDFEECQKPLEFRRLLFGFCLFHAIIQDRRKFGPIGWN
IAYEFTNEDLTVCRRQLRMLLDEYELVPYKVLNFLGAEINYGGRVTDDKDVRLIKTILQN
YVCSQALDEGYKYSKSGIYYQPKAETIDDYIRYITDLPLNPEPEAFGLHDNAEITNSQNT
TRELLETILSVQPRSSSSGAKSREQQIEEIADYVQSRTPEVFNFQEIYKKYPTKYEESMN
TVLVQEIIRYNRLLAIMKESLINVKKALKGLVVMSEELELLANSLFDNQVPIMWEEKGFL
SLKPLSSWTQDLNDRVNFLNEWIENGTPKVFWISGFFFPQAFITGTLQNFARQEIIAVDK
LSFEFKILDNLHYTDIQQKPKSGCYIYGIYLEGAKWNYKTHMIDDPQPKELYSDLPLIHL
VPKENRQVPENGIYNSPLYKVVSRRGTLSTTGHSTNFVMFLELPTDKKQEVWITAGVAAF
LSLRY


>TTHERM_00821980(gene)
ATGAGTCACTTTAGGACAAAATCTTTTAAGGTTGCAGCTCATAAAACTCCCTCAAAGGTT
TCTTTTTATTTCAGCAATAAATTAATAAATCATAACAATATACTATTTGAATTTGATAAG
TGGTTTATTTTATTTTTCTTTTAAAATTAAAGTATGAAATTGAAGATGATCCTAATAAGG
GACAGGATCAAAATAAGATTAGCAAGTTTAGTAAAGAAAATTTTATGAGTCCATCTCCTA
AAAAATAAAAATTCTCAAAATCTCCTGAGAGATCAAAGGTAAATTAAGATTGTTTCAGAA
TTATGAAATGATAAAAATAGCATTTACTTAGCTGATAACTTAAAATAATCTGCAATCTAA
TTTTTTTGTTTGCTCATAATAAAAAAAAGCCTTTCAAGAAGTATGATTTGACCAAAATAT
CACCAGCACCTTAGAAATATGTAGGACCTAAAAAATATAAAGAGTATTGGATGCCATAAA
TTTTAGAGGAAAGTGTAATTTTAATCTTTTCAAATTCAAAACAAATTTTGAGTTTTAGCA
AAATAAAAGAAAAAAGTTATCTAAGATTATGGTTTTTAATTAAAAAGGGTATTGATTTTG
ATTCATGTATTGTAGAACATAGTTACTTACCACTGAAAACATTCAACAATACAGATTATG
ACTTTTATTCTAATGAAGAAATCTTCTAAAAACTTCAAGAAAGAGGTGAAATGAGAGCAC
AAGTAAATCAGTTTAGAGTTAATTCTGTGAAATTATTTGATTTTTTTATTTAATTTAGGC
TATAATTTAAAGAGAAGAGAAAAGGTTTGAGTGGGAAGAAGTTTTAGTTATAAGTTATGA
TCAAGAAAAAGAACTCTTCACAGTTTAGACAGAAGATTAGCTGAATTTCTTCTTAAATCG
TATTGAGCTTATTTTTGTTGAGGAAGAGGATCCTTTTTAATACACTCAAAAGCTTATAAA
TGCCTGGAATATGAGAACATTTATGGATTCTATTCTTAGATATAATTTTTATTTAGATAA
CATGCCTTGCCATGATATGGAATATATAGATGAACAAACAGAAAGAAATATTTTAAGTTT
AGTTTTTAACAAATCCATTCTCTAATAGGGTGATGTAACCTAGCTTTTGGAAGAAGTAAA
TTAATAATATGTAAGAACATAAAATAAGCTCGTATTCAATAAATACTTATCTACTAATGC
ATCTGACATATTCCCTACTCCTCTGATATTACCTCCTGTAGAAGAAAAGATAGTAATTAA
AATAACTTTATAAATAATAATAAATGAATAATATTAATTTTATTGGTAATTTCAATATTT
TTTAAATCAGGTCCCTGAAAAAGGTAAACTTATGTTAGAAAGACTAAAAGGAGCTAAAGA
ATTAGTAGTTTATGAAAGCGGCGTAACATAAAGATTCAAAGCAAAAGTTTTTGAAGAAAT
TAGAAAAGATTTTGCAAATCATTCAATTTACAGCATAAAAGAAGTTATTTAATGTCTTGC
AAAGCTTGAGAATGAATGCCAATAAATTGAAGGAGAGGAAATATTTGTATATTTCTTTGA
TAAGCCATAGGAAATTAATGAATTTAGAATTTCATAAGATTCTCATATTGATAGAAAGCA
AGATTTAATTTGCAATAAGTGGCCTGAAAGGTTAGAAAAAGTATTTGAGAGAACCCTCTA
AATCTCTAAGAATAAAAGCAGAATAGTTGATGACGATAAGTTGGAAAGAGTTATGGCTCT
AGTTAGATATAAAATGCAAGACACCATTTATAATATCTGCAACTATTCATTCAACAAACT
CTATGAATTCCTTTTTTCATTTGTTCCAGATTAAGGTAATTGACTAATTAAAATCTTTCG
ATTATCTTTTTATATTTTTAAATAAATGAAAATTCATATTTTTACAATATTCAGCTAGCT
TGTGTTTAATTTTCTACAATCTTTTTATAAATTTATTTAGTAAAAATTGTTAATTCTGGA
GATGTATAAAATATTTACGATTCTAAGACCAATACTCTTTAAACATCACCTAGAGTAATT
ACAATAGAGAGTTAAAATGGAATGAATTCAATGGCTTCTTTAGTTGACTACCAAGAAAAA
CCTAAAAAAGAATTTGCTCTTTATAAAATTGCAGTAGTAAGCAAGGATGATACTTTTTAG
TATTCTTATGATTCTAATTTCTTCTTAGAAATGCTTTAAGGTTATTTCAAGAATACCCTA
AACAAATTTCAAAAAATAGCAGGTAATCATTATTATCATGATAAAAAATAATGACTAATA
TTTTTATATCATTACAATAAATATTAGATATTGAGTTTAAACTGAATTCTAACTTTTAAT
TTGTGCATAAAACGAAGCAGTATGTAAAAGCCCCTTAACTTCCTAATTAAGAACCTAGGA
GAGCTAACTTAAATGAGACAGGAGATAATAGAGTTGATGATGAAAATTTATGGGTTTGGG
ACTTATGGGTAGACTTAACATAGTTAATCAAGAAATGTGTTGATCCACTAGATGAGTACT
TAACTCATTTCAAGAAATTTGAAAATATCCTAAGATTAAACCCTGATACATACTCTAAAG
AGTTTGAGGGAACAGAAGAAAATCCTAGAGATATTTAAGAAATAAAAGAAGAAATTATTT
AAACATTAATCAAAGAAGAGGAAACAAAAAAACTTTTACCTGAACTCATAAAGGTGTCTA
TTTTTGAAATTGACTTAAAAATTATCAGCAATACTTTGGCTGGAAAATACAAGAAATTAT
CAAATAATTTGAAGGACATCATTTGTTAGAGAGCAAAGAAATTAACAAATAATATAATCA
CTGAATTCTAAGAAATGCACTTCACAATAAATAAGCAACCCTCAAATATTGAAGAGTTAA
CTGATATTTAAAATTTTATAAGCAATGTTCCAAGTAAATTTAGTCTGTCTTTTTGTAATT
TTAAAATTTATTTAAATAAAAAAATTAAGCTGAAATGGAGAAAAAAAAAGTAGAAATTGA
AAGAATATTAGAAATTTATGATATCTTAGATGAATTTATGTACAGATTAGAGAAAGAGGC
AATCAAGAGCAAACAAGAAATGCAATTCCTTCCTAAGAAAACTTTATAAATGCTAGAAAA
GAGAAGTAATCTTCTTGATGATATCAAATCTAATTTCTTGAGAGATTAGTAGAAAGATTA
AGATATGTTTAGGAAAGCTATTGATGCTGCCCAAAAAAAGATTATGACTTTCCATAGCTA
CACCAATATCAATCAACATGAAGAAGTAGCTCAAAAAGCCACTGAATTATATAATGAATT
AGCCAAAATGATTGAACAATCTCGTAAATTCAACACAAGAGAACAACTCTTTGGTTAGCA
AATGACAGATTATTCCAAAATTATTTAAATGCAAAAGGTATGTTTGTTTTATCATTTTTA
AAATCAATTTTGAATATTTCAAATTAAAATTTATTAATTTTATAGGACTTCACTCCTTAT
TATAATTTGTGGACTATATCTAGCAAATGGTTTGAAAATATTTAAATATGGCTTTATAGC
AGTTGGGATAAATTAGATGCTCCTTATTGTGAAAAATTTGTTGAAGATGGATTTAGAACT
TTGGGCTAGACAATTAGATTCTTTAAAGAAAAGAATCTTTCTGCTGTACAAAAAATAGCT
GAGAAAGTTAAAAAGGAGTTTGATGAATTCCGTCCAAAAGTCCCTTTGATGGTTGCACTT
AAGAAATAAGGAATGAAAGATGTAAATTTAATTTTTAATTAACTAATTAAATATTTGGAT
GTATTTAACTAAAATAGAGACATTGGGATGCAATTACAAATAAAGTTGGATTCGAGGTTA
GACCTGATAATAGTTTCAACTTTTAAAAAGTTTTAGATATGGGCTTGATGACTCATATTG
AACAGTGTGTAGAAATAGGTGAATAAGCAGCAAAAGAATACACTATCGAAGAAATGTTAA
AAAATATGAAATCAAAATGGGCTACTGTGGAATTTGATCTAATGACCTACAAACATTTGT
TTATCATCAGGGTAAATTTTTGAAATTTAATGTAAATAGATTTTAATCAAAAAATTTATT
GAAGGGATCTGATGAGATTTAAGCTCTCTTGGATGAACATTTAGTAAATACTTAAGCAAT
GCAGTTTTCTCCTTATAAAAAACCATTCGAAGAAGAAATCATAGAATGGAATAATCAACT
TAAATTGATGAGTGATATTTTGGAAGAATGGATTAAAGTGCAGCTGTAGTGGATGTATCT
TTAACCTATTTTTGACAGCAAAGATATAGCAAAATAACTTCCTCATGAAACAAGAAAGTT
CAAATAAGTTGACGATATTTGGAAAAAAGCTATGATTTAAGCTAGAGATAAAAAATTAGT
TATAAGAGTATGTAGTGAGCCTAACTTACTAGAAAATCTTCGAAATGCTAATGAAAAATT
TGATTAAATACAAAAAGAGCTAAATAATTACCTTGAAAAGAAGAGAGAAAAGTTTGCTCG
TTTTTATTTCTTATCCAATGATGATCTACTCGAAATTCTTTCTTAAACCAAAGAGCCTAC
TGCTGTCTAGCCTCATTTGAAGAAGGTTTTTGAAAATATTCATTAAATTGAATTCGATGA
TTAAAAAATCATTCATGCTATGTTTTCAGCTGAAAAAGAAAAAATTAACTTTGTCAAAAC
TGTAAACCCTAATCATAAAAATGTAGAAGAGTGGATGGGTGAAGTAGAAAATATGATGAA
AGCCTCTGTAAGATTTGAGCTCTTTAACTCATATCAAAAGTATCCAGACACACCTAGAAC
TCGTTGGGTTGTTTCTCATCCAGGTTAGTGTGTTCTCAATGGTTCTTAGATGCACTGGAC
TCTAGAAGTAGAATAAGCTTTAAAATAAAATTCTGTTAAGAAATATTGGGATGTCCTTAG
CTCTCAAGTAATTATTAAATAAAATATTTAAAATAAATCTTCAAGCTTTTAAGTTTTCAA
TAAAATAATTGACAAATACAACTATAAAACCTTAAGAATTAGAAAATAAAATTTTCTTAG
AATAGGATTAATTAAATAAAATGAAATATTTTGAGAATTGTTTATTATTATTGAATGAAT
ATACTCAATTCAATAAAATATAATTTAATGATAATTTATTTAATTTTATAATTTTTCATG
CCATTTTTTAAAAAATAAAATAATAGCTTAATGATTTAGTTGATTTAGTTAGAACAAAGC
TTACAAAGTAACAGATGGTTACAATTAATGCACTTATTGTCATTGATGTGCATGCAAAGG
ATGTGACTGAGATTTTGTGGAGAAATGAAATCACTGACATTAGTGCTTTTGAGTGGATAT
CGTAGCTAAGATATTATTGGGAAAAAGAAAATTGTATGGTCAAATGTATTTAAACCTCAT
TCCCTTATGGTTATGAGTATTTGGGTAATACTCTTAGATTAGTTATTACTCCTCTTACTG
ATAAGTGTTACATGACTTTGATGGGTGCTCTCAAATTAAATTTAGGAGGTGCCCCTGCAG
GTAAAAAATAAAATTTTCATTTATTTTTCAAATAATTAATTTTATATTATTCAGTTATTT
ACTAATTAATTAAACAAATTTTATTTTAATTGAATATGAATTATTTTTTTATTGATTGAA
TCAGTCAGTCACAATTGTTAAATTTAATAGTTAGTTGAGTTATTGAATAATATTTCAAAA
GTATTCAATATAATTATATAATTAAAATGAATAGGACCTGCCGGTACAGGTAAAACAGAA
TCGACAAAAGATCTTGCTAAAGCACTTGCAAAGTAGTGTGTAGTATTTAATTGTTCTGAT
AGTATGGATTATATTATGCTTGGTAAGTTCTTTAAGGGTTTAGCTAGTGCTGGTGCTTGG
TGCTGTTTTGATGAGTTTAATCGTATCAATATTGAAGTATTGTCAGTTATTGCATAGTAA
TTGCTAATTCTATTTGGTGAAAAAGCAAAAGGTTCTTCCTAGTGTGAGTTTGAAGGAAGT
ATAATAAAAATCTAACCTACATTTTGTGTCTTCATCACTATGAATCCAGGTTATGCTGGT
CGTACTGAATTGCCAGACAACTTAAAGGCCCTCTTCAGAGCAGTAGCTATGATGGTTCCT
GATTATGCTATGATTGGTGAAATCATGCTTTACAGTTTTGGTTTCAAATAGGGTAGAGAT
TTAGCTAAGAAAATGGTTGCTACTTTTAAGTTATCTTCAGAATAATTATCATCTTAAGAC
CATTATGATTATGGTATGAGAGCAGTTAGAAGTGTCATTAATGCAGCTGGTCTTTTGAAA
GCAGCAGAGCCTGATATGAATGAAGAACAACTCTTACTTAGAGCCTTAAGGGATGTTAAT
GTGCCCAAATTCCTTAAAGATGATCTTCCTCTATTCGAAAATATTATTTTAGATCTTTTC
CCAGGAGTTGAGAAGCCTGTAATTAACTATGGAGAATTGCTTGATGCAATGTCAAAGTAA
AGTAAAGTATTAGGATTATAGCCCGTTAAGCCTTTCCTTGATAAAGTTATTTAGCTTTAT
GATACAATTTAAGTTAGACATGGTCTCATGCTTGTTGGACCAACAGGAGGTGGTAAAACT
TCAAATTACAGAGTTCTCTAAAAGGTATTTTTTGTCAAATCAATATTCATTCATTCATTA
ATTATTTTATTTTATTTTATTTTAGGCTATGACTTCATTAGAGAAAAAGGGATAAGCAAA
AGTTAATACTCATATTATGAATCCTAAATCAATCACTATGGGATAGTTATATGGATAGTT
TAATGATGCCACTCATGAGTGGTCTGACGGTGTTCTTGCTTATATTATTAGAGAAACAGT
CAAGGATTAATCAAGTGATAGACATTGGATTGTTTTTGATGGTCCAGTTGATGCTATTTG
GATTGAATCTATGAATACAGTGCTTGATGATAATAAGAAATTATGTTTAAATAGGTAAAT
AAATTTATCACTAAAATTTTTTAAGAATTAAATTAATTTAATTATTTTAAATTTATTAGT
GGCTAAATTCTCACACTTACTCCTTACATGACTATGATGTTTGAAGTAGAAGACTTAGCG
GTTGCTTCTCCTGCTACAGTTAGTCGTTGTGGAATGGTTTATATGGAGCCAAGTACAATG
GGTTTAACTCCTTTAGTTAATAGCTGGATGGACTTTAGAATCACTGAGTCTTTCAGAGCA
AATAAGCTTTTTGTTCCTAAATTGCAGTCATTATTTGAAGAATATTTAGAATTTTGCATC
GATTTTATTAGAAAAAATTGCATAGAAATAGTTGATTCTATGAACAACAACCTTGCTTAG
TCACTAATGCGTAATCTAAACTGTTTCTTAGTTAATTATGTTGATACAGATTTTAAAAAA
ATACCTGCTGAAGAAATTGAAAAATTACTTGACCATCTTGAATAAATATTTATTTTTAGC
TTGATTTGGTCAATAGGATGCACAATCACTTATGAAGGCAGGGTTAAATTTGACAATTAT
CTTAGAGGTCTTATGAAATAAAATCAATGCTCTTTTAGTGTAATACTTTTAATTTAAGAA
TTATATTTTTTTAAAATTAATAACTTGTAATAAAATAGTTCCCTTAAGAAGGCTTGGTTT
ATGATTATTAATATATTGAGAAAATTGGTGAATTTTAACATTGGAAGGAGAATTTTAAGG
ATTTTGCCATTAATGATAAGCTAGGTTACCATGAAATTATGATTCCAACAGCAGATTCCA
CCAGAAATATGTATTTTACTAAAATTCATTTAACTATTGGATAGCACGTTATGTCACCTG
GCCCAACTGGTACAGGTAAGAGTTTAAATCTCTTTTAACTTCTTGGTTCTTAAATGGATG
AATAATTCTAATATATTGCTCTTGCTTTTAGTGCTTAGACTAGTGCTAATTAAACTTAGG
ATACAATTGATAGCAAAATGGATAAGAGAAGAAAAGGCTACTATGGCCCACCTATCGGAA
AAAAATGCATTATCTTTATTGATGATTTGAACATGCCTAAAAAGGAAACTTATGGAGCTT
AGCCTCCTATTGAACTTATTCGTTAATTCATCGATCATAGAGGTTGGTATAATAGAAAGG
ATCTCCAGTTTATGAAATTAGAAGATATTATTCTTCTTACTGCTATGGGCCCTCCTGGTG
GTGGTCGTACATTTATAACAAACAGATTTGTCAGACATTTTAACATTCTAGCTTACACTG
AATTAGATGAAGGAACAATTAAACAAATTTTTGGAACTATGTCCTCCTTTTTCTTAAGTA
AATATTTTGAGTTTATTTGATATTTTAATTATTATTAAAAAATAAAAATAAAGATAAATT
CGAAGAACCTATTAAAAAGTGCATTTAATTGGTTGTTGACACTTCTTATAATGTTTATTA
GAGAGTAAGAGAAGAATTGCTCCCTACTCCTTCAAAATCTCACTACACATTTAATTTAAG
AGACATTAATAAAGTATTAATAAAAAATTTAATTAATTAAAATTATAATTAATTTCTAAA
AATCGAATAGGTCTTTTAAGGTGTTTGCAATGCATCCTCAAAGCATGTTACTGAATGTGC
ATAATTAGTAAGACTTTGGTTCCATGAAAATATGAGAGTTTATCATGACCGTTTAACAAC
AGAAGAAGACAGATAATACTTAAAGAATCTCTTGATTGGATATTTTGAGCAATTCGGCTT
GAACTAAAAAGATGTTTTAGACATGGATAGAATCATTTTTGGTGATTTTGTTTAAGGCAG
AGATTCTGATTCACGTCCTTATTAATAAGTAAAAAATAATTTGCAAATTAGAAGTAGATT
TTAATTAATTTTTAATAAAGGTACCTGACTTGAATGAATTACTAACTAAAATGAATGATT
TCTAAGATGAATATAACAACGAAGTCGGAGTTCATTCAAAAAAAGCTATGAAACTAGTTA
TGTTCTTAGATGCCTGTGAACATATTTCCAGAATAGCCCGTATAATTAGATAGCCTCTTG
GTAATGCATTACTTCTTGGTGTTGGAGGTTCAGGACGTCAGTCTCTTTCTAAAATGGCAA
CCTTCATTTGCAACTATAAGCTTTTCCAAATTGAAGTAATAAAGAACTATTCTATGAAAA
ATTGGAGAGAAGATATCAAGGAAGTATTGAAAATAGCAGGTATTGAAAATGTTCCTGTTA
CATTCCTTTTCGTAGATACTTAAATTATCAATGAATAAATGTGCGAAGACTTGAACTCTA
TTTTGAATTCTGGAGATGTCACAAATATATATAACGATAAAGATATGGAAGAAATAAGTA
ATATTTTCTTTAATAAAAAATAAATAAAGATTAATAAAATAATTTTAAAAAAAAGTGGAT
GCATGCAAAGGTGAGTGCATTAAAAAGAATTTGTAACCCAACAAAATGAATGTTTTCACT
TAATATCTAGCAAGAGTAAAAAATAATATCCATCTCGTAATAGCTATGTCACCATTAGGT
GAAGCTTTTACAACTCGTTTAAGAAGGTAAATTTTCTAATAAATAAAATTAAAAAAATAA
AAATATTTTTTTTAGATTCCCCTCATTTGTAAGTTGTTCAACTATTGACTGGTTTACTGA
GTGGCCTGAGGAGGCCCTTATTGGTGTTGGTCTCGGAGCATTAAGAGAAGTTGACCAAGA
ACTTGGTATTGAAGAATAAGTAGATTCACTTGTTGATATGTTTAAGATTATTCACAAGAG
TGTTGAAAAGATAAGTATTAAATATTTAAATGAGTTAAGAAGACACAATTATGTGACACC
TACTTCTTACTTGGAGCTTTTACAAATGTATAAGCAGATACTCAAAGAAAAAAAGACAAA
ATAAAAGAATGCTATACTTAGACTTTAAAATGGTCTCGATAAATTACACGCAGCTAATTA
AGCTACAGTTGAATTGTAAGTTAAATTGGGAGATATGAAACCGTTGTTGGAAAAAGCGTC
TATAGAAACAGAGTAAGTTATGGCAAAATTATCAGTTGACTAAAAGGTAACAAATTTCTT
TTGAATTTTGAAGAGTTTTTATCAATTATTAGATACAAAATTAATCAAATAAATATAAAA
TTTATTAATTAATTAAAGGAAGCAGAAGAAGCTGAGAAACTTGTTGCTGCTGAAGAAAAA
ATAGCCAAAGCTCAACAGTAAGATGCAACTGATTTAGCTGAAAAAGTAAAAATTTATATT
TTAAGTTTTTTATTTAAATTATATTATTTTAAAGGCTTCTGCTGCAGTCGCTGATGCAAA
TAAAATTTTGGATGCCACACTCTAAGAAGTACAAAAATTGAAAAAAGATCACTTGGTTGA
AGTTAAAGCTCTACCTAATCCTCCTAAAGCTGTGAAGGTTGTCCTTGGTGGTATTGTGAT
ATTGAATTTAGATTACATCAAAAAATGTGGTGGAAATATTATTACAAAGAAAGTAGAAGG
TACCTTGAATTAAAAAGAAGAAGATTACTTCGAAACTGCCAAAAAGTAATTCATTTTAAA
AGATAAATTCATTTTTAAAAATATAATTATTAATAAGGTTTTTACTAAATGATCCAGCAG
GTTTATTGGATATGCTAAAAGGTTTTGATAAAAATAATATTAATCCAAACAATATATAGA
AATTAGAAAAAACTATCATGCCTGATCCTGATTTTACATTAAGCAGAGCACAAACTTGTT
CTTATGCTGTGCAGTTCTTATTCTAATGGGTAAAGGCTATGTATGATTACAATAAAGTAT
ATTTAGAAACTAAACCTCTCCGTGACAAGCTTGATGAGACTTAGAAAATTTTAGATGAGA
AAACAAAAGAACTTAATGAAAAGAAAGCTAAGCTTGATAAGATTTAACAACAAATCAAAG
GTTTAGAAGATTTATATAACTCAAAAGTATAGTTAAAAGAACAGTTAACTAACTAAATGA
ATGATTGTTAAATTAAGCTTGAAAGAGCTATTAAATTAACAAGTGGATTATCAGGAGAGT
AGAAAAGATGGAATTAAGAAATTCTTAATCTAAAAGATGGTGAGCTTTATCTTGCAGGTA
ACTCTGTTATTGGTGCAGCTATGGTTGCTTATTCTGGGCCCTTCACAAGTCATTACAGAA
CTGAACTAGAATAGCAGTGGGTTAGACAGTTAACTCTTCATTCTATTATGCACACAGAAA
AAATCACAATGCGTCAGTTCTTAGGAGAAGCAGTAAAAATTCAATAGTGGAACATTGCAG
GTCTTCCAAAAGATGACTCTTCCACTGAAAATGGTATTATAATAGATCAGGTAAATAAAT
TTTGATTCATTTAACACAATTTTTTAACAAGTTTAATAAATCAACTTTTTTTGTCTAAAT
TATTTTTGCAAAAAAATTAGTCAAGAAGATGGACTCTTATGATAGATCCTTAAACTTAGG
CAAATAAATTTATCAAAAATCTCGGTAAAGACCATGCTGAAGGTTTAGATGTTCTTAAGA
TTTCCAATCCTTAATTAATGAGAACTTTAGAATTAGCAATATAATTTGGTAAGAGAGTTC
TCCTTGAAAACGTAGGTAGAGACTTGGATCCATCTTTAGAGCCTATCCTTCAACAATAAG
TTGTAAAAGTTGGTTCATAGTTAAGCATAACAATCGGTGAAAAGAATCTAACTTACAACC
CTAATTTCAAACTTTATATGACAACTACTATCCCAAATCCTCACTACCCTCCTGAAACAT
TTGTAAAAGTTACAATAATCAACTTTGGTATCACTCCAAGCGGATTAGAAGAATAAATGC
TTGCTCAAATTGTAGCTCTAGAAAATCCTCAACTTGAACAGAAAAAATTAGATATTGTAA
TTAAGAATGCAAACGATAAGAGATAGCTATTGAATATCGAAGATTCAATTCTTTAAGAAT
TATCCAGCATCAAAGGAGGTATTGAAGAAGTACTGAAAGATGAAAATTTAATTGAAAAGT
TGCAAAACTCCAAGAAGTTTGCTGAAGGTAAATAAAAAATGAAACTAATTAATTAATATA
TTTAATAAATAATAATTTTTTATCAAAAATATAGAAATTAATAAGAGAGTAGAGGAAAGT
AAAATCACAGAAGCTTAAATCGACGAGGCAAGAGAAGGATATAGACCAGTTGCTTTCAGC
TCATCTTGGTTATTCTTCTGTATTTTAGATCTTTGCTTAATTGATCCAATGTACTAATAT
TCTTTATAATGGTTTATGAACCTTTTTGTTATGGCAGTTGAAAACTCTGAGGTATCTAAT
ATACTTGAAGAACGTCTTGATAACTTAGATAAGTTCTTTACATATTCCCTCTATGAAAAC
ATTTGCAGATCTCTCTTTGAAAAGCACAAACTTTTATTCTCTTTAATGTTAACTGTCAAG
ATTTTGCAAGGAAAAGATTTAATGAATAAAGAAGAATGGAGATACTTACTTGCAGGTCCA
TCTGGTGATATCAAGGTATTTATTCAATAATATCCAAATTTTGTTAACTTATTTACTAAC
TTTTATATTTTTTAATATTGAAAATTTCACATTTACAAATTTAATTTTTTTTAAGATTAA
ATTTAAAAATTAAAATAATTTTTTATTTTAGATTTATTTATTTATTTTGTAAGTTGAATT
TAATTAAATTTATTAAATATTTAATATGATTTAAAAAATTTTTCACAAATTATTTAATAG
AAGTATTTTGTTTATAAAAATAAAATAGGTACCCGAAAATCCAACTTAATGGATTAGTGA
AAATTCTTGGCCAGATATTTATAGATAAATATTTGGTATGAACCATATTGAAGCTTTCAA
AGGCATCGAAGAACATTTTATGAAACGCCCTGATGATTTTAAGATATTATTTGATTCATT
AACTCCTTAAACTGAACCTTTACCTGGAGACTGGGAGAAGAAACTTAATTAATTTGAGAA
AATAATTGTTTTGAAATCATTTAGACCTGATAAAGTAGTTCCAGCCATCTAGAATTGGAT
TGAAAAAATTATGGGTAAATTTAAAATAATTATTTTTTTTCAACAAAATTAAAACACATT
TAAATGTTATTAGGTAAAAAATTCATTATGGCTCCTGGCTTTGATCTTCCTAAATGCTTT
AAGGATTCAACTTAAGCCACTCCATTAATTTTTGTTCTCTCAACTGGTTCAGATCCTGTT
GCTGATTTTATGAGATTTGCTGAGGAATAAAGTATGTTATAGATGTTTGAATCTATTTCT
CTAGGACAAGGATAGGGTGTCAAAGCAGAAAGAATGATTCGTGAAGCTGTATAAAAAGGT
AAAATGGCTTTATTTTAATTCATATTTATTTAAATAAAAATACTTAAAATTCAAATAGGC
ACTTGGGTATTGCTTTAGAATTGTCATTTGGCTTCAAGTTGGATGAGTGAATTAGAAAGA
TTATGTGAAGAATTAGATGGTGATAATGTCCAAAAAACATTCAGATTATGGTTAACCAGT
ATGCCATCTAAGGATTTCCCAATCAGTGTTTTATAAAATGGTGTTAAAATGACTTTAGAA
CCACCTTAAGGTCTTAGAAACAATCTGTTAAGAACATACAATAATTTAGATTCTAAAGAC
TTTGAAGAATGTCAAAAACCACTTGAGTTTAGAAGATTGCTGTTTGGTTTTTGTCTTTTC
CATGCAATTATCTAAGATAGAAGAAAGTTTGGCCCTATTGGTAAATATATCATTCATACA
TTAAATTAATTAATTTTTAAAAATTTTATCACCAAAATTTTAAGGTTGGAATATCGCATA
TGAGTTTACCAACGAAGATTTGACAGTATGTAGAAGGTAATTGAGAATGCTTTTGGATGA
ATACGAATTAGTTCCATATAAAGTGCTCAACTTTTTAGGTGCCGAAATCAATTATGGTGG
TAGAGTCACTGATGATAAAGATGTCCGTTTAATAAAAACGATTTTACAAAATTACGTCTG
CAGCTAAGCATTAGATGAAGGTTATAAGTATTCTAAATCTGGCATTTATTATCAACCAAA
AGCAGAAACCATAGACGATTATATTAGGTATATCACAGACCTACCTCTAAATCCTGAGCC
TGAAGCGTTCGGATTGCATGATAATGCAGAAATCACAAATAGTTAAAATACAACAAGAGA
ATTACTTGAAACTATATTGAGTGTATAACCTCGTTCAAGTTCATCTGGAGCCAAAAGTAG
AGAATAATAGATAGAAGAAATTGCTGACTATGTTTAATCTCGTACTCCAGAAGTGTTTAA
TTTCTAAGAGATTTATAAAAAATACCCTACAAAGTATGAAGAAAGTATGAATACTGTACT
TGTCCAAGAAATTATTAGGTAACTCTTTCTTTGTTTTATTAGTTTATTAAAAAATTTTTA
ATAAAAGATACAATCGTTTACTTGCGATCATGAAAGAAAGCTTGATCAATGTCAAGAAAG
CACTGAAAGGTTTAGTCGTAATGAGTGAAGAATTAGAGTTGTTAGCAAATAGCTTATTCG
ACAATTAGGTCCCAATAATGTGGGAAGAAAAGGGCTTTTTAAGTCTGAAACCACTTAGTT
CATGGACTCAAGATTTAAATGATAGAGTTAATTTCTTAAATGAATGGATTGAAAACGGTA
CACCAAAAGTTTTCTGGATTTCAGGTAAAAAAAGCAAAAAAATTATTAGACATAAAAAAA
TATTTTAAAATAATTAAAAAAGGATTCTTCTTCCCTCAGGCTTTCATAACAGGAACTTTG
TAGAATTTTGCAAGATAAGAGATTATTGCTGTTGATAAATTATCATTCGAATTCAAAATT
CTTGATAACTTACATTACACAGATATTCAACAAAAACCTAAAAGTGGGTGCTATATCTAT
GGAATTTATCTTGAAGGAGCTAAATGGAATTATAAGACTCATATGATTGATGATCCCTAA
CCAAAAGAATTATACTCTGATCTACCCTTAATTCATTTAGTGCCTAAAGAAAATAGGTAG
GTACCTGAAAATGGAATTTATAACAGTCCTCTTTACAAAGTAGTTTCCAGAAGAGGTACT
TTAAGTACTACAGGTCACTCAACTAATTTCGTTATGTTTTTGGAGCTGCCAACTGATAAA
AAATAGGAGGTTTGGATCACTGCAGGTGTTGCTGCCTTTTTATCATTAAGATATTGA