Identifiers and Description

Gene Model Identifier

TTHERM_00558310

Standard Name

DYH2 (DYnein Heavy chain )

Aliases

PreTt07928 | 73.m00172 | 3735.m00066 | AY770505

Description

Heavy chain subunit of non-axonemal dynein complex 2; molecular motor protein functioning in intracellular trafficking; required for maintenance of the cortical microtubule cytoskeleton

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF05227 ) CHASE3 domain
  • ( TIGR01612 ) rhoptry protein
  • ( PF00004 ) ATPase, AAA family
  • ( PF03028 ) Dynein heavy chain
  • ( PF01540 ) Adhesin lipoprotein
  • ( TIGR00041 ) thymidylate kinase
  • ( TIGR01257 ) rim ABC transporter
  • ( PF04100 ) Vps53-like, N-terminal
  • ( TIGR00455 ) adenylylsulfate kinase
  • ( TIGR02640 ) gas vesicle protein GvpN
  • ( TIGR00217 ) 4-alpha-glucanotransferase
  • ( PF04837 ) MbeB-like, N-term conserved region
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( PF06160 ) septation ring formation regulator EzrA
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( TIGR02397 ) DNA polymerase III, subunit gamma
  • ( PF01704 ) UTP--glucose-1-phosphate uridylyltransferase
  • ( PF06401 ) Alpha-2-macroglobulin RAP, C-terminal domain
  • ( PF04048 ) Sec8 exocyst complex component specific
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.4%

TetraMine Data

TTHERM_00558310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_48330
WormBaseWBGene000004859.997093137033517e-262locus:che-3 Cytoplasmic dyne
in 2 heavy chain 1 status:Pa
rtially_confirmed UniProt:Q1
9542 protein_id:CAA99830.2
Tetrahymena borealisEI9_14396.19.997093137033517e-262dynein heavy chain family prot
ein (4167 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig11800.0.g249.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18300275: Wilkes DE, Watson HE, Mitchell DR, Asai DJ (2008) Twenty-five dyneins in Tetrahymena: A re-examination of the multidynein hypothesis. Cell motility and the cytoskeleton 65(4):342-51
  2. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  3. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  4. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  5. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  6. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_00558310(coding)
ATGGATCAAAGAAAGGAGTATTTGCTTAATTGCATTACAGCTTTGCTCAAATTGAGTGAA
TTTCCTGAAAAATTGAGCAATTCATCCATTTTAGATAAATTTTTAAATGATTCTGACAAG
AACACACTGCCCCTTCTCTACGTTTACGGAAAAGGTTTCAAACTTTATAATTACACTGAT
AGTTAGCAACCTGAAAGTTTGATTATAACGTTAAGCAAAATTACAAATGAAACAATTACA
CCATAAAACGTAAACAGAGTAGTTAGTATCTCTTTAATGTCAAGCAATCCAGTAGATTAG
CTTTATCTGCAACTATCTAATTTTTATCTTCCAGCTCTTAAAGAAAAGTCAGATCCCAGC
ATTACCAAGTTATTAGAAGAATTAAAGATGAATTTAAGTGGCTCAACACAAGGTTTTGGC
AATGGAAACTTTGATGACATGGATGAAAATAATGTCAAAGTCATTTTCAAGCCAGTAGAT
GAATTAGATTTTTGGATTAGAATGCAATCTGCAGCTACATCAAATTAAGTGCAAAGAAGG
GCAGCCCAATATAGCGAATAACTCTCTTAAATTGACAAAATTTGGAGAGATATAAACAAA
GTTGAATTCAGTGGTATTAAGGAAGCAATAGACTAAACTTTAGCAGTGATGGATAAGATA
TGGAGATTAGATCCTAGTTAGCAAGGCTATCCTGAAGTCAGAATGAGAAAGTTTTTTGAG
GTCTGCATGAATACTTTAGTTGCACGTTTTTAGCAAGAGTTTAATACACAGGAAATTTGG
GACAGTTCTTAAAGCCAAGTTAGATTGAAACTTAATGAAGGACAATTATTTTTGAAACAC
TTTAATGAAAATATTACATTATACACAACTCAATTGTGGACTTAAGGAAGAAAGTGGACA
AGCGGATAAATTGATCTTACACTTTCTAATAATACCATTTAAAGAATAAATGAAATCTTA
GAATTAAGAGAACAATATGAAGAATTATTAAAAATGCAATAAATTAGCAACGGTAAGCTT
AAAGGAGACTTTGAGTCTGCTTATAGCACTTTCAGATAAATGAATTGTTTAAATGCTTCA
GATAATACCAAAGATTAATGGAATACAGCTAAAACAAAATTTAATCAATAGATGGAAGAA
ATTGATGACGAGGTAGTAAATATATTAAAAAAAGATATTCTTGCTTAAAATGTAAAAGAA
AATATGATGTAAATATTTAGAGATATGCAAAGCTGGAATGGCTTGCTCAACCGTCCTAAA
ATAAAAAAAGACCTTTAAAATGAGAGATCAAATATTCTTTAATCTATTCGTTAAATAGTT
GAATAAATATAAAATGAATTCGAAACAAAAAGTGGAGAAAATTTAGATCCAGTTTTAGGC
TCTGACGCTATTCCTTCAGGTCATAATTTCTCCAAAATATTAAACTCGATAGTTTGGGGT
AAATCCCTAAGTGGAAAACTTAAGAGAATTATGACTATCAGCTAAACATCTTTGGGAGAT
TTAAGAGAATACGGAGGATTTAAATAGTATTGTGAATAACTATCTTCTTAAATAAATGAA
TATTAAAATGATTAATTTAACTCTTGGAAATCTGATGCTATAAACTAAATAAGTAAACCT
GACAGCAAAGTAAGCTTAGAAATTACTGGTAGAATGATGGATATTAACCTATAAAATGGC
TTAGTAGAAGTCAACTACTCTGAAAGGTTGGTCTTGCTCATTAGAGAAGTCAGATAACTC
TTTGAGTTGGGTTTCAAAAAAGATATTCCAAAGTAAATTGTTGAAGTTGTAGAAAATGGC
AAAAAGTTTTATAAAGAAGCTTTAAATCTAAAGCAAATTGCTAATTTTTATAACTCAATG
TCAAGTGTGATTCCTCAATGCCTTTAGAAAATGCTTGCTGACAAAGCTATGAAGTTCGAA
AACATAATTTTAAATCCTAAAGTTGGAGCTAAAAAGTAATAAGGTGGTTAAAATCAAGGA
AACATTACTTGGAACAATGTAGATGAGTTAGAAGATTATATAAAAAAAGTGTAAGAAGCT
GCTAATGATATTATGAATGAAAACAGAAGATTAAGAAAACTTCATATGAGTTTAATAGAA
CAAGTTATTTTCCTTTTTGATGTCGACCTCGTCAAGAATAAACATGTCTGGAAGGAAAAG
TTAGAAACAATTAAAAAAACAATTGATGTTGGATGCTAAGGAAAAGATCCAAGCATTTGT
AATGTATGGAAATACAATTGGGATATTTAATTATATAAAGCTTTGGAACATTAATACTAA
AGAGGACTTTAAATGTTAGATTAGAACCTTTAAGAAATGAATGCTGATATTGTTTTGAAG
GGAAAAAATATTGAGTTCAGACCTCCTTTTGAAGAATTAAAGGAAAAATATTATAGAGAA
ATCAGAGCTTTTATTAATTGGCCTGCTAAAAATTTCTAAGGAGTAGGTGGAAGTTCAGAG
GTTTATAGTGCTATGCCTAAGAACAATGCCCAATACCTTTCTGTTGTTTATGCAAAAGCT
GAAAAACTATTTGAAAAATTGTAGAATCTTCTTGAAAAATTCCGTAACTGGACTGTTATT
GGATACTTAGATAGCGATAAAGTTGAAGAAAAACTCTCAGACATTGAAGACTGGGAATAT
AATATAAAGAATATTAGAACAAAGAGAAAAGAACTTGAAAAACTTTAAGATAGTTATAAA
ATAGAATGTTTTAATGTAAATCTTACTCCTTTCAAAAACAGCGCTGACGATTTACTATAA
AACTTTATCGATAATTTAACTAATTCTCTCAAGAATAGTGTAAAGAGTGATTGTGAAATT
TTAGAAGAATTTGTAACAAATAGTTTGGAAAAATTATCAAACAAGCCTAAGACTATGGAA
GAAATGAATGCAGCTAAGAGTTCATATTTTGAATTGAAGGGTTAGAAGAAACCCATGCAG
CAAAAGCTTAACAATATTCAAGTTAAAAATAAACTCTTAAGAAATCTTGTTGGCTTCGTT
TAAAACACTTCTAACATCGAAAAGAGATGGGAAAATTTCGAGCTTGCAATTGGAGATTTC
GATAATATATTGTCTGAATAAACTAAAACAATTAAGCAAGAAATTGGTAAGAGAAGTGAA
GGAGTCAATTAAGAAATTGATAAATTTTATGCTAAGTGGTAAAACTTAAAGCCAAAACAA
ACAGAAGAATTAGATAAAGAACAAGCAAGAGAATTAGCAGCAAAGATGAAAGAATGGAGA
AACGATTGGGGAGAGATCGAAAAGAAAGTCGAAGGCATTTAAAAGGATTGCGACCACTTT
GAGATGGATCAGCCTTCTTTTGCAAGCTTATCTCAAGTTAGAAGAGAGTTACAATCTGAA
GAGTCTTAATGGAAGGTATTTGATGACTTTAGTTCTGAATTAGAAACCTTTGAAAAGGAG
GATTGGCTTGTAGTTAAGGGTAAGCTCTACGACTTCCAAGATTTCACCATGAAGTGGACT
GATCTATTAAAGCAACAGACTAAAAGAGATGCAGTTTCATAATACATGATAGATCAAATT
GATCGCTTCAAATAAATTTGGACTGGACTTAGACTTTGTATTGGCGAAGCTTTTGAAAGA
GAACATTGGAGAAGCTTATTTGGAATCCTTAAATTACCTAAAGATGTTACTCTAGAAACT
TTAAAGTTTGGTCATTTATTGGATGCAGATAAAGAAATTCTCTTAAAAATGAATGATTTG
AAAGATTTAGCAGCTAGAGCTCAAGGTGAAGTTGCTTTAAGAGAAGCAATTTAAGAGTTA
AAGCAGTGGTGCGAAACTTACGATTTTGAATTAACTGAGCATAATTCTAATGGCAGATAA
ACTCCTCTTATTAAAGAATGGAAAGACTTGCTAACTAAGGTATCAGATAACCAAAGTTTA
CTTGCTTCTATGAAAGAAAGTAAATTCTATGCTAGATTCCAAGATTAGATTGAAGGGTTT
GAGCAAAAGCTTGGTGGTGTGGATGAATATTTAGGAAAATTGCAAGTTATTTAAAGAAAA
TGGGTTTATCTAGAACCTATTTTCGGAAGAGGCGCTCTTCCTGCAGAATAAGGTAGATTT
AAGCGTCTTGATGACGATTTTAGATCAATTATGCTTGGTATTGAAAGAGATCCTAAAGTT
GTTTCTCTTTGCATGGTGGCAGGTATTAAAGATACTTTGGAAACAATTTTAGATTAACTT
GAAAGATGCTAAAAGGCCTTAAATGATTTCTTAGAAGAAAAGAGAAGCAAATTCCCTAGA
TTTTATTTCTTGGGTGATGACGATTTGTTAGAAATTCTTGGTTAAAGTTAAAATGCTTAA
GTTATCTAAATGCATCTAAAGAAATTGTTTGCAGGAATCAATAAAGTTGAGTTTAACAAA
GATTGCTCTCAGATTCTTGCTATGATATCATCTTAAAAAGAAACTGTTTAATTGAATGAG
AAAGTTTAAGTGGAAGAGTAGGTAGAAAATTGGTTGAACTCTTTAAGTAGAAATATGGTT
AAGACTTTACAAAAGCTATTAGTTGAATGCCTTACTGAGAATTCTCTTGAGGCTGATAAA
TACCCAAGTTAAATTTTATGTATTAGTGAGGAAATCAAATTTACTGAAAAAGCAGTTGGT
GCAATAAGAAATGGAAAATTATCAAATTACAAAGCAGATTTATCTAGAATGTTAGAATAG
TTTACTAAACTTGTTGGCGGTGCACCATTATTGATTTAGTTAAAATTAAAAGCTTTGATC
CTAGATTTGATTCACCACATTGAAGTTATTGATGTCTTAATAGACAATAATGTATAGGAT
GTTTAAGATTGGTTCTGGTATAAATAATTGAAATACGAAATGAATTAAAAGAAAAATGGA
GAAATTATTATGTGTAGAGCTAGATTTGATTATACTTATGAATATTAAGGTAATGCACCT
AAGCTTGTGCACACTCCCTTGACAGATAAATGTTATCTTACACTGACTTAAGGTATGGAT
ATGGGTTATGGTGGTAATCCTTATGGTCCTGCTGGTACAGGAAAAACAGAGTCAGTCAAG
GCACTAGGTTAAGCATTTGGTAGATAGGTTTTGGTATTTAATTGTGATGAGGGATTGGAT
TTCAAGAGTATGGGTAGAATTTTTATTGGTTTAGTTAAATGTGGTGCTTGGGGTTGCTTT
GATGAGTTCAATCGTCTTTTAGAAGAATAATTATCAGCTATCTCTCAGTAAATTTAAGTC
ATTTAATGGGCTATCAAAGAAGGGGAATAAACCATGCAATTGATGGGATAAACTATTGAA
GTTAATAAAAATTCTGGTATTTTTGTCACTCTTAACCCTGCAGGAAAAGGATATGGTGGT
AGAAGTAAATTGCCAGATAACTTAAAGTAGTTATTCAGACCAGTAGCTATGAGTGTACCT
GATAATGAGCTGATTGCTGAAACTCTTCTCTACTCTGAAGGCTTTAAATATGCAAAGGAA
CTGTCTTAAAAAGTTATTTCAATATTTACTCTCAGTAGATAGCTGCTTTCTCCTCAATAA
CATTATGATTGGGGTCTTAGAGCTCTTAAAACTATTCTCACTGTAGCTGGTTAACTTATT
TAAGCAGAGAGATAAAAAACACCAAATATTTCTAGAGAATAAGAAGCTGAATTATTAATT
AAAGCTATTAGAATTAATACAATGTCCAAGCTGACATTTTCAGATACTCGTAAGTTCGTT
GCTTTGGTTTAAGATGTTTTCCCAGGGATTAAATCAGAAGATATCGTTTATGCTGAACTC
ACAAAAGCAGTTGAAGAAGTACTAGCTGAAATGAAATTGGATGTCATTGAGACCTAAATT
TCTAAAATATTACAATTTTATGAGGCTTGTAAGTAGAGAATGGGTGTTGTCCTAGTCGGC
CCCTCTGGTTGTGGTAAAACAACTATTTGGAAAACTCTTAAAAAAGCCTATGAAAAAATG
GGAACTTAAGTTAAAGCATATGTTATGAATCCTAAGAGTATGCCAAGGAGCTAACTTTTA
GGTCTTATGAATAATGACACAAGAGAATTCACTGAAGGTGTTTTAACTAGCAGTGCAAGA
GAAGTCATTAAAGAATCAAGTGATGTCATTAGTTGGATTATTTGTGATGGTGATATTGAC
CCTGAATGGATTGAATCACTTAACTCTGTCCTCGATGACAATCATTTACTCACACTACCT
ACTGGTGAGCGTATTAGCTTCTAAGATAATGTCAATTTTATTTTTGAAACAAATGATTTA
CAATACGCATCTCCAGCTACTGTTTCTAGAATGGGTATGATTTTCTTAAACTAGGAAGAT
ATTAGCATTAAATCAGTAGTCAATAAATGGGTAAAGAGATAGAAAGAAGAATTATAAGCT
AAGTTAGAAAATCTTTTAGAAGAATATTTCTATAAGATTCTTTAGTTTGTTCAACAATTT
GAAGAAGAGTAAGTAGTTTAGACAACTAGAATTGGTTTAGTTATGAATGTCCTTTCTTAG
CTTACTTCTATCCAAAGCAAGAGTGAATTTGTTACTTAAATGTTAAGAGGTTTTTGCAGT
AATTTCTCCTTACAGATTAGAGTAAAAATTGCAAATGAAATATTTTCTTTGTCTGGAGAT
AAACCTCCTTGTGATCTTAATAATTCACCATTAGATTTTGTTTGCATTAACGGATCTCTA
AGACCACTTTCTATCCTTTCTTAAGACATCAATCTGAATGACTTTGCTGATAGTGAAGAA
CCACCAATCATATAAACAATTGGTCTTCAAAGAGATTTTGAAGTTTTAAAGCCATGGATT
TTAAATTGTGAACCTTTTATTGTTTGTGGTCCTGAAGGAAGTGGAAAGAGTTTGTTGATT
AGGGCAGCTTTTAATGAGCTTAGAAAATAATAAAAAATTTAAGTTGCTACAATCTATTGT
AACGCTTAAACTACTGCAGCATAAATAATTCAAAAGCTTAATCAAATTTGTATGAAGGGT
ACTTTTTCTCAAGGAAGAATTCTTAAGCCAAAGGATGCCAGTAGATTAGTTTTATACCTC
AAAGATATTAACTTACCCAAACCAGATAAATATCAAACTATATAACTCATAGCTTTCTTG
CAATAAATTATTACTCACAAAGGTTATTATGATGAATAATTAGAGTTTGTTTACCTTGAC
GAAAAAATTTAGATTGTTGCTTCTATGGCACCTTCTTCAACTATAGGTAGACATGAAATT
TCTACTAGATTTACTGCTAACGCTCGTATACATTACATATAATATCCTTCAAAAGAAGAA
TTAATGCACACATACACTGAATATTCAAAGGCTATTTTCCAAAGCGAAAAAGTTCGCATT
GAAAAAAATTAGGCAGCATAAATTGCTAAAAAATTCAGTTTAGTTTTAATTGATTTCTAC
ACAAATTTCGCAAGTAAATTTAACGTTGATGAGCACAGACACTACAGCTTTACCCCTAGA
AATTTAACTTAAATAGTTTTTGGTATGTTGAGATATGAAATCGGTTAGAGCAATCCAGAT
TCTATAGGTGAAGCCTTATATAATGAAATATCAAAGAGATTCAGAGATAGATTAGTAAAC
TTTGAATAATAAAATAAATTCGATGCTTTCGTTGGCTCTTTACTTCGCTCACATTTATCA
TATTAGGTTACTCCTAACATTTTCTTTAGCTCTGTTGGAGGGTAAAAGCAATTAACTAGA
TTAGAGAAAAAAGATTATATTGTTGCAATCAATTAAGGTTTGCTCATGTATGAAAGAGAA
TTTAAAGAGATGAAACTTCACTTATTAGATGAAGTCCTATCTCTTTTATCAAGTCTTGAT
AGATGCTTAAGCTAAAGTGGCAGTGTTTTACTCGCTGGTAGAAGTGGTATAGGAAGAAAA
AGTTGTATTAGTCTTATGGCTACTATGCTAAGAATGGAAATAGTCAGTCCTAGCACAAGC
AGAGATTATAGCACAAGAGAGTTTAAAAAAGAACTTAAGATTTTCTTAGAAAAAGCAGCA
GCTTAAAATAAATAAGTAATTTTATATATTGAAGATCATCATTTAGTAAAATCTGAGTTT
TTGGAATTACTCAACTCATTGATTTCAAGTGGTGAAATTCCAGGTCTCTTTACTTAAGAT
GAAGTGGATCATTCCTTCTAAAATGCTGACGAAGTCCGTAGAGAAAACTATGGAAGATCT
TTATATGATATTTTCTGTATGAGAGTTAGATAAAATCTAAGAGTTGTTTTAAGCATGGAT
CATTCCGAGGAGACATTTGCAGCTAATTGTGCTTCTAATCCAGCATTCTTTACTAAATGT
ACAGTCATATGGTTAAATAACTGGAGCAAAGAATCTATGTCAGTGATTATGAAAGAAGAA
TTAAAAGAAATGCTTGAAAATTTCCCTGCAAAAGAAAAAGAAGATATTGCCAGTTACTTT
ATCAATATACACAAGTATGGTTTAGATAACTCTCGTGCTTCGCCATCTCATTTATTTGCT
TTGGCTCATACTTATTCTAAAATTTATCAAAAGAAAGTTAATTCAAGAGGCAGCTAGAGC
TCTCACTTGAAGAAGGGTTTAGGTAAACTTTAAGAAGCAAAAGAATTGGTAGATGTCTTA
TAAAAGCAAGCTTAAGTCAAAAAGTAAGAGTTAGCTGTAAAGCAAAAAGAAGCAGACAAC
GCCTTGGTATTAATTAGTAAAGCTATGTAAAATGCTGCAGAAAGAAAGGCTGAGTGTGAA
AAAATTTAAGAATATTTACAAAGTGAAGAAGGAAAGATACAAGATTAAAGGATGGAAGTC
CAAAGATAGCTCCAAGAAGTCGAACCTTTAATTCAATCTGCCAAAAAATCTGTAGACAAT
ATTAGCAAAAGTGATTTAGATTTCTTAAGAAATTTGATGATGCCTCCTCCTGTTATTCAC
AATATCATGAAAGGTGTCTTAAGGGTCTTCAATATTTCAGATGTTGAGAAATGGTAAACT
GTTAGATAGTTTTTAAGTAATAGGTAGGTATTAGAATAAATTATTAACTTTGATCCTGAT
ATTATTACTCCATAAGTTAGAAGAGGTGTTTAGGCCCAAATTATGGAAAGTGAATCATCT
TTCAGAAAAGAAGTTTCTTATAATGCTTCAAAAGCTGCTGGTCCTATGGCTGATTGGACT
ATTGCAGTACTTAAGTATAGTGAAGTAAATGAAAAAGTTATTCCTCTTAAAAATAATCTT
AAAGCAATTGATTCAAAGCTGAATGCTAGTAGACAAAAACTTTAAGAAAATGAAAATGAG
CTTCAAAAATTAGAAGGAAAGGTAGAATAATTGAAGTAAGACTTTGCTTCAAAGACTTCT
TCAGCAGAAATATTGAAAAACGAACTAAAGAAATAAGAAGAAACATTAGCTGTGGCCTCT
TAACTTCTTGATAAATTAGGTGATGAAAAGGTTCGTTGGGAAGCTCAAGCTTAATCTATT
GAAAAAGAATTCAAAAGTTTCCCAGTAGAGAGTTTACTTGCTGCTGGTTTTACAATCTAT
TTAAGTGAAAATGATGAAAATTAAAGAGAAAAGGCAATATAAGAATGGAAATAAATGACC
AAATCTCAGACTTTTAATTACTTGAAATTCCTAAGTAGCGAAGGTTAAATGCTTAAGTGG
AAGAGTGAGGGTTTACCTGGTGACTCTCTCAGTTTAGAAAACAGTGTTATGATCTTCCAT
TCTAGTAAGACTCCTTTGTTGATTGATCCTAATACTTAAGCTACTGAGTGGCTCAAGAAA
AATTTAGGAACTATCGAAGTCTTAAATCAACAAGACCCTAAATTCTCTAATCAACTCGAA
TTATCAGTTCTTTTCGGAAAAACTTTACTGATTTAAGAATTAGATAAAATAGAACCTATT
TTAGTACCTATTTTGAGAAAAGATTTAGTCCACTAAGGTCCTAGATGGGTTGTTATGATT
GGCGATAAATATGTTAACTATAATGAGAATTTCAAGCTTTATTTATGTACAAGAAATAGC
GGTATTGAAATAAATGCAAATACAAGTGCTTTGGTAAGTATAATAAACTACACAGTCACC
AAGAGTGGTTTGGAAGGTAAACTGTTGAGTATAATTATTAACCACGAATAGCCAGATCTA
GAAAAAAGAAAATAAGAGCTCTTAGAGAATGAAGAAAAACTCAAAATACAACTAGAAGAG
TTAGAAAAGACACTTTTAGAAGAATTGGCAAGTTCAACAGGTAACATCCTTGAAAATTCT
GTGCTTATTGAGAGTTTAAATCAAACTAAGTAAAAGAGTTAGACTATTGAAGTTAGTTTA
AAGGAAAGTACAAAATTATAAGAAAACCTAGATCAATAAAGAGAAGTCTATAGAAATCTT
GCAGTCAAGGGTGCTTAACTTTTCATAAGTATAGGTGACTTAAAGAAAATCAATAATATG
TACAGGTTCTCTTTGAATTACTTCATAAAGCTTTTCAAAATTTGCCTAAATGTTAAAGAA
TAATTCCCCAATATGCAAGCTAAACTCCAATTCTGTGCAGTCAATCTAAATAGAATTATC
TTTAATAATGTTGCAAGCTCGCTATTTAAACACGATAGACTTATGTTTGGTCTTCATATT
GTTCACGACATATATCCTGAGTATTTCTAACAAAGCGAATGGGATTTCTTGTTAGGAAAC
ACTGCTCTAGCAATTGAAAGCAACTTGTAATTACCTAAATGGGCTAACCCTGACTGCAAA
GATCAATATGCAGTATTTGTCAATAGTTTTGGAAAACTTTGCAACAATATTAACTTCAAT
GATAGAGAGTGGGAATAATGGAGCAAGGAATTGCAATGTGAAAGAGTTTTCCCCTAAGCC
TATGCAAGCAAATTAACTCAATTTTAGAAAGTATTGTTTGTTCAAGTTTTCAGACCTGAA
AGATTGCAATCTGCTTTGAATGATTTTGTATGCTAGTCATTGCAAATATCTTCAATTAGT
GGAAATCCATTCTCTTTTAATTCCATCTATTAATAGGAGACATCCACCTAAACTCCTGCC
TTGTTTGTTGTTTCTCCCGGTTCTGATCCTTCTGCAGAATTAGAAGAATATGCTGAGTAA
TAAATTGGCAGAGAAAACTTCTAAGAAATGTCCATGGGTGGTAACCAAAATGACGTAGCT
CTAGAAAAACTAAGAGAAGCTGCAAACAAAGGATATTGGCTTTGTCTTAAAAACTTACAT
TTAGTCACAGCATGGCTTCCAATTTTAGAAAAAGAATTAAAAACTCTAACACCTCACTAG
AATTTCAGATTATGGCTTACAACTGAAGCTCATATTAAATTCCCAGCTATCTTACTAGAA
ACCTGCTACAAGGTATCTTATGAATCTCCACCTGGTCTTAAAAAGAACGTTGAAAGAATC
TACAGCAGTTGGAGTCCCTAATACATTGCCAAGGGTTCTGCTTAGAGAGCTTAATTGTTA
TTCCTTTTAGCTTGGTTCCATGCTATTTTACAAGAAAGAAGAACCTATATTCCTTAAGGT
TGGTCTAAGTTCTATGAGTTTTCATATGGTGATTTGAGAGCTGGTACTTAAATTATTGAA
GGACTTGTTTAGGACACCTAATAGAAAGGAATAAGTTGGGAAACTCTTTATGGGTTATTT
GAAAATGCAATTTATGGAGGTAGAATTGATGAGGCTTTTGATATGAGAGTATTGAGATCC
TACATCGAATTGTATTTCAATAATAATATTCTTAAAGGTTCTGCTAGAATACCTACTGGT
GATACTCTCCCACAAAGTACTAATTTGCCTGATTACTTGGCAATAGTTAAGAAGATGAGT
GAAACTGATACTCCCTCTATTTTTGGTTTACCTCTAAATATTGATAAGGCAGTTTAAAGA
TATAATACTTAACAGGTTATTTCTAATCTTAAGATTATCATGCAAGCAAGTGCTGAGGAT
CTTAAATTTGATAAGGAAAAATGGTAGAAATAACTTGGAACAATTATAAATCTTTGGAAA
AATCTTTATAAGCAGTTCCGTGAAGGAAGTGGTTTACCTTAAATTAAACCTTAAAATCTA
ACTTCAACAGACCCTATAGAATCATTTGTTTACCTAGAAGCTTCATCAGCATACTAAATG
CTTGAAAAAATTGAAAGCTCAATTGAGGGTTTGAATAAAGTTTTGTTTGGAAATGGTTTA
TTAACTAGCGAAATACAAGCAACAGGTATGGAACTCATGCTTGGTAATGTTCCTGAAAAA
TGGAGTAAAGTTTGGGAAGGACCTGATAACGCTAATAGCTGGCTTAAGGGATTCTGCTCA
AGAGTTTATCAACTTAAGAAATGGGTAGAAACCTTAAGAAACGGTAGTCTTCTTGACAGT
CCACTCAATTTATCTGACCTTTTCCACCCCGAAATTTTCTTAAACGCTTTAAGATAGAAA
ACAGCAAGAAAAATAAGCAAACCCCTTAATGACCTTAAAATAGTTACATCATTCGATTAA
TCAAAAATCAGCACTGCCATTACCATAAAAATAAAAAATCTTTTACTTTAAGGTTGCTAG
ATTAACTAAGGACATCTTATTGATGGAGCCTAAGATCTTCCTGAATTCGTTTAACTACCT
GAATTATATATTGGATTTATCCCTAAAGATGAATAAGATCCTTACCCCTCTAATACTTTA
GGAGAATTCCCAATATTCTCAAGTAGCCAAAGAGAAAAACTTGTAGCAAAAATAAAAATA
CCAGTACAAGGAAGTCTAAACGATAGAATAATTGCTGGTGTTGCATTTGTTTTATAAAAT
AATTGA


>TTHERM_00558310(protein)
MDQRKEYLLNCITALLKLSEFPEKLSNSSILDKFLNDSDKNTLPLLYVYGKGFKLYNYTD
SQQPESLIITLSKITNETITPQNVNRVVSISLMSSNPVDQLYLQLSNFYLPALKEKSDPS
ITKLLEELKMNLSGSTQGFGNGNFDDMDENNVKVIFKPVDELDFWIRMQSAATSNQVQRR
AAQYSEQLSQIDKIWRDINKVEFSGIKEAIDQTLAVMDKIWRLDPSQQGYPEVRMRKFFE
VCMNTLVARFQQEFNTQEIWDSSQSQVRLKLNEGQLFLKHFNENITLYTTQLWTQGRKWT
SGQIDLTLSNNTIQRINEILELREQYEELLKMQQISNGKLKGDFESAYSTFRQMNCLNAS
DNTKDQWNTAKTKFNQQMEEIDDEVVNILKKDILAQNVKENMMQIFRDMQSWNGLLNRPK
IKKDLQNERSNILQSIRQIVEQIQNEFETKSGENLDPVLGSDAIPSGHNFSKILNSIVWG
KSLSGKLKRIMTISQTSLGDLREYGGFKQYCEQLSSQINEYQNDQFNSWKSDAINQISKP
DSKVSLEITGRMMDINLQNGLVEVNYSERLVLLIREVRQLFELGFKKDIPKQIVEVVENG
KKFYKEALNLKQIANFYNSMSSVIPQCLQKMLADKAMKFENIILNPKVGAKKQQGGQNQG
NITWNNVDELEDYIKKVQEAANDIMNENRRLRKLHMSLIEQVIFLFDVDLVKNKHVWKEK
LETIKKTIDVGCQGKDPSICNVWKYNWDIQLYKALEHQYQRGLQMLDQNLQEMNADIVLK
GKNIEFRPPFEELKEKYYREIRAFINWPAKNFQGVGGSSEVYSAMPKNNAQYLSVVYAKA
EKLFEKLQNLLEKFRNWTVIGYLDSDKVEEKLSDIEDWEYNIKNIRTKRKELEKLQDSYK
IECFNVNLTPFKNSADDLLQNFIDNLTNSLKNSVKSDCEILEEFVTNSLEKLSNKPKTME
EMNAAKSSYFELKGQKKPMQQKLNNIQVKNKLLRNLVGFVQNTSNIEKRWENFELAIGDF
DNILSEQTKTIKQEIGKRSEGVNQEIDKFYAKWQNLKPKQTEELDKEQARELAAKMKEWR
NDWGEIEKKVEGIQKDCDHFEMDQPSFASLSQVRRELQSEESQWKVFDDFSSELETFEKE
DWLVVKGKLYDFQDFTMKWTDLLKQQTKRDAVSQYMIDQIDRFKQIWTGLRLCIGEAFER
EHWRSLFGILKLPKDVTLETLKFGHLLDADKEILLKMNDLKDLAARAQGEVALREAIQEL
KQWCETYDFELTEHNSNGRQTPLIKEWKDLLTKVSDNQSLLASMKESKFYARFQDQIEGF
EQKLGGVDEYLGKLQVIQRKWVYLEPIFGRGALPAEQGRFKRLDDDFRSIMLGIERDPKV
VSLCMVAGIKDTLETILDQLERCQKALNDFLEEKRSKFPRFYFLGDDDLLEILGQSQNAQ
VIQMHLKKLFAGINKVEFNKDCSQILAMISSQKETVQLNEKVQVEEQVENWLNSLSRNMV
KTLQKLLVECLTENSLEADKYPSQILCISEEIKFTEKAVGAIRNGKLSNYKADLSRMLEQ
FTKLVGGAPLLIQLKLKALILDLIHHIEVIDVLIDNNVQDVQDWFWYKQLKYEMNQKKNG
EIIMCRARFDYTYEYQGNAPKLVHTPLTDKCYLTLTQGMDMGYGGNPYGPAGTGKTESVK
ALGQAFGRQVLVFNCDEGLDFKSMGRIFIGLVKCGAWGCFDEFNRLLEEQLSAISQQIQV
IQWAIKEGEQTMQLMGQTIEVNKNSGIFVTLNPAGKGYGGRSKLPDNLKQLFRPVAMSVP
DNELIAETLLYSEGFKYAKELSQKVISIFTLSRQLLSPQQHYDWGLRALKTILTVAGQLI
QAERQKTPNISREQEAELLIKAIRINTMSKLTFSDTRKFVALVQDVFPGIKSEDIVYAEL
TKAVEEVLAEMKLDVIETQISKILQFYEACKQRMGVVLVGPSGCGKTTIWKTLKKAYEKM
GTQVKAYVMNPKSMPRSQLLGLMNNDTREFTEGVLTSSAREVIKESSDVISWIICDGDID
PEWIESLNSVLDDNHLLTLPTGERISFQDNVNFIFETNDLQYASPATVSRMGMIFLNQED
ISIKSVVNKWVKRQKEELQAKLENLLEEYFYKILQFVQQFEEEQVVQTTRIGLVMNVLSQ
LTSIQSKSEFVTQMLRGFCSNFSLQIRVKIANEIFSLSGDKPPCDLNNSPLDFVCINGSL
RPLSILSQDINLNDFADSEEPPIIQTIGLQRDFEVLKPWILNCEPFIVCGPEGSGKSLLI
RAAFNELRKQQKIQVATIYCNAQTTAAQIIQKLNQICMKGTFSQGRILKPKDASRLVLYL
KDINLPKPDKYQTIQLIAFLQQIITHKGYYDEQLEFVYLDEKIQIVASMAPSSTIGRHEI
STRFTANARIHYIQYPSKEELMHTYTEYSKAIFQSEKVRIEKNQAAQIAKKFSLVLIDFY
TNFASKFNVDEHRHYSFTPRNLTQIVFGMLRYEIGQSNPDSIGEALYNEISKRFRDRLVN
FEQQNKFDAFVGSLLRSHLSYQVTPNIFFSSVGGQKQLTRLEKKDYIVAINQGLLMYERE
FKEMKLHLLDEVLSLLSSLDRCLSQSGSVLLAGRSGIGRKSCISLMATMLRMEIVSPSTS
RDYSTREFKKELKIFLEKAAAQNKQVILYIEDHHLVKSEFLELLNSLISSGEIPGLFTQD
EVDHSFQNADEVRRENYGRSLYDIFCMRVRQNLRVVLSMDHSEETFAANCASNPAFFTKC
TVIWLNNWSKESMSVIMKEELKEMLENFPAKEKEDIASYFINIHKYGLDNSRASPSHLFA
LAHTYSKIYQKKVNSRGSQSSHLKKGLGKLQEAKELVDVLQKQAQVKKQELAVKQKEADN
ALVLISKAMQNAAERKAECEKIQEYLQSEEGKIQDQRMEVQRQLQEVEPLIQSAKKSVDN
ISKSDLDFLRNLMMPPPVIHNIMKGVLRVFNISDVEKWQTVRQFLSNRQVLEQIINFDPD
IITPQVRRGVQAQIMESESSFRKEVSYNASKAAGPMADWTIAVLKYSEVNEKVIPLKNNL
KAIDSKLNASRQKLQENENELQKLEGKVEQLKQDFASKTSSAEILKNELKKQEETLAVAS
QLLDKLGDEKVRWEAQAQSIEKEFKSFPVESLLAAGFTIYLSENDENQREKAIQEWKQMT
KSQTFNYLKFLSSEGQMLKWKSEGLPGDSLSLENSVMIFHSSKTPLLIDPNTQATEWLKK
NLGTIEVLNQQDPKFSNQLELSVLFGKTLLIQELDKIEPILVPILRKDLVHQGPRWVVMI
GDKYVNYNENFKLYLCTRNSGIEINANTSALVSIINYTVTKSGLEGKLLSIIINHEQPDL
EKRKQELLENEEKLKIQLEELEKTLLEELASSTGNILENSVLIESLNQTKQKSQTIEVSL
KESTKLQENLDQQREVYRNLAVKGAQLFISIGDLKKINNMYRFSLNYFIKLFKICLNVKE
QFPNMQAKLQFCAVNLNRIIFNNVASSLFKHDRLMFGLHIVHDIYPEYFQQSEWDFLLGN
TALAIESNLQLPKWANPDCKDQYAVFVNSFGKLCNNINFNDREWEQWSKELQCERVFPQA
YASKLTQFQKVLFVQVFRPERLQSALNDFVCQSLQISSISGNPFSFNSIYQQETSTQTPA
LFVVSPGSDPSAELEEYAEQQIGRENFQEMSMGGNQNDVALEKLREAANKGYWLCLKNLH
LVTAWLPILEKELKTLTPHQNFRLWLTTEAHIKFPAILLETCYKVSYESPPGLKKNVERI
YSSWSPQYIAKGSAQRAQLLFLLAWFHAILQERRTYIPQGWSKFYEFSYGDLRAGTQIIE
GLVQDTQQKGISWETLYGLFENAIYGGRIDEAFDMRVLRSYIELYFNNNILKGSARIPTG
DTLPQSTNLPDYLAIVKKMSETDTPSIFGLPLNIDKAVQRYNTQQVISNLKIIMQASAED
LKFDKEKWQKQLGTIINLWKNLYKQFREGSGLPQIKPQNLTSTDPIESFVYLEASSAYQM
LEKIESSIEGLNKVLFGNGLLTSEIQATGMELMLGNVPEKWSKVWEGPDNANSWLKGFCS
RVYQLKKWVETLRNGSLLDSPLNLSDLFHPEIFLNALRQKTARKISKPLNDLKIVTSFDQ
SKISTAITIKIKNLLLQGCQINQGHLIDGAQDLPEFVQLPELYIGFIPKDEQDPYPSNTL
GEFPIFSSSQREKLVAKIKIPVQGSLNDRIIAGVAFVLQNN


>TTHERM_00558310(gene)
ATGGATCAAAGAAAGGAGTATTTGCTTAATTGCATTACAGCTTTGCTCAAATTGAGTGAA
TTTCCTGAAAAATTGAGCAATTCATCCATTTTAGATAAATTTTTAAATGATTCTGACAAG
AACACACTGCCCCTTCTCTACGTTTACGGAAAAGGTTTCAAACTTTATAATTACACTGAT
AGTTAGCAACCTGAAAGTTTGATTATAACGTTAAGCAAAATTACAAATGAAACAATTACA
CCATAAAACGTAAACAGAGTAGTTAGTATCTCTTTAATGTCAAGCAATCCAGTAGATTAG
CTTTATCTGCAACTATCTAATTTTTATCTTCCAGCTCTTAAAGAAAAGTCAGATCCCAGC
ATTACCAAGTTATTAGAAGAATTAAAGATGAATTTAAGTGGCTCAACACAAGGTATAAAA
TTGATCAATTTTTTTAGAATTTTACAAGCTTATTTAGAAGGCTTTAAAAAAACAATTGTC
ATATTAAAAGGTTTTGGCAATGGAAACTTTGATGACATGGATGAAAATAATGTCAAAGTC
ATTTTCAAGCCAGTAGATGAATTAGATTTTTGGATTAGAATGCAATCTGCAGCTACATCA
AATTAAGTGCAAAGAAGGGCAGCCCAATATAGCGAATAACTCTCTTAAATTGACAAAATT
TGGAGGTATTTTTAATTTTTGCAAAGCAATTAATGATGGCAATTTTCTTAGATAATTTCA
CAAATAATTATAAATTAAGTAAATAAACTTTAAATTGCACTTATAAAATAGAGATATAAA
CAAAGTTGAATTCAGTGGTATTAAGGAAGCAATAGACTAAACTTTAGCAGTGATGGATAA
GGTAATTTTATATATTTAAAATGAGAAACGCTATTTATTGTTTATGATTTTTTAGTTTCT
TCAAAGATAAGAATTGATTAGAGTGTTGAAAATTAAAATTAATCAAATTTTAAATATTGA
GCTGCTAATTCTTAATTTTCTTTTTAATAATTTTTATTTATATTATTAAGATATGGAGAT
TAGATCCTAGTTAGCAAGGCTATCCTGAAGTCAGAATGAGAAAGTTTTTTGAGGTCTGCA
TGAATACTTTAGTTGCACGTTTTTAGCAAGAGTTTAATACACAGGAAATTTGGGACAGTT
CTTAAAGCCAAGTTAGATTGAAACTTAATGAAGGACAATTATTTTTGAAACACTTTAATG
AAAATATTACATTATACACAACTCAATTGTGGACTTAAGGAAGAAAGTGGACAAGCGGAT
AAATTGATCTTACACTTTCTAATAATACCATTTAAAGAATAAATGAAATCTTAGAATTAA
GAGAACAATATGAAGAATTATTAAAAATGCAATAAATTAGCAACGGTAAGCTTAAAGGAG
ACTTTGAGTCTGCTTATAGCACTTTCAGATAAATGAATTGTTTAAATGCTTCAGATAATA
CCAAAGATTAATGGAATACAGCTAAAACAAAATTTAATCAATAGATGGAAGTAATAAATT
TTGTTAAATAATTTACTTATTTGTTTTTCAAAAAATATTTAAAACCTTTTTTTAAAAAAA
TATTTTTATTTGATTTTATTAGGAAATTGATGACGAGGTAGTAAATATATTAAAAAAAGA
TATTCTTGCTTAAAATGTAAAAGAAAATATGATGTAAATATTTAGAGATATGCAAAGCTG
GAATGGCTTGCTCAACCGTCCTAAAATAAAAAAAGACCTTTAAAATGAGAGATCAAATAT
TCTTTAATCTATTCGTTAAATAGTTGAATAAATATAAAATGAATTCGAAACAAAAAGTGG
AGAAAATTTAGATCCAGTTTTAGGCTCTGACGCTATTCCTTCAGGTCATAATTTCTCCAA
AATATTAAACTCGATAGTTTGGGGTAAATCCCTAAGTGGAAAAGTAAATAAAATTTTTAA
GGAAAAATAAACTTATATTTAAACTAATTTATCTTAATTACTAGCTTAAGAGAATTATGA
CTATCAGCTAAACATCTTTGGGAGATTTAAGAGAATACGGAGGATTTAAATAGTATTGTG
AATAACTATCTTCTTAAATAAATGAATATTAAAATGATTAATTTAACTCTTGGAAATCTG
ATGCTATAAACTAAATAAGTAAACCTGACAGCAAAGTAAGCTTAGAAATTACTGGTAGAA
TGATGGATATTAACCTATAAAATGGCTTAGTAGAAGTCAACTACTCTGAAAGGTTGGTCT
TGCTCATTAGAGAAGTCAGATAACTCTTTGAGTTGGGTTTCAAAAAAGATATTCCAAAGT
AAATTGTTGAAGTTGTAGAAAATGGCAAAAAGTTTTATAAAGAAGCTTTAAATCTAAAGC
AAGTAATTTGTTAATTAATTCAGTAAACTTTAACAAATGTGTATTTTTTCTTAATTAAAA
TTAATTAGATTGCTAATTTTTATAACTCAATGTCAAGTGTGATTCCTCAATGCCTTTAGA
AAATGCTTGCTGACAAAGCTATGAAGTTCGAAAACATAATTTTAAATCCTAAAGTTGGAG
CTAAAAAGTAATAAGGTGGTTAAAATCAAGGAAACATTACTTGGAACAATGTAGATGAGT
TAGAAGATTATATAAAAAAAGTGTAAGAAGCTGCTAATGATATTATGAATGAAAACAGAA
GATTAAGAAAACTTCATATGAGTTTAATAGAACAAGTTATTTTCCTTTTTGATGTCGACC
TCGTCAAGAATAAACATGTCTGGAAGGAAAAGTTAGAAGTAATAAACTTTTATTAATGTT
TATACTATATATTCAAATAATAAATATTAATTTATTTTTATTTTTCTTATTAATTAAGAC
AATTAAAAAAACAATTGATGTTGGATGCTAAGGAAAAGATCCAAGCATTTGTAATGTATG
GAAATACAATTGGGATATTTAATTATATAAAGCTTTGGAACATTAATACTAAAGAGGACT
TTAAATGTTAGATTAGGTAAAAAATAAATTTGATTTGTAAATTTTATTAAATTAAACTTA
AATTAAATAGAACCTTTAAGAAATGAATGCTGATATTGTTTTGAAGGGAAAAAATATTGA
GTTCAGACCTCCTTTTGAAGAATTAAAGGAAAAATATTATAGAGAAATCAGAGCTTTTAT
TAATTGGCCTGCTAAAAATTTCTAAGGAGTAGGTGGAAGTTCAGAGGTTTATAGTGCTAT
GCCTAAGAACAATGCCCAATACCTTTCTGTTGTTTATGCAAAAGCTGAAAAACTATTTGA
AAAATTGTAGAATCTTCTTGAAAAATTCCGTAACTGGACTGTTATTGGATACTTAGATAG
CGATAAAGTTGAAGAAAAAGTACATTTTTAATCATTTTACTTAGTTTTAATATTATTTTT
TTTGATTTAATAGCTCTCAGACATTGAAGACTGGGAATATAATATAAAGAATATTAGAAC
AAAGAGAAAAGAACTTGAAAAACTTTAAGATAGTTATAAAATAGAATGTTTTAATGTAAA
TCTTACTCCTTTCAAAAACAGCGCTGACGATTTACTATAAAACTTTATCGATAATTTAAC
TAATTCTCTCAAGAATAGTGTAAAGAGTGATTGTGAAATTTTAGAAGAATTTGTAACAAA
TAGTTTGGAAAAATTATCAAACAAGCCTAAGACTATGGAAGAAATGAATGCAGCTAAGAG
TTCATATTTTGAATTGAAGGGTTAGAAGAAACCCATGCAGCAAAAGCTTAACAATATTCA
AGTTAAAAATAAACTCTTAAGAAATCTTGTTGGCTTCGTTTAAAACACTTCTAACATCGA
AAAGAGATGGGAAAATTTCGAGCTTGCAATTGGAGATTTCGATAATATATTGTCTGAATA
AACTAAAACAATTAAGCAAGAAATTGGTAAAGAGTTTTTTATAAATTAAATCTAGACAAA
ACATAAAAAGAAATACAAAGCTCACAAATATAAATTAATAATTAAATTAAATTTCTTTTG
AATTCTAATTTAGGTAAGAGAAGTGAAGGAGTCAATTAAGAAATTGATAAATTTTATGCT
AAGTGGTAAAACTTAAAGCCAAAACAAACAGAAGAATTAGATAAAGAACAAGCAAGAGAA
TTAGCAGCAAAGATGAAAGAATGGAGAAACGATTGGGGAGAGATCGAAAAGAAAGTCGAA
GGCATTTAAAAGGATTGCGACCACTTTGAGATGGATCAGCCTTCTTTTGCAAGCTTATCT
CAAGTTAGAAGAGAGTTACAATCTGAAGTGAGCTTATTTAAATTAAGTTTTTTAAATTAA
AATATTTTTACATTTTTCATAATAATAGGAGTCTTAATGGAAGGTATTTGATGACTTTAG
TTCTGAATTAGAAACCTTTGAAAAGGAGGATTGGCTTGTAGTTAAGGGTAAGCTCTACGA
CTTCCAAGATTTCACCATGAAGTGGACTGATCTATTAAAGCAACAGACTAAAAGAGATGC
AGTTTCATAATACATGATAGATCAAATTGATCGCTTCAAATAAATTTGGACTGGACTTAG
ACTTTGTATTGGTAAATAATTAGTCAAAATATAAATATCACCTTTAATCAAAATAGCAAA
TACATACCAATATTTATTTATACTCTAATAAATTATTAAAACTTATATAAATAATAAAGT
TAAAAAAAAATTAATTTAATTTAAATATAGGCGAAGCTTTTGAAAGAGAACATTGGAGAA
GCTTATTTGGAATCCTTAAATTACCTAAAGATGTTACTCTAGAAACTTTAAAGTTTGGTC
ATTTATTGGATGCAGATAAAGAAATTCTCTTAAAAATGAATGATTTGAAAGATTTAGCAG
CTAGAGCTCAAGGTGAAGTTGCTTTAAGAGAAGCAATTTAAGAGTTAAAGCAGTGGTGCG
AAACTTACGATTTTGAATTAACTGAGCATAATTCTAATGGCAGATAAACTCCTCTTATTA
AAGAATGGAAAGACTTGCTAACTAAGGTATCAGATAACCAAAGTTTACTTGCTTCTATGA
AAGAAAGTAAATTCTATGCTAGATTCCAAGATTAGATTGAAGGGTTTGAGCAAAAGCTTG
GTGGTGTGGATGAATATTTAGGTAAATTTATTTTGTTTATTAATATATAATTTTAAATCA
AATAAATAAATAATTTTATTAAAAAAAAATTAATTCAATTAAAATAGGAAAATTGCAAGT
TATTTAAAGAAAATGGGTTTATCTAGAACCTATTTTCGGAAGAGGCGCTCTTCCTGCAGA
ATAAGGTAGATTTAAGCGTCTTGATGACGATTTTAGGTAATTAAAAAGTTTAATTTAATT
TTTGAGGATATTAAGTTACTTACTTACTTAAAATTTTAAATTATTATAAATAGATCAATT
ATGCTTGGTATTGAAAGAGATCCTAAAGTTGTTTCTCTTTGCATGGTGGCAGGTATTAAA
GATACTTTGGAAACAATTTTAGATTAACTTGAAAGATGCTAAAAGGCCTTAAATGATTTC
TTAGAAGAAAAGAGAAGTAAAAAAATTAATTGATTTTGTAAATTGTTTAATAAAATATTT
ATTTTTAATATAGGCAAATTCCCTAGATTTTATTTCTTGGGTGATGACGATTTGTTAGAA
ATTCTTGGTTAAAGTTAAAATGCTTAAGTTATCTAAATGCATCTAAAGAAATTGTTTGCA
GGAATCAATAAAGTTGAGTTTAACAAAGATTGCTCTCAGATTCTTGCTATGATATCATCT
TAAAAAGAAACTGTTTGTAAATGAATTTTTATTTTGTTTTACAAAGATTAATTTATCAAT
TTAAAATAAAATTTAGAATTGAATGAGAAAGTTTAAGTGGAAGAGTAGGTAGAAAATTGG
TTGAACTCTTTAAGTAGAAATATGGTTAAGACTTTACAAAAGCTATTAGTTGAATGCCTT
ACTGAGAATTCTCTTGAGGCTGATAAATACCCAAGTTAAATTTTATGTATTAGTGAGGAA
ATCAAATTTACTGAAAAAGCAGTTGGTAATTAATTAATTAATTAATTACTTAATTAATTT
ATATTTTATCATCTTAATCTGTAAATTTTAAATTTATTTCTTTTAATTTAGGTGCAATAA
GAAATGGAAAATTATCAAATTACAAAGCAGATTTATCTAGAATGTTAGAATAGTTTACTA
AACTTGTTGGCGGTGCACCATTATTGATTTAGTTAAAATTAAAAGCTTTGATCCTAGATT
TGATTCACCACATTGAAGTTATTGATGTCTTAATAGACAATAATGTATAGGATGTTTAAG
ATTGGTTCTGGTATAAATAATTGAAATACGAAATGAATTAAAAGAAAAATGGAGAAATTA
TTATGTGTAGAGCTAGATTTGATTATACTTATGAATATTAAGGTAATGCACCTAAGCTTG
TGCACACTCCCTTGACAGATAAATGTTATCTTACACTGACTTAAGGTTATTTATTAAATA
TTTATCTTAAATTTCATTTATATTATCAGATTAATTTTATTGATTTATTTATTATCTCTC
TCTTATATTAAATTTGTTAATCATTTTACTAAATAGGTATGGATATGGGTTATGGTGGTA
ATCCTTATGGTCCTGCTGGTACAGGAAAAACAGAGTCAGTCAAGGCACTAGGTTAAGCAT
TTGGTAGATAGGTAACAATATATATTGAATTGATAAAGTTTTTAAATTCATTTTAATTAA
AAACAGGTTTTGGTATTTAATTGTGATGAGGGATTGGATTTCAAGAGTATGGGTAGAATT
TTTATTGGTTTAGTTAAATGTGGTGCTTGGGGTTGCTTTGATGAGTTCAATCGTCTTTTA
GAAGAATAATTATCAGCTATCTCTCAGTAAATTTAAGTCATTTAATGGGCTATCAAAGAA
GGGGAATAAACCATGCAATTGATGGGATAAACTATTGAAGTTAATAAAAATTCTGGTATT
TTTGTCACTCTTAACCCTGCAGGAAAAGGTAATTAAATAAATAATATATCTTAAACTAAC
TTAAATATTAATAATAAAAAAAATAGGATATGGTGGTAGAAGTAAATTGCCAGATAACTT
AAAGTAGTTATTCAGACCAGTAGCTATGAGTGTACCTGATAATGAGCTGATTGCTGAAAC
TCTTCTCTACTCTGAAGGCTTTAAATATGCAAAGGAACTGTCTTAAAAAGTTATTTCAAT
ATTTACTCTCAGTAGATAGCTGCTTTCTCCTCAATAACATTATGATTGGGGTCTTAGAGC
TCTTAAAACTATTCTCACTGTAGCTGGTTAACTTATTTAAGCAGAGAGATAAAAAACACC
AAATATTTCTAGAGTATTACAATAATTTATAGTTAATTTTTTTTCAATTAAATTTTAATT
ATAAAAATTAGGAATAAGAAGCTGAATTATTAATTAAAGCTATTAGAATTAATACAATGT
CCAAGCTGACATTTTCAGATACTCGTAAGTTCGTTGCTTTGGTTTAAGATGTTTTCCCAG
GGATTAAATCAGAAGATATCGTTTATGCTGAACTCACAAAAGCAGTTGAAGAAGTACTAG
CTGAAATGAAATTGGATGTCATTGAGACCTAAATTTCTAAAATATTACAATTTTATGAGG
CTTGTAAGTAGAGAATGGGTGTTGTCCTAGTCGGCCCCTCTGGTTGTGGTAAAACAACTA
TTTGGAAAACTCTTAAAAAAGCCTATGAAAAAATGGGAACTTAAGTTAAAGTAAGAACTT
ATTTTTTTTTAAATTTATGATTTAAACTTAGGATTTTTCATTGCAAAATATAAATAGGCA
TATGTTATGAATCCTAAGAGTATGCCAAGGAGCTAACTTTTAGGTCTTATGAATAATGAC
ACAAGAGAATTCACTGAAGGTGTTTTAACTAGCAGTGCAAGAGAAGTCATTAAAGAATCA
AGTGATGTCATTAGTTGGATTATTTGTGATGGTGATATTGACCCTGAATGGATTGAATCA
CTTAACTCTGTCCTCGATGACAATCATTTACTCACACTACCTACTGGTAATTAATTACTT
AAAATTTTATTTAATTTAATAAATAAATTTATTATCTGCTATGTATGTATTTAATTAAAT
ATTATATTTCATATAATTCTAATAGGTGAGCGTATTAGCTTCTAAGATAATGTCAATTTT
ATTTTTGAAACAAATGATTTACAATACGCATCTCCAGCTACTGTTTCTAGAATGGGTATG
ATTTTCTTAAACTAGGAAGATATTAGCATTAAATCAGTAGTCAATAAATGGGTAAAGAGA
TAGAAAGAAGAATTATAAGCTAAGTTAGAAAATCTTTTAGAAGAATATTTCTATAAGATT
CTTTAGTTTGTTCAACAATTTGAAGAAGAGTAAGTAGTTTAGACAACTAGAATTGGTTTA
GTTATGAATGTCCTTTCTTAGCTTACTTCTATCCAAAGCAAGAGTGAATTTGTTACTTAA
ATGTTAAGAGGTTTTTGCAGTAATTTCTCCTTACAGATTAGAGTAAAAATTGCAAATGAA
ATATTTTCTTTGTCTGGAGATAAACCTCCTTGTGATCTTAATAATTCACCATTAGATTTT
GTTTGCATTAACGGATCTCTAAGAGTACTTTATTTTACTTTTAAAAAAATTTAAATAAAT
TCATTTTTGATTTAACGTAAAGCCACTTTCTATCCTTTCTTAAGACATCAATCTGAATGA
CTTTGCTGATAGTGAAGAACCACCAATCATATAAACAATTGGTAAGGAAATTTGAGTCAT
TAGTTAAGATATTAATCACTTTTTTATATAGGTCTTCAAAGAGATTTTGAAGTTTTAAAG
CCATGGATTTTAAATTGTGAACCTTTTATTGTTTGTGGTCCTGAAGGAAGTGGAAAGAGT
TTGTTGATTAGGGCAGCTTTTAATGAGCTTAGAAAATAATAAAAAATTTAAGTTGCTACA
ATCTATTGTAACGCTTAAACTACTGCAGCATAAATAATTCAAAAGCTTAATCAAATTTGT
ATGAAGGGTACTTTTTCTCAAGGAAGAATTCTTAAGCCAAAGGATGCCAGTAGATTAGTT
TTATACCTCAAAGATATTAACTTACCCAAACCAGATAAATATCAAACTATATAACTCATA
GCTTTCTTGCAATAAATTATTACTCACAAAGGTTATTATGATGAATAATTAGAGTTTGTT
TACCTTGACGAAAAAATTTAGATTGTTGCTTCTATGGCACCTTCTTCAACTATAGGTAGA
CATGAAATTTCTACTAGATTTACTGCTAACGCTCGTATACATTACATATAATATCCTTCA
AAAGAAGAATTAATGCACACATACACTGAATATTCAAAGGCTATTTTCCAAAGCGAAAAA
GTTCGCATTGAAAAAAATTAGGCAGCATAAATTGGTAAATTTTTTTAAGCAATTTCAATC
AAATTTTTCATTAAAAATTCAAAAAAATTTTTTTAAATTAAATTTTTTTATTATATTTTG
AATAGCTAAAAAATTCAGTTTAGTTTTAATTGATTTCTACACAAATTTCGCAAGTAAATT
TAACGTTGATGAGCACAGACACTACAGCTTTACCCCTAGAAATTTAACTTAAATAGTTTT
TGGTATGTTGAGATATGAAATCGGTTAGAGCAATCCAGATTCTATAGGTGAAGCCTTATA
TAATGAAATATCAAAGAGATTCAGAGATAGATTAGTAAACTTTGAATAATAAAATAAATT
CGATGCTTTCGTTGGCTCTTTACTTCGCTCACATTTATCATATTAGGTTACTCCTAACAT
TTTCTTTAGCTCTGTTGGAGGGTAAAAGCAATTAACTAGATTAGAGAAAAAAGATTATAT
TGTTGCAATCAATTAAGGTTTGCTCATGTATGAAAGAGAATTTAAAGAGATGAAACTTCA
CTTATTAGATGAAGTCCTATCTCTTTTATCAAGTAATTAAACAAAAACAACTTTTATTTG
AAATAAATTATATAAAATAAAATTTTAACAGGTCTTGATAGATGCTTAAGCTAAAGTGGC
AGTGTTTTACTCGCTGGTAGAAGTGGTATAGGAAGAAAAAGTTGTATTAGTCTTATGGCT
ACTATGCTAAGAATGGAAATAGTCAGTCCTAGCACAAGCAGAGATTATAGCACAAGAGAG
TTTAAAAAAGAACTTAAGATTTTCTTAGAAAAAGCAGCAGCTTAAAATAAATAAGTAATT
TTATATATTGAAGATCATCATTTAGTAAAATCTGAGTTTTTGGAATTACTCAACTCATTG
ATTTCAAGTGGTGAAATTCCAGGTCTCTTTACTTAAGATGAAGTGGATCATTCCTTCTAA
AATGCTGACGAAGTCCGTAGAGAAAACTATGGAAGATCTTTATATGATATTTTCTGTATG
AGAGTTAGGTAATTAATTCATTTAAATAAACAATAAATAAATTAACAAAATCATTAATAA
TTTTATTAATCTTTCACAAGCTTATTTTAATAACTCTCAATTTAATTTTAATTAGATAAA
ATCTAAGAGTTGTTTTAAGCATGGATCATTCCGAGGAGACATTTGCAGCTAATTGTGCTT
CTAATCCAGCATTCTTTACTAAATGTACAGTCATATGGTTAAATAACTGGTAAAAAATTT
TTTAATTTTTATCAATTAAATATAATTTATCAGCATTTTTGATAGAATCATCATAAATAG
CCAAATTATTCATGATTTTTCTATTAAATTTTTTTGGAATTTTAAAAATTTAAAGATAAA
TATCAAAATATGATTTTCTCTATTCATTTTTCACTTTTGGCTAGATTATATTGTCACTAT
TTAAAATCTAATAATATTTAATGCTTATTGATCATCTTAAGAAAATATTATAACTTTTAA
TTAAACTTAATTTTTAGATTCATACTTAATCATTATCATTAAATTTATTTAAATAAATGT
TAAAATAACTAACTAAATTAGGAGCAAAGAATCTATGTCAGTGATTATGAAAGAAGAATT
AAAAGAAATGCTTGAAAATTTCCCTGCAAAAGAAAAAGAAGATATTGCCAGTTACTTTAT
CAATATACACAAGTATGGTTTAGATAACTCTCGTGCTTCGCCATCTCATTTATTTGCTTT
GGCTCATACTTATTCTAAAATTTATCAAAAGAAAGTTAATTCAAGAGGCAGCTAGGTAAT
TTTTCAAATAATTTGAAATAATCATTTATCTTATTATATTATTATTTAATATATAGAGCT
CTCACTTGAAGAAGGGTTTAGGTAAACTTTAAGAAGCAAAAGAATTGGTAGATGTCTTAT
AAAAGCAAGCTTAAGTCAAAAAGTAAGAGTTAGCTGTAAAGCAAAAAGAAGCAGACAACG
CCTTGGTATTAATTAGTAAAGCTATGTAAAATGCTGCAGAAAGAAAGGCTGAGTGTGAAA
AAATTTAAGAATATTTACAAAGTGAAGAAGGAAAGATACAAGATTAAAGGATGGAAGTCC
AAAGATAGCTCCAAGAAGTCGAAGTAATTTATCAAAATAAATCTTTTTTTTGATTTTACT
CTAGCAAATCAGAAAATTTTGATTTAAATTTTATTTTTTTGCTAAGTTTCACTTTATTTA
AAAAAAATAATGGTTTTAAAATAATATTTTTTAACCTTAAAAAAAGCCTTTAATTCAATC
TGCCAAAAAATCTGTAGACAATATTAGCAAAAGTGATTTAGATTTCTTAAGAAATTTGAT
GATGCCTCCTCCTGTTATTCACAATATCATGAAAGGTGTCTTAAGGGTCTTCAATATTTC
AGATGTTGAGAAATGGTAAACTGTTAGATAGTTTTTAAGTAATAGGTAGGTATTAGAATA
AATTATTAACTTTGATCCTGATATTATTACTCCATAAGTTAGAAGAGGTGTTTAGGCCCA
AATTATGGAAAGTGAATCATCTTTCAGAAAAGAAGTTTCTTATAATGCTTCAAAAGCTGC
TGGTCCTATGGCTGATTGGACTATTGCAGTACTTAAGTATAGTGAAGTAAATGAAAAAGT
TATTCCTCTTAAAAATAATCTTAAAGCAATTGATTCAAAGCTGAATGCTAGTAGACAAAA
ACTTTAAGAAAATGAAAATGAGCTTCAAAAATTAGAAGGAAAGGTAGAATAATTGAAGTA
AGACTTTGCTTCAAAGACTTCTTCAGCAGAAATATTGAAAAACGAACTAAAGAAATAAGA
AGAAACATTAGCTGTGGCCTCTTAACTTCTTGATAAATTAGGTGATGAAAAGGTTCGTTG
GGAAGCTCAAGCTTAATCTATTGAAAAAGAATTCAAAAGTTTCCCAGTAGAGAGTTTACT
TGCTGCTGGTTTTACAATCTATTTAAGTGAAAATGATGAAAATTAAAGAGAAAAGGCAAT
ATAAGAATGGAAATAAATGACCAAATCTCAGACTTTTAATTACTTGAAATTCCTAAGTAG
CGAAGGTTAAATGCTTAAGTGGAAGAGTGAGGGTTTACCTGGTGACTCTCTCAGTTTAGA
AAACAGTGTTATGATCTTCCATTCTAGTAAGACTCCTTTGTTGATTGATCCTAATACTTA
AGCTACTGAGTGGCTCAAGAAAAATTTAGGAACTATCGAAGTCTTAAATCAACAAGACCC
TAAATTCTCTAATCAACTCGAATTATCAGTATTTACATTTTAAATTTGCAATTCCCTTTA
ATTAACTTAACTTAAATTCATTTTTTTAAATGCTTATTAACTAAAATTACTTAATTGAAT
AAAGGTTCTTTTCGGAAAAACTTTACTGATTTAAGAATTAGATAAAATAGAACCTATTTT
AGTACCTATTTTGAGAAAAGATTTAGTCCACTAAGGTCCTAGATGGGTTGTTATGATTGG
CGATAAATATGTTAACTATAATGAGAATTTCAAGCTTTATTTATGTACAAGAAATAGCGG
TATTGAAATAAATGCAAATACAAGTGCTTTGGTAAGTATAATAAACTACACAGTCACCAA
GAGTGGTTTGGAAGGTAAACTGTTGAGTATAATTATTAACCACGAATAGCCAGATCTAGA
AAAAAGAAAATAAGAGCTCTTAGAGAATGAAGAAAAACTCAAAATACAACTAGAAGAGTT
AGAAAAGACACTTTTAGAAGAATTGGCAAGTTCAACAGGTATTTTTTTATAAATTAATTA
AATCGTTTTAGCTAAATTTTATTAATTTGTTTTTTTATTAATTTTTAGGTAACATCCTTG
AAAATTCTGTGCTTATTGAGAGTTTAAATCAAACTAAGTAAAAGAGTTAGACTATTGAAG
TTAGTTTAAAGGAAAGTACAAAATTATAAGAAAACCTAGATCAATAAAGAGAAGTCTATA
GAAATCTTGCAGTCAAGGGTGCTTAACTTTTCATAAGTATAGGTGACTTAAAGAAAATCA
ATAATATGTACAGGTTCTCTTTGAATTACTTCATAAAGCTTTTCAAAATTTGCCTAAATG
TTAAAGAATAATTCCCCAATATGCAAGCTAAACTCCAATTCTGTGCAGTCAATCTAAATA
GAATTATCTTTAATAATGTTGCAAGCTCGCTATTTAAACACGATAGACTTATGTTTGGTC
TTCATATTGTTCACGACATATATCCTGAGTATTTCTAACAAAGCGAATGGGATTTCTTGT
TAGGAAACACTGGTAAAATTAATTTTATTTAAGAAAATAATATATATTTATTATTAAATT
TATAAATCAGCTCTAGCAATTGAAAGCAACTTGTAATTACCTAAATGGGCTAACCCTGAC
TGCAAAGATCAATATGCAGTATTTGTCAATAGTTTTGGAAAACTTTGCAACAATATTAAC
TTCAATGATAGAGAGTGGGAATAATGGAGCAAGGAATTGCAATGTGAAAGAGTTTTCCCC
TAAGCCTATGCAAGCAAATTAACTCAATTTTAGAAAGTATTGTTTGTTCAAGTTTTCAGA
CCTGAAAGATTGCAATCTGCTTTGAATGATTTTGTATGCTAGTCATTGCAAATATCTTCA
ATTAGTGGAAATCCATTCTCTTTTAATTCCATCTATTAATAGGAGACATCCACCTAAACT
CCTGCCTTGTTTGTTGTTTCTCCCGGTTCTGATCCTTCTGCAGAATTAGAAGAATATGCT
GAGTAATAAATTGGCAGAGAAAACTTCTAAGAAATGTCCATGGGTGGTAACCAAAATGAC
GTAGCTCTAGAAAAACTAAGAGAAGTAAAAAAAATCTTACATTCAATGCTAGTATTAAAA
AAATTTATTAAATAAAAAAGGCTGCAAACAAAGGATATTGGCTTTGTCTTAAAAACTTAC
ATTTAGTCACAGCATGGCTTCCAATTTTAGAAAAAGAATTAAAAACTCTAACACCTCACT
AGAATTTCAGGTAAATAAAAAAAATTCCAAGGTTTTTCATAATCATCAATTAATTTTATT
TAAAAAGATTATGGCTTACAACTGAAGCTCATATTAAATTCCCAGCTATCTTACTAGAAA
CCTGCTACAAGGTATCTTATGAATCTCCACCTGGTCTTAAAAAGAACGTTGAAAGAATCT
ACAGCAGTTGGAGTCCCTAATACATTGCCAAGGGTTCTGCTTAGAGAGCTTAATTGTTAT
TCCTTTTAGCTTGGTTCCATGCTATTTTACAAGAAAGAAGAACCTATATTCCTTAAGGTT
GGTCTAAGTTCTATGAGTTTTCATATGGTGATTTGAGAGTAATTGTTTTAAATTTTTTAT
TAATTTTTAAATATTTTCTAGCTCCACTTAGATTTGAATTTAAAAGCTCCAAGATTAATT
GTTTTTAATTTTATGGTTTCTAATAATTTGTTTTTATGTATATATAGGCTGGTACTTAAA
TTATTGAAGGACTTGTTTAGGACACCTAATAGAAAGGAATAAGTTGGGAAACTCTTTATG
GGTTATTTGAAAATGCAATTTATGGAGGTAGAATTGATGAGGCTTTTGATATGAGAGTAT
TGAGATCCTACATCGAATTGTATTTCAATAATAATATTCTTAAAGGTTCTGCTAGAATAC
CTACTGGTGATACTCTCCCACAAAGTACTAATTTGCCTGATTACTTGGCAATAGTTAAGA
AGATGAGTGAAACTGATACTCCCTCTATTTTTGGTTTACCTCTAAATATTGATAAGGCAG
TTTAAAGATATAATACTTAACAGGTTATTTCTAATCTTAAGATTATCATGCAAGCAAGTG
CTGAGGATCTTAAATTTGATAAGGAAAAATGGTAGAAATAACTTGGAACAATTATAAATC
TTTGGAAAAATCTTTATAAGCAGTTCCGTGAAGGAAGTGGTTTACCTTAAATTAAACCTT
AAAATCTAACTTCAACAGACCCTATAGAATCATTTGTTTACCTAGAAGCTTCATCAGCAT
ACTAAATGCTTGAAAAAATTGAAAGCTCAATTGAGGGTTTGAATAAAGTAAATTAAAAAT
TTATTTTATCTTAAAGATTTTATTAAAATTTTTTAAATTCATAGGTTTTGTTTGGAAATG
GTTTATTAACTAGCGAAATACAAGCAACAGGTATGGAACTCATGCTTGGTAATGTTCCTG
AAAAATGGAGTAAAGTTTGGGAAGGACCTGATAACGCTAATAGCTGGCTTAAGGGATTCT
GCTCAAGAGTTTATCAACTTAAGAAATGGGTAGAAACCTTAAGAAACGGTAGTCTTCTTG
ACAGTCCACTCAATTTATCTGACCTTTTCCACCCCGAAATTTTCTTAAACGCTTTAAGAT
AGAAAACAGCAAGAAAAATAAGCAAACCCCTTAATGACCTTAAAATAGTTACATCATTCG
ATTAATCAAAAATCAGCACTGCCATTACCATAAAAGTATATTTAAAGATAAAGTGATAAA
TAGATTATTAAATACTCTTTTTTAAAATTAGATAAAAAATCTTTTACTTTAAGGTTGCTA
GATTAACTAAGGACATCTTATTGATGGAGCCTAAGATCTTCCTGAATTCGTTTAACTACC
TGAATTATATATTGGATTTATCCCTAAAGATGAATAAGATCCTTACCCCTCTAATACTTT
AGGAGTAATACAAATATTTTTTTAAATAATTTTAGTATTTACGTTTTTTTATCATAAATA
ATAGGAATTCCCAATATTCTCAAGTAGCCAAAGAGAAAAACTTGTAGCAAAAATAAAAAT
ACCAGTACAAGGAAGTCTAAACGATAGAATAATTGCTGGTGTTGCATTTGTTTTATAAAA
TAATTGA