Identifiers and Description

Gene Model Identifier

TTHERM_00047540

Standard Name

DYH18 (DYnein Heavy chain 18)

Aliases

PreTt11233 | 3.m01885 | 3824.m02991

Description

Dynein heavy chain family protein; heavy chain subunit of ciliary single-headed inner arm dynein (IA)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00047540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_283520
Tetrahymena borealisEI9_01698.19.997093137033517e-262dynein heavy chain family prot
ein (4125 aa)
OxytrichaContig2564.0.g1059.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
DictyBaseDDB_G02763552.0006373583905387e-170dhcA on chromosome: 2 position
6681538 to 6695830
WormBaseWBGene000009623.998345761652816e-169locus:dhc-1 Dynein heavy cha
in, cytoplasmic status:Parti
ally_confirmed UniProt:Q1902
0 protein_id:CCD64267.1
SGDYKR054C8.001307376279851e-107DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00047540(coding)
ATGAAAAGGAAGAACAATTCTTTCCATCTTGGATAAAATTAGCGTTATCCTTCGCCTACA
TAAAATAACAAGCTTTAAAATGATGGAATTTAAATGAATAATTAGAATTCTACATAACTG
CCTGAACATTCAGTTGCACATCGCATTTATAGATAAGCAATCGAAGAAGAGTTTTAGGAA
AAAATATAAAAAAGTGTCGAGCTCGTTCAAGGATAAAATAAGTAAAGCTTTTTAAGGAAC
AGATATAATAAAGAGAAATTTTAAATGCAGCCCTCTATTTAATTATAAACATAAAGTGTA
AATACAGGTTCAAAATAGTTGACTAATTCATCTTCTATTGTAAATCTAAATACCATTATT
AACTCAAATGTATAATCAATCGTACAAGTGGATAAACTAAATTAGAATTCAATTTAAATA
TTAGATAATTCGTAATAGTAAATTAAACCATAAACCAACTTATCACCTAATAGTGATAAT
AAATCAGTTTTACCTATTGTAAGGCATAAGACAAGTTTTTCATTAGATAAAGCAGCCTTA
ATAGGGCCATCAAAGGAGCATTTTCCAACTCTTGTACCAAAAGTTTAACTAAGAGATAGA
TCTGAATCTAGAAAGAGAGTTATATCATCAAGCAATTTGTCTTTCAGTATATAAGATTAA
CTCATCCCTGGATAACCTTCACCATCTAAAAAATTAAATAAAAAATCAAAATAAAGTGGA
TTAGATGACAGCATTTATATTGATGAAGAAAATATGAATGTACCTTCAAACTATCGTGTT
AAGACAGAATTATCTACAATTTCTTAAAACCAAGAAAGATATGATTTATTGAATACTTCA
TTAAGAGTAAAAACTTAGCCTTAGAATAACTAGCGTCTTTATATTGCTAACAACCCAAAT
AATAAATTTTAGATAATAAACGAGTAAGAAATGATATAATCAGTACAACTTTAACAGTAA
GAAAATTAGGCATTGTTTTAACAAAAAAGAAATTTGAAATTCCAAAAAGTAGATCCTTCA
CAAATATAATCAGAAAAGAAGGAAAATAAAAATCTAGAGCAACAAGAACATGAAAGAATA
AGATCATTCAGTACTTCAGTTAATTAAAATGATAAATAAATTTAAATAGATGAATAAAAG
TAGACAAGAACAGAAATATATCCAAGAAAAAGAAACCAAAGCATAATTTAAGAGGAAGAT
GATTTAGATTAGTAGTTTAGCTAAAATCTTTAAGGCGGAGCAAGCATAATGATATAAAAT
AATTCACATAATTAATCCAAAATTTTGGGTGGAGGACATTCAAAATAATAAAATAATCCT
TCTAAAATGTCATAACACTAATAAGATTTTTAGAAAAAAACAATTTCAGATTAGAACTAC
TAAGAATACATGCAATAATTACAAAAAAAGTAGCCTTTCTTTAATGATTATTTATCTCCT
ATAGATTTCATTTCTTTGATAAGAACTGACGCGGAAATGAAAGACGAGTTTTGTTATTTA
AATTAAATTGGTTTGAATTGTTATGATTGGAAAATTGTTCCTTTTTCAGAAAGAAACCCA
CAAAATTATATGACAATATCTAGAAGAGGTATAGTACATTTCAAAGAGAGTGAAGTGAGA
TTTATGAGACTTGATGAGTGGGAAAGAGAACATGAATTGTATCATAATACAGCTAATATT
CATTTCTTTAAAACTTTCAGGATGTGGAAAAACTTCTTTTTATGGAAAAAACTCATGAAA
AGAAATATTATGAAGGAGTGTTCAAAGATTTTAGAGTATAAATTATTATTATTAGATCCT
GTTATGAGAGAATCGCTTATTAAGATTAGGTCTGAATGTATTGAATAGAAATAAGCTTTG
TTTTTTGATGTTAAATTTACTTAACCTGTCAAATTTGACGAATTTAAGGTAAAAGCTGAG
AATTACAGGAAAAATCATTTAGTAAATTAAGTCAACTCTCACTAATCTATAATTATGAAT
ATTATTTAAGCTGCATGCGATTTTTCATTGAAGAAATTCAAAAGGGATTTCCGTATTCCT
AATAAAGATGAAGATATTTCTGATATATCTAATTTTTAAAATATAAAATAAAAAGCAGGT
ATGCTAATTGGAGACTCTGAATATAGAGATATGCCATATGCAGCTGAAGCTACTCTTAAA
ATACACTAAAAAAAGCTTAAGAATTTCACTAAATGCATAGATTATATCGTCTTAGAATCT
AAGTTACAATTAGTTTAATTTGCAACTGATAATTTAGCAACAAAAATAGAAAATTTTAAC
AGGTATATGTAAGATGAAAATTTCAATATAATTGAACATATCAGTTGGATACAATGTATT
GCTTCTGAATGTGAAAATAAGCTCAGTCTTTTTCCCTCAGAAGTTGAGTTTAAAGATGAA
TTCGATGAAATCGTAAGAGCAGCAATTTAGGATTTAATAAATGATCATATTTAATTTGCC
CTAAGAGGCGAGATTCTTGAATATTTATAAAGTAAAGATTTAGATTTTATTGAATTAGCA
TAAGAAAAAATAAATCTAAGTCATCTCATTTATCATGATGAATAATTTGTTAACAATTTA
AGAAGAGTTCAAGAAGCCGTGGATATAGCTTATAAATAAATATATAAATAAAGCCTGAAA
TTAGTTAAACCTCTTGAAATCTATTAAGAGCATCAAAATATAAATCCTTAAATTTATGAT
GACATGGAATCAGAGTAATTAAGTGAAGTAATTGAGAAATATTAGCACGATGACTAATAT
TTATGCTCTTTGAAAGTAGAAGAAGAGCAAGGTATATTTTTCTTTGATATAAATCCGATC
AAAGAAACACTAAAAAATTCTGCATAATCCAGCTTAAAAGTTTTGTTTGAAAAAATGCCT
ACCATAACAATTATGAGAGCATACGATTTTAATAAGATTACAGATGAATATTTAAATTTA
GTCATTAAAAATCCTTAAACATTAGATTAATTTGTGGTTTTCTTAAAAAATTATAAATTT
GTGGAGGCAAAAATAAATGATTTAGGCTTAAGATGTAGTGAAATTTTAAATTTATACTAT
TTAGGAATGAAGAATAAAGTAGTGTTTGTTGAAAAAGATCACTAGACAATTATTTCTTCA
TAATCTCACTTGCACACTCTCAGATCTAGAATAGAAGAAATTGAAAATTTGATGAATTCT
TTTGTAGCTAATTTTAAGGAAGATTTAAAGAATTTATTACCTGGATTTCATGAAACAGTT
AAGCAATATAAATTTAAATTTGACTATTCTAATGTCTTTGAAAAAGAGACAAATTTAGAA
AAATCTATTGATTTTTTATTGAGCATAGAATAAGGCATTAAAGATTTGTATGACTAAAAG
CTAAAAATAATGTCTTATGAAGAAGCTTTAGAGATTTTTGTTGATAATCAAACAAATTTT
GATAGTCTTGATTCTCTTTATCAGTAATATAATTTAGTCTATGCAGTTTTATCTAACAAG
AAAGAATGGATATTTAGATATTCATTATGGGAATCCTAACATTTCTTGTAAATAGATTTG
AATGATATGGGTTAGCTTTTAGATTAATGTAATAAAGCAGCAATTAATTATATGAAAGAA
TTAGACAAAGGAAATATAGCTATAGATCTGAAAGAAAAAGTTGAAGTATACAAAGATTTT
CACTTTTGCTTGATGAATTTAAGATCAGAAAGTATTGGTCAGCCTTAATGGGCAGAAATA
AGAGAAATTATATTAAAGGATATAAATAATGATGATCATTCATTTTTTAAAAAATTTGAA
TTAATAAATAAATCTGACCTATTTTCTTCTGTGTAAGCTAATAAATACAAGCTTAAATAT
CTGTTTGATCTTAAAATATACCTATTTAATGAGTAAATTAATGACATAGCATTGAGATCT
GAAAAAGAAAGAGAATTACTCAAAATTATTGAATAAGTCGAAGAGTTTTGGAAATTTTCT
AAATTAGGGTTTTTACCTTACAAAGAAAATGAAATATTTATTTTAGGAAGCAATATTGAA
TTAATTGATAAAATTGATGATAACATTACTGCATTAACAAATTTGCTAGGAAATAGGTAC
ATTAGCAATTTAAAACTCAGAGTTGAGAGATAATATATGCTTTTTAAATATGTTTAGGAA
TTGCTTGATGAGTGGATGCTTCATTAAAAGAATTGGCTTTATTTAAAGCCTATTATGTCG
ACTGGATATGCTTAAAAACATCTCAGTAAAGAGTGTTAAAAATTCTAAAATTGTGATTAA
ATTTGGAAAAAATTTATGAAATAGGCAAAAGAATTGCCCTTAATTAGAAGATTAGCAGAT
GATTTTAGGAGCCAATTTTTAATGAAGCCTCTTAAATAAAACAATCTGCACTTTGATTAA
ATTTAGAAAGCTTTAGATGAATTTTTAGATTAAAAAAGAGAAGCTTTCTAGCGTTTTTTC
TTCTTGTCAAATGATGAATTACTTGAAATACTATCAACAGTAAAAACACCTTAGTAAGTT
GTTCCACATCTAAGAAAATTATTTGAAAATATAGACGACATAGAAATTGAAGGCCAAAAT
GCAAGGAAAATGATATCTTAAGAAGGCGAAAAAGTTATTTTGAAATACTGCATATTGAAG
GGAGAAGTTGAGGAGTGGCTTTAAATGATTTTAGATTAGATGAAGTATTCTCTCTCACAT
CTTTTTTTGAATTGCTTAATTAGATATGAATAAGAAAAAATGACTTTACCGAAATGGATA
CCCGAATTCCCTAATTAAGTAATTCTGACAGTAAATAGAATGTAGTGGACTTATATCTCT
GAGGATTACTTAGATCCAGAAAATCCATAAGATCTTGGTGAATGGCATTACTCCTTAGTA
CTATAACTTGAGGATATAACTGGTATGATCAAGCAAAAATTAGAGAAATCTGAAAGGAGA
AAGATTGTTGCTTTAGTCACCTAAATGGTGCATTTTAGAGATATAGTAGAAGATATGTGC
TTGAGTGAAACTAGAGTAACAACAAATGACTTTAAATGGGCTCAGTAACTTAAATTCTAT
GAAGAAGATAATGCTATCATCGCTAAATAAGTTGAAAGTAAATTATACTATGGATACGAG
TATATGGGAGCTACTACTAGATTGGTTATAACTCCACTTACTGAGCGCTGTTGGATAACA
ATTACTGGAGCACTTCACATTAAATTAGGTGCTAATCCCACAGGTCCTGCAGGTACAGGT
AAAACTGAAAGTTGTAAAGACTTAGCAAAAGCCTTAGGAAGGTATTGCATAGTCTTTAAT
TGCAGTGAATAAGTTAATGTTAAGATTATGGAATAACTTTTCACTGGATTATCGTACACA
GGTGCATGGGCATGCTTGGATGAGTTTAATAGAATTGACATTGAAGTACTTTCAGTCATT
GCTTCTTAAGTGCTAACGATAAGGCAAGCTTTGCTTCAAGATAAAAATCAATTCTTATTT
TATGGAAAAAATGTAAACCTCGATAAAAATTTGGGAATATTTATTACTATGAATCCAGGA
TATGCTGGGAGAACAGAATTACCTGATAATTTAAAGAGTTTATTCAGACCTGTTTCAATG
ATGGTTCCAGATTACACTCTTATAGCAGAAATCATGTTGTATTCAGAAGGTTTTTCTAAT
GCCAAAGACCTTTCTAAAAAAATGACCAAATTATATAAACTTTCTAGTGAGTAATTAAGC
CAGTAAGATCACTATGACTTTGGTATGAGAGCTGTTAAGAGTGTTTTAGTAATGGCTGGT
GCTTTGAAAAGATCACACCCTAATATACCAGAAGATGTACTACTTATCAAAGCTATGAGA
GACAGTAATGTCCCTAAGTTTTTGAACTAAGATCTGCCTCTTTTCGATGCTATACTTTAG
GATTTATTTCCTAATTTAAATCTACCAAGCACTGACAATAAGCAGCTATCTGATTATTCA
GAAAAAGAAATGATAAAATGTGGGTTAAAAGAAAGCAAAAAATTTATTGAAAAGGTTATA
TAAACACATCAAATTATTAATGTTAGATTTGGCATTATGGTAATAGGACCAACAATGAGT
GGAAAGTCGAGTATCTTAAAAATTTTGAATAGAGCTTACACAAACAGTAAAGAGTATCAA
TAAACGAATAACTCAAATTCTATTCTGTCAAGTTAAGAGCAACTAATTAAATACCCAGAA
GTAATTTCTAGGACTGTTAATCCTAAAGCGATTGATTTAAATGAGCTCTATGGCGATTTT
GATTAAGTTACTTAAAGTTGGAATGATGGTTTGGTGAGTAAAATTATAAGAGAATATGTA
GACGAAACTGCTGGAGAAACAATTCAAGAAAAGTTATCCAAGATGGAAAATGAGCTCAAG
CGAAAAGAGAGTTTTAATTAGGATAATCTACAGACTTCTGCTTGGGAAGAAAGCAAAAGA
TCTTCAATTTTAAATGTCTCAGCAACCTAAGCCAGCATCATTTCTTCACCTAGTTAAAAA
AGATCAGATAGAGAATAATAAAAATGGATAGTTTTTGATGGACCTGTTGATGCTTTGTGG
ATTGAAAATATGAATAGTGTATTAGATGATTCTATGACATTATGCTTATCAAATGGTGAG
AGAATTAAACTTAAACCAAATATCAAAATGGTTTTTGAAGTTACAGATTTATCATATGCA
TCACCCGCAACAGTTTCAAGATGCGGAATGGTTTACGTTGATTAAGGAGTTATTGACACA
TTTTTAATTACAGATAGCTATATTGAAAAGGAATTACCTGAAAAATTAGATTAAGAATAA
ATAGATTTTGTAAAGACTCTTGTAAAATAATGTATTGTCAATGGATTGGATTACTTAAGT
AGATAATGTAAATATATTATTCAGGTATCTGAATAGATTTTAGCATTGTCACTCTGCAGA
TTGATCAAAGTTTACATATTCCAAGAGAAAGAAGATCTAAAGGAAAAGGGAATGCTTATT
AAAAAGGTAATTGAGAAAATAGTATTGTTTTGCTATTATTGGACAACTTATACTTTGATC
CACATTGAAGCACTTCCCAGATATGATAGACACTTAGGAGAAATATTTTCGGCTGATATT
GTTAGAGCTAATATGTATGATTACCTACTCAAAGTATAAGGATATGAAGCTGAGTTATAT
CACTGGGATTTGCAAATGGAATAGTTTTAATACAGAAAAGGGATGAGTTTTTATGAGATG
ACAGTCTAAACAAAAGAAACTATTTGTGTTTCATATTTTTTGCAATTGTTCTTGTTCTAA
CAGTAATCAATTTTTGTTACAGGAGAAACAGGAACTGGGAAGACAGTTATCATAGATAAC
TTTATCAAGAAATTGTCTTCAAAAGAAAAGCATGTCACTATCCAACTCAACTTTTCCAGC
GAAACAAAGACTCTAAATGTTTAAAATACGATAGAATCTAAGCTCATTCAATAGAGAAGG
CACTAAAAGCTCTTTTTGGAACCACCTCCAGGAAAGAAAATGATAGTTTTTATAGATGAT
GTGAATATGCCTAAGGTCGAAAAGTATGGAGCATAACCAGTTATAGAGCTATTAAGAGTT
TTATAAGAAAATAAGGGACTTTACGAAAGAAAATCTTTAGTTTGGAGATCTATCTCTTCG
ACATCTTTAGTTATAGCTGGAGGAATGCCTGGAGGAGGAAGATCTAATTTGTCAACAAGA
TTTTTAAGATATTTTAATATAATTAATCTCAATTAATATTCAGAAGACTCTATGGTTTCT
ATCTTTTCTAATATATTAAAAACTATTAAGTATAATTATACATTTAATAATTAAATAAAT
GATTTGATAGATAGAGGTGTTATTGTTAAGATTACAATTTAATTATTTCAACATATTTAA
TAAGAATTACTCCCTACACCATAAAAGTGTCATTACATTTTTAATATGAGGGATATTGCT
AAAATATTTTAAGGAATGTTAATGATTAGAGCTTAAACAGTAAATACAAAAGAGAATTTT
GGTAAGCTGTGGCTCCATGAGTGTTGTAGAGTATTCATGGATAGATTAGTAAGTATTAAA
GATATTGAATGGTTCTAGGAGTTAGCATCAAAGCTGATTTTTTTTAACTTTCAATTTGAA
GTGAAAAATGTTTTTCAATTCTTCGACTCTCTTTCATTTTCTCCTGTTTACAAATCTGAC
TCATACGAATATGTCTCAGACGCGGCCGCCTACAAAAAAAGAATTGAAGAGGTGATGAAT
ACTAAAACATCTATGAATTTAGTTCTCTTTAGTCATACTATTTAGCATATCACTAGGATG
GCAAGAGTGCTTCATTAAGAAAGAGGCCACTTCATGAGTGTAGCTGTTGGTGGCTCAGGA
AAAAAATCTTTATCAATTTTATCAGCTCTCCTAACTGAAATGCCATACTCTTAGATTATG
CTTAAATAAAATTATGGTATGAAGGATTTTCATGATTTACTTTTAAAGACTATGAAGGAA
GTTGCTTTTAAAAATTAAAATTAAATACTTCTCATAATGGACAATTAAATTGTTAAAGAA
TAATTCCTTGAAGAAATAAATAACATTATGAATTCTGGTGAAGTTCCGGGTATAATAACT
AAAGAAGAGTTAGAAATTATTGAAGATAACTTAAAAAGTGATGCAAAACAGTAAGATTCA
AAATTATAAGCTTATGATTTATTTGTTTAGAGAGTTAGGAACAAATTGCATGTTGTTTTA
GGAATGAGTCCAGTTGGAGAGAGTTTTAGAAACAGGATAAGAATGTTTCCAAGTTTAACT
AATTGCTGTACAATTGATTGGTTTTAGCCTTGGCCAGAAGAGGCCTTACTTTAAGTAGCA
ACGAGCTTTTTAGAAAAAGAAAGCAGCTTGACTAAGCTAAGCAAATAAATTTTAGCAAAG
TGCTTTGTCTTTACTCACTAAGTAATTACCCAAAGTATCGAAGATTTTTACAATGTTTGG
AAAAGAAAGGTTTACTCAACGCCAAAGAATTATATTTAAATGATAATGAATTATAGAAAT
CTATTAAGAACACAAAATAATTATCAAACATAATAAAAAAATAAACTTCAAAACGGTTTA
GATAAGTTATAAGAAGCTAACAAAGTTATTGATGTTTTAGAAGAAAAATTAACCAAACTT
TAACCAGAGTTAGTAAAAAAAACAGAGGAAATAGAAATTCTTATTGAAAAATTACAGATA
GATAAGAATGAAGCAAACGAAGCCAAAAAATTAGTTGAAATAGAGGAAAAAATAGTAGAG
TAAAAGGCAGAAGAAATAAAAAAGCTTTAAAATGAAGCGAGTTTGATTCTCAAAAATGCA
ATGCCTTAACTTCATAAAGCAACAGAAGCTCTTAACACTTTAAACAGAAATGATATAAGT
GAAATGAGAGCATAACACAACCCTCACCAACTGGTTAGATTTACGTTGGAATGTGTAGCC
ATTTTACTTGATGAAAAAATGGATTGGGACAATATTAAAAAAATGATGGCTGATACAAAC
TTTTTATAAAGATTGAAAAATCTAAATGTAGAAAAAATTCCAATAAAAATTCAAAAAGAA
ATAAAATCAAGAATATAAAATAACCCTGATTTTAAACCATCTATCGTTAAAACAATTAAT
TATGCTGCTAAATCTATGTGTTCATGGGTAAGAGCCGTGGATAGATTTTAGGATGTCTTT
TATGAGATAACATAAAAAAGAGACTATGTTAAAAAAATGGATGAAGAATATGCAAATGCA
TTTAGTATTTTGAAGTAAAAGAGAGATGAACTTGATAAAATTATATAAAAATTCTAGAAA
TTCGAAAATGAACTACAAAATTCTATAAAATAAAAGGATGATTTAAAAAATGAAATCGAA
TTAACAAAATAACGTTTGATTAATGCAGTTGAATTGAAATCTGGGCTTTCAGATGAAGAA
GAAAGATGGAAAAATAAAATTATAGATTTGGAGAATTCAATTGGTTATTTGCAGGGAAAC
ATGTTTTTAGCAGGTTCTTACATCTGCTATTTTGGTCCTTTCAATGGTGAATTTAGATAA
ATTATTATTGAACAACTGATGGAAAACCTAAAATAAGAAAATATACTTTTCAATGAAAAA
TATAATATTGGGGATGTTCTCGGATACTAAGTTACTATCAGAGATTGGAATCAAAAAGGT
CTCCCAACAGATTTAGTTTCTATAGGAAATGGAATAATAGCACTTAATGAATTTAATTAT
AATAATGATTAGTCATCCTTTCCTTTACTTATTGATCCATAAAATTAAGCTTTAATATGG
TTAAAGCAGATGTTTGGTATTGACAATATTACTATGATTTAGATCAATTCTGATAATCTC
ATCAAAACTGTTGAGATGTGTATAAGAGTGAATAAAATATTATTTATTGAGTAGGTAAAT
GAATAATTCCTTGATCCATAGCTTGATCCAATACTTTTGAAATAATTCGAATATGTAAAT
GGTAGGAAGGTTATTAAATTTAATGGATCTAATCTTGAAATGGCACCAAATTTCAAATTA
TTTATGTTTACTAACCTTGGAAATCCTAATTATCTTCCTGAAGTCTTCATAAGAGCAAAT
GTGATCAACTTTTAGGTAACTGAGCAAGGTCTTGAAGAGCAGCTTTTAGGAGAAGTTTCT
AGTAGAGAAACTCCTGAGCTAGAAAAAGAGAAGCATAATTTAATACTTACAATAGGAAAT
GGTAAAACAACTCTCACTAATATAGAAGACAAGATTTTAGAATTATTAGCTAATAGTTAA
GGAATTATTTTAGATGATAAAGAGTTGATAGATAATCTCAAAAAATCTAAGAAAATATCT
ATTTCAGTTAAGGAGGGTCTTATTTAGAGTGAAATCAAAGAAGAAGAGATAGAAATTGTG
AGAAATTTGTATAGAAAAGTTGCTCGAAGAGGATCAATTTTATTCTTTTGCATATAGAAG
CTCTAATTAATTGATCCCATGTATTAATTTTCTCTAAGCTACTTTAATAGATTATTTATT
CATAACTTGCAAACGTCTCCATAATCAGATGTTCCAGAAGAAAGAGTGGAATTCATCAAA
AATTGTACAACCTCGAATATATTTTAAAATGTTATAAGATCTCTTTTCAACAATCATAAA
AAAATTTTTAGTTTTATGCTATGCACATAGATTGCTTTAGACTCTGGTTTACTCTCTCAC
TAAGAATACAATTATTTAATTTATGGTGACATATATCTTGATAAATTAATTTCATCAATC
TCTGAAGAGCAAGTTACTTTACAAAACTATGTTCCTTAATCAAAATAACTTAAAATATCT
GAAAAACTTTACAAAAATATTCCAAAATTAGAAATTCTTAACCCAATTCTTTTTAGAGGT
TTATGTGAAAAAATGAATTCTTCATTAAAATAATGGAACTATTGGTTAAAATCATAGGAT
CCTTTGTCTAACTTTCCTCCTGGTATTGTAAATGGAGATTTAACACCTATCTAAAAGTTG
CTTCTATTAAAAGCTTTCAGGTCAGATGAATTTGTGTCAGGTATGATGCACTATGTTGCA
TCTGTGCTTGGTCATTAATATGTAGACCATTCACCTGCTTCAATGGAGGAAGTGTTTGTA
GATTCTGATTATACAACTCCTCTAATTTTTATACTTTCTTAAGGTGTTGACCCATTAATT
AAAATAATGAATTTTGCTACAACTAAAGGAATTGATCAAATAAACATGAACATAGTGTCT
TTGGGAAGAGGTTAAGAATAATAAGCTGAAAAAGCTATTCAAGATGGCTTAAAAAATGGA
AAGTGGGTTATTTTGTTAAATTGTCACTTGGGAAAGGGATTTATGAAATAACTTTCTAAG
CTAGTTGAATCAATACCAAATGATCCAAGAATTTAAGTTAAGAAACATAAGGAAACCTTT
AGACTATTTTTAACTTCAATGCCATGTGATTATTTCCCAGTTTCTATTTTATAAAACGGT
ATAAAAATTACAAATGAATCTCCTAAAGGAATAAAAGCAAATCTTTAAAAAACTTATGTT
GAATTACCGTAAAATTGTTTAGATGCTGCTAATGAAATAGGAAATGATAAGTGGAGAAAG
CTCTTGTTTTCATTTTGCTTATTTCATGCAGTAGTATAAGAAAGAAGGAAATTTGGTAGC
TTAGGTTGGAATATTAGTTATGATTTCAATGAAAGTGATCTTCAAACCTCTCTGACTATT
TTAACTAACGTATTAAATACATATGACCGTATACCATGGGAAAATTTATAGTATATAATT
GGAGAGATTACTTATGGTGGCAGAGTTACAGACAATCAAGATAGAATATGTTTGATGTCA
TAATTGCAATAATTTTGTAATCCTTAAGTTATTTAAGATAATCATTAATTTTCTAAAGCA
TATAAATAAATATCCTTTTAAAATGGCACTTCATATACTGACTAACTGAAAGAATACCTA
GATTAGCTTCCAGCTTAAGACTATGCAGATATATTTGGTATGCATGAGAATGCAATTATT
TCATCTAAATTTAATGAAACAAATGAAAGTCTTAAGCTATTTATAGATGCATAACCAAAG
TATTAACAAAGAACTTCAAAGAATTAAGCTAAATCTTAAAGTGAGTAGGAAAAAGATGAG
AATAAGCCTTCTTATATTGTAACTGAGGAAGAGGAGATATTTGATAAATGTAGGTATTTT
GAGAAAAATTTACCTTCTATTATGAAGCATGTTGAGAGAAAACCTAAAAAGCAAAACAAA
CAGCTTTATCTTCTTCAACTCTAATAAGAGCAGTTTATGAGTGAAAAGAAAAAGAAGAAG
CACTATTTAAAAATGAATAAAGAAGAATCACGCTAAACTCGTAAAAATTTTATTGACTCT
TTAGAAATGTGCTTGCAGCAAGAAATAGAAAGGTTCAATAGGCTATTAGAAGTTATGAAA
TAAAGCTTATCAAATTTGAAAAGAGCAATAAAAGGTGAAGTAGTTCTATCTAAAAGGCTT
GAATTAATGTATAACAGCATTTTGCTGAATAGAGTCCCTGAAATCTGGTTAGAGAAAAGC
TATTTATCAATGAGAAGTTTGTCAAGTTGGTTTAGTAATTTGATAGACAGAGTTAATTTT
TTCACAGAATGGCAAAAGGAAAAACCTAAAGCTTTTTGGCTGAGTGCATTTTTCTTCCCA
TAAGGATTTTTAACCTCAGTTTTATAAAACTATGCAAGAAAATACATGGTACCAATCGAC
ACATTAATATTTGATTTTAAATTCATGAACTCCATACCAACAAAAAAATAATAACAAATA
GTTGATAATAATAACTAATAATAAGTTAGAGGGCCTTCTATGACTTAAATAAACCCATAA
GAAATTTACAATGATGAAAGAGAAGAGTTAAAAGCAAAACAAAAGCAAAGACAATTGTAA
CAATAAATTTTACAACAAAAAATTAATGAACTCCTGAAGTAATAAGAAGAGGAGGAAAAA
GAAGAAAACATGGATGGATGTTTAATTTATGGGCTTTATTGTGATGGATGTAGATTCTCT
TCCAGCTTAGATTGTATTGAAGACAATGAAATAGGTATTTTAAATAAATAAGCTCCAGTA
ATTCATTTTATCCCTAAGGAAATAAAATTACTCAGTGAAGCTGAAGTAATAAGACTTCAA
TAAGAAAAATATAGATAAATACAAATATAAAATAGATCAGATAAAGATATAAATAATGAA
GTAGGAATGAAACTTGAAACAAATTAAAGTAATAAGAATTTAATTATTAAAAATAATTCA
TCACTGATAAAAGACAGTTAGTTGCTTGAAGGATAAAAACTTGCTCAATTTACATTTTTA
ATGCCTCTTTACAAAACTGTGTAAAGATCAGGAGTTCTTTCAACAACAGGGCATTCCACA
AATTTTATTATATCAATTTCTGTTCCTACTAAATAACCTTCCTTTTATTGGATTTTAAGA
GGAGCTGCTTTTGTATGTGATCCAGAATCTTGTTGA


>TTHERM_00047540(protein)
MKRKNNSFHLGQNQRYPSPTQNNKLQNDGIQMNNQNSTQLPEHSVAHRIYRQAIEEEFQE
KIQKSVELVQGQNKQSFLRNRYNKEKFQMQPSIQLQTQSVNTGSKQLTNSSSIVNLNTII
NSNVQSIVQVDKLNQNSIQILDNSQQQIKPQTNLSPNSDNKSVLPIVRHKTSFSLDKAAL
IGPSKEHFPTLVPKVQLRDRSESRKRVISSSNLSFSIQDQLIPGQPSPSKKLNKKSKQSG
LDDSIYIDEENMNVPSNYRVKTELSTISQNQERYDLLNTSLRVKTQPQNNQRLYIANNPN
NKFQIINEQEMIQSVQLQQQENQALFQQKRNLKFQKVDPSQIQSEKKENKNLEQQEHERI
RSFSTSVNQNDKQIQIDEQKQTRTEIYPRKRNQSIIQEEDDLDQQFSQNLQGGASIMIQN
NSHNQSKILGGGHSKQQNNPSKMSQHQQDFQKKTISDQNYQEYMQQLQKKQPFFNDYLSP
IDFISLIRTDAEMKDEFCYLNQIGLNCYDWKIVPFSERNPQNYMTISRRGIVHFKESEVR
FMRLDEWEREHELYHNTANIHFFKTFRMWKNFFLWKKLMKRNIMKECSKILEYKLLLLDP
VMRESLIKIRSECIEQKQALFFDVKFTQPVKFDEFKVKAENYRKNHLVNQVNSHQSIIMN
IIQAACDFSLKKFKRDFRIPNKDEDISDISNFQNIKQKAGMLIGDSEYRDMPYAAEATLK
IHQKKLKNFTKCIDYIVLESKLQLVQFATDNLATKIENFNRYMQDENFNIIEHISWIQCI
ASECENKLSLFPSEVEFKDEFDEIVRAAIQDLINDHIQFALRGEILEYLQSKDLDFIELA
QEKINLSHLIYHDEQFVNNLRRVQEAVDIAYKQIYKQSLKLVKPLEIYQEHQNINPQIYD
DMESEQLSEVIEKYQHDDQYLCSLKVEEEQGIFFFDINPIKETLKNSAQSSLKVLFEKMP
TITIMRAYDFNKITDEYLNLVIKNPQTLDQFVVFLKNYKFVEAKINDLGLRCSEILNLYY
LGMKNKVVFVEKDHQTIISSQSHLHTLRSRIEEIENLMNSFVANFKEDLKNLLPGFHETV
KQYKFKFDYSNVFEKETNLEKSIDFLLSIEQGIKDLYDQKLKIMSYEEALEIFVDNQTNF
DSLDSLYQQYNLVYAVLSNKKEWIFRYSLWESQHFLQIDLNDMGQLLDQCNKAAINYMKE
LDKGNIAIDLKEKVEVYKDFHFCLMNLRSESIGQPQWAEIREIILKDINNDDHSFFKKFE
LINKSDLFSSVQANKYKLKYLFDLKIYLFNEQINDIALRSEKERELLKIIEQVEEFWKFS
KLGFLPYKENEIFILGSNIELIDKIDDNITALTNLLGNRYISNLKLRVERQYMLFKYVQE
LLDEWMLHQKNWLYLKPIMSTGYAQKHLSKECQKFQNCDQIWKKFMKQAKELPLIRRLAD
DFRSQFLMKPLKQNNLHFDQIQKALDEFLDQKREAFQRFFFLSNDELLEILSTVKTPQQV
VPHLRKLFENIDDIEIEGQNARKMISQEGEKVILKYCILKGEVEEWLQMILDQMKYSLSH
LFLNCLIRYEQEKMTLPKWIPEFPNQVILTVNRMQWTYISEDYLDPENPQDLGEWHYSLV
LQLEDITGMIKQKLEKSERRKIVALVTQMVHFRDIVEDMCLSETRVTTNDFKWAQQLKFY
EEDNAIIAKQVESKLYYGYEYMGATTRLVITPLTERCWITITGALHIKLGANPTGPAGTG
KTESCKDLAKALGRYCIVFNCSEQVNVKIMEQLFTGLSYTGAWACLDEFNRIDIEVLSVI
ASQVLTIRQALLQDKNQFLFYGKNVNLDKNLGIFITMNPGYAGRTELPDNLKSLFRPVSM
MVPDYTLIAEIMLYSEGFSNAKDLSKKMTKLYKLSSEQLSQQDHYDFGMRAVKSVLVMAG
ALKRSHPNIPEDVLLIKAMRDSNVPKFLNQDLPLFDAILQDLFPNLNLPSTDNKQLSDYS
EKEMIKCGLKESKKFIEKVIQTHQIINVRFGIMVIGPTMSGKSSILKILNRAYTNSKEYQ
QTNNSNSILSSQEQLIKYPEVISRTVNPKAIDLNELYGDFDQVTQSWNDGLVSKIIREYV
DETAGETIQEKLSKMENELKRKESFNQDNLQTSAWEESKRSSILNVSATQASIISSPSQK
RSDREQQKWIVFDGPVDALWIENMNSVLDDSMTLCLSNGERIKLKPNIKMVFEVTDLSYA
SPATVSRCGMVYVDQGVIDTFLITDSYIEKELPEKLDQEQIDFVKTLVKQCIVNGLDYLS
RQCKYIIQVSEQILALSLCRLIKVYIFQEKEDLKEKGMLIKKVIEKIVLFCYYWTTYTLI
HIEALPRYDRHLGEIFSADIVRANMYDYLLKVQGYEAELYHWDLQMEQFQYRKGMSFYEM
TVQTKETICVSYFLQLFLFQQQSIFVTGETGTGKTVIIDNFIKKLSSKEKHVTIQLNFSS
ETKTLNVQNTIESKLIQQRRHQKLFLEPPPGKKMIVFIDDVNMPKVEKYGAQPVIELLRV
LQENKGLYERKSLVWRSISSTSLVIAGGMPGGGRSNLSTRFLRYFNIINLNQYSEDSMVS
IFSNILKTIKYNYTFNNQINDLIDRGVIVKITIQLFQHIQQELLPTPQKCHYIFNMRDIA
KIFQGMLMIRAQTVNTKENFGKLWLHECCRVFMDRLVSIKDIEWFQELASKLIFFNFQFE
VKNVFQFFDSLSFSPVYKSDSYEYVSDAAAYKKRIEEVMNTKTSMNLVLFSHTIQHITRM
ARVLHQERGHFMSVAVGGSGKKSLSILSALLTEMPYSQIMLKQNYGMKDFHDLLLKTMKE
VAFKNQNQILLIMDNQIVKEQFLEEINNIMNSGEVPGIITKEELEIIEDNLKSDAKQQDS
KLQAYDLFVQRVRNKLHVVLGMSPVGESFRNRIRMFPSLTNCCTIDWFQPWPEEALLQVA
TSFLEKESSLTKLSKQILAKCFVFTHQVITQSIEDFYNVWKRKVYSTPKNYIQMIMNYRN
LLRTQNNYQTQQKNKLQNGLDKLQEANKVIDVLEEKLTKLQPELVKKTEEIEILIEKLQI
DKNEANEAKKLVEIEEKIVEQKAEEIKKLQNEASLILKNAMPQLHKATEALNTLNRNDIS
EMRAQHNPHQLVRFTLECVAILLDEKMDWDNIKKMMADTNFLQRLKNLNVEKIPIKIQKE
IKSRIQNNPDFKPSIVKTINYAAKSMCSWVRAVDRFQDVFYEITQKRDYVKKMDEEYANA
FSILKQKRDELDKIIQKFQKFENELQNSIKQKDDLKNEIELTKQRLINAVELKSGLSDEE
ERWKNKIIDLENSIGYLQGNMFLAGSYICYFGPFNGEFRQIIIEQLMENLKQENILFNEK
YNIGDVLGYQVTIRDWNQKGLPTDLVSIGNGIIALNEFNYNNDQSSFPLLIDPQNQALIW
LKQMFGIDNITMIQINSDNLIKTVEMCIRVNKILFIEQVNEQFLDPQLDPILLKQFEYVN
GRKVIKFNGSNLEMAPNFKLFMFTNLGNPNYLPEVFIRANVINFQVTEQGLEEQLLGEVS
SRETPELEKEKHNLILTIGNGKTTLTNIEDKILELLANSQGIILDDKELIDNLKKSKKIS
ISVKEGLIQSEIKEEEIEIVRNLYRKVARRGSILFFCIQKLQLIDPMYQFSLSYFNRLFI
HNLQTSPQSDVPEERVEFIKNCTTSNIFQNVIRSLFNNHKKIFSFMLCTQIALDSGLLSH
QEYNYLIYGDIYLDKLISSISEEQVTLQNYVPQSKQLKISEKLYKNIPKLEILNPILFRG
LCEKMNSSLKQWNYWLKSQDPLSNFPPGIVNGDLTPIQKLLLLKAFRSDEFVSGMMHYVA
SVLGHQYVDHSPASMEEVFVDSDYTTPLIFILSQGVDPLIKIMNFATTKGIDQINMNIVS
LGRGQEQQAEKAIQDGLKNGKWVILLNCHLGKGFMKQLSKLVESIPNDPRIQVKKHKETF
RLFLTSMPCDYFPVSILQNGIKITNESPKGIKANLQKTYVELPQNCLDAANEIGNDKWRK
LLFSFCLFHAVVQERRKFGSLGWNISYDFNESDLQTSLTILTNVLNTYDRIPWENLQYII
GEITYGGRVTDNQDRICLMSQLQQFCNPQVIQDNHQFSKAYKQISFQNGTSYTDQLKEYL
DQLPAQDYADIFGMHENAIISSKFNETNESLKLFIDAQPKYQQRTSKNQAKSQSEQEKDE
NKPSYIVTEEEEIFDKCRYFEKNLPSIMKHVERKPKKQNKQLYLLQLQQEQFMSEKKKKK
HYLKMNKEESRQTRKNFIDSLEMCLQQEIERFNRLLEVMKQSLSNLKRAIKGEVVLSKRL
ELMYNSILLNRVPEIWLEKSYLSMRSLSSWFSNLIDRVNFFTEWQKEKPKAFWLSAFFFP
QGFLTSVLQNYARKYMVPIDTLIFDFKFMNSIPTKKQQQIVDNNNQQQVRGPSMTQINPQ
EIYNDEREELKAKQKQRQLQQQILQQKINELLKQQEEEEKEENMDGCLIYGLYCDGCRFS
SSLDCIEDNEIGILNKQAPVIHFIPKEIKLLSEAEVIRLQQEKYRQIQIQNRSDKDINNE
VGMKLETNQSNKNLIIKNNSSLIKDSQLLEGQKLAQFTFLMPLYKTVQRSGVLSTTGHST
NFIISISVPTKQPSFYWILRGAAFVCDPESC


>TTHERM_00047540(gene)
ATGAAAAGGAAGAACAATTCTTTCCATCTTGGATAAAATTAGCGTTATCCTTCGCCTACA
TAAAATAACAAGCTTTAAAATGATGGAATTTAAATGAATAATTAGAATTCTACATAACTG
CCTGAACATTCAGTTGCACATCGCATTTATAGATAAGCAATCGAAGAAGAGTTTTAGGAA
AAAATATAAGTTAATACTTTTTTTAGATTAAAATGTTTTTTAATATTAATTGTATTATTG
AAAAAGAATATTTTTATGATAAAGCTATTTAATTTCACAAAATCCATTTTGAATAATTAA
CAATCTTTTTACAATAGAAAAGTGTCGAGCTCGTTCAAGGATAAAATAAGTAAAGCTTTT
TAAGGAACAGATATAATAAAGAGAAATTTTAAATGCAGCCCTCTATTTAATTATAAACAT
AAAGTGTAAATACAGGTTCAAAATAGTTGACTAATTCATCTTCTATTGTAAATCTAAATA
CCATTATTAACTCAAATGTATAATCAATCGTACAAGTGGATAAACTAAATTAGAATTCAA
TTTAAATATTAGATAATTCGTAATAGTAAATTAAACCATAAACCAACTTATCACCTAATA
GTGATAATAAATCAGTTTTACCTATTGTAAGGCATAAGACAAGTTTTTCATTAGATAAAG
CAGCCTTAATAGGGCCATCAAAGGAGCATTTTCCAACTCTTGTACCAAAAGTTTAACTAA
GAGATAGATCTGAATCTAGAAAGAGAGTTATATCATCAAGCAATTTGTCTTTCAGTATAT
AAGATTAACTCATCCCTGGATAACCTTCACCATCTAAAAAATTAAATAAAAAATCAAAAT
AAAGTGGATTAGATGACAGCATTTATATTGATGAAGAAAATATGAATGTACCTTCAAACT
ATCGTGTTAAGACAGAATTATCTACAATTTCTTAAAACCAAGAAAGATATGATTTATTGA
ATACTTCATTAAGAGTAAAAACTTAGCCTTAGAATAACTAGCGTCTTTATATTGCTAACA
ACCCAAATAATAAATTTTAGATAATAAACGAGTAAGAAATGATATAATCAGTACAACTTT
AACAGTAAGAAAATTAGGCATTGTTTTAACAAAAAAGAAATTTGAAATTCCAAAAAGTAG
ATCCTTCACAAATATAATCAGAAAAGAAGGAAAATAAAAATCTAGAGCAACAAGAACATG
AAAGAATAAGATCATTCAGTACTTCAGTTAATTAAAATGATAAATAAATTTAAATAGATG
AATAAAAGTAGACAAGAACAGAAATATATCCAAGAAAAAGAAACCAAAGCATAATTTAAG
AGGAAGATGATTTAGATTAGTAGTTTAGCTAAAATCTTTAAGGCGGAGCAAGCATAATGA
TATAAAATAATTCACATAATTAATCCAAAATTTTGGGTGGAGGACATTCAAAATAATAAA
ATAATCCTTCTAAAATGTCATAACACTAATAAGATTTTTAGAAAAAAACAATTTCAGATT
AGAACTACTAAGAATACATGCAATAATTACAAAAAAAGTAGCCTTTCTTTAATGATTATT
TATCTCCTATAGATTTCATTTCTTTGATAAGAACTGACGCGGAAATGAAAGACGAGTTTT
GTTATTTAAATTAAATTGGTTTGAATTGTTATGATTGGAAAATTGTTCCTTTTTCAGAAA
GAAACCCACAAAATTATATGACAATATCTAGAAGAGTAATTTATAAAATTCTTTTGATTG
TGTATAAAATTAAATTAAAAAGTATTTATGTCTTCTTTAACTAAAATTGCTAAAAAATAT
TTTAGTAAATTATTAAAAGAGTATTGTTGGAGGGAATAATTCAGATTTAATTTTTATATA
AAAATAAAAATATTTTTTTAATTTAAAGAGTTAAATTTAATGAAATATTAGGGTATAGTA
CATTTCAAAGAGAGTGAAGTGAGATTTATGAGACTTGATGAGTGGGAAAGAGAACATGAA
TTGTATCATAATACAGCTAATATTCATTTCTTTAAAACTTTCAGGATGTGGAAAAACTTC
TTTTTATGGAAAAAACTCATGAAAAGAAATATTATGAAGGAGTGTTCAAAGATTTTAGAG
TATAAATTATTATTATTAGATCCTGTTATGAGAGAATCGCTTATTAAGATTAGGTCTGAA
TGTATTGAATAGAAATAAGCTTTGTTTTTTGATGTTAAATTTACTTAACCTGTCAAATTT
GACGAATTTAAGGTAAAAGCTGAGAATTACAGGAAAAATCATTTAGTAAATTAAGTCAAC
TCTCACTAATCTATAATTATGAATATTATTTAAGCTGCATGCGATTTTTCATTGAAGAAA
TTCAAAAGGGATTTCCGTATTCCTAATAAAGATGAAGATATTTCTGATATATCTAATTTT
TAAAATGTAAATAGATTTAATCTTAGAACCTAACTTTTAAATTTTAATTTAATAATTTAG
ATAAAATAAAAAGCAGGTATGCTAATTGGAGACTCTGAATATAGAGATATGCCATATGCA
GCTGAAGCTACTCTTAAAATACACTAAAAAAAGCTTAAGAATTTCACTAAATGCATAGAT
TATATCGTCTTAGAATCTAAGTTACAATTAGTTTAATTTGCAACTGATAATTTAGCAACA
AAAATAGAAAATTTTAACAGGTAAATAACATTTTTATTTGATTAGAAAAAATATAATATT
TATTTTAATAGGTATATGTAAGATGAAAATTTCAATATAATTGAACATATCAGTTGGATA
CAATGTATTGCTTCTGAATGTGAAAATAAGCTCAGTCTTTTTCCCTCAGAAGTTGAGTTT
AAAGATGAATTCGATGAAATCGTAAGAGCAGCAATTTAGGATTTAATAAATGATCATATT
TAATTTGCCCTAAGAGGCGAGATTCTTGAATATTTATAAAGTAAAGATTTAGATTTTATT
GAATTAGCATAAGAAAAAATAAATCTAAGTCATCTCATTTATCATGATGAATAATTTGTT
AACAATTTAAGAAGAGTTCAAGAAGCCGTGGATATAGCTTATAAATAAATATATAAATAA
AGCCTGAAATTAGTTAAACCTCTTGAAATCTATTAAGAGCATCAAAATATAAATCCTTAA
ATTTATGATGACATGGAATCAGAGTAATTAAGTGAAGTAATTGAGAAATATTAGCACGAT
GACTAATATTTATGCTCTTTGAAAGTAGAAGAAGAGCAAGGTATATTTTTCTTTGATATA
AATCCGATCAAAGAAACACTAAAAAATTCTGCATAATCCAGCTTAAAAGTTTTGTTTGAA
AAAATGCCTACCATAACAATTATGAGAGCATACGATTTTAATAAGATTACAGATGAATAT
TTAAATTTAGTCATTAAAAATCCTTAAACATTAGATTAATTTGTGGTTTTCTTAAAAAAT
TATAAAGTAAATTATTTTATTATTAAATTTAATAATCATTTATAAACATATGTTTAAAGT
TTGTGGAGGCAAAAATAAATGATTTAGGCTTAAGATGTAGTGAAATTTTAAATTTATACT
ATTTAGGAATGAAGAATAAAGTAGTGTTTGTTGAAAAAGATCACTAGACAATTATTTCTT
CATAATCTCACTTGCACACTCTCAGATCTAGAATAGAAGAAGTAATTGATATAATTCTAA
TCCAAATAATATTTAAATAATTCTTTTATGAATTTTAGATTGAAAATTTGATGAATTCTT
TTGTAGCTAATTTTAAGGAAGATTTAAAGAATTTATTACCTGGATTTCATGAAACAGTTA
AGCAATATAAATTTAAATTTGACTATTCTAATGTCTTTGAAAAAGAGACAAATTTAGAAA
AATCTATTGATTTTTTATTGAGCATAGAATAAGGCATTAAAGATTTGTATGACTAAAAGC
TAAAAATAATGTCTTATGAAGAAGCTTTAGAGATTTTTGTTGATAATCAAACAAATTTTG
ATAGTCTTGATTCTCTTTATCAGTAATATAATTTAGTCTATGCAGTTTTATCTAACAAGA
AAGAATGGATATTTAGATATTCATTATGGGAATCCTAACATTTCTTGTAAATAGATTTGA
ATGATATGGGTTAGCTTTTAGATTAATGTAATAAAGCAGCAATTAATTATATGAAAGAAT
TAGACAAAGGAAATATAGCTATAGATCTGAAAGAAAAAGTTGAAGTACATCATTTTTAAT
AATTTTTGTGAAAAATTAAAAATCTATTAATAAATAATTATTTAAGGTATACAAAGATTT
TCACTTTTGCTTGATGAATTTAAGATCAGAAAGTATTGGTCAGCCTTAATGGGCAGAAAT
AAGAGAAATTATATTAAAGGATATAAATAATGATGATCATTCATTTTTTAAAAAATTTGA
ATTAATAAATAAATCTGACCTATTTTCTTCTGTGTAAGCTAATAAATACAAGCTTAAATA
TCTGTTTGATCTTAAAATATACCTATTTAATGAGTAAATTAATGACATAGCATTGAGATC
TGAAAAAGAAAGAGAATTACTCAAAATTATTGAATAAGTCGAAGAGTTTTGGAAATTTTC
TAAATTAGGGTTTTTACCTTACAAAGAAAATGAAATATTTATTTTAGGAAGCAATATTGA
ATTAATTGATAAAATTGATGATAACATTACTGCATTAACAAATTTGCTAGGAAATAGGTA
CATTAGCAATTTAAAACTCAGAGTTGAGAGATAATATATGCTTTTTAAATATGTTTAGGA
ATTGTAAATTTTTTTTTAGTTTGAATTTTGTCTTAGCAATTTAATATTTTTCTTAGGCTT
GATGAGTGGATGCTTCATTAAAAGAATTGGCTTTATTTAAAGCCTATTATGTCGACTGGA
TATGCTTAAAAACATCTCAGTAAAGAGTGTTAAAAATTCTAAAATTGTGATTAAATTTGG
AAAAAATTTATGAAATAGGCAAAAGAATTGCCCTTAATTAGAAGATTAGCAGATGATTTT
AGGAGCCAATTTTTAATGAAGCCTCTTAAATAAAACAATCTGCACTTTGATTAAATTTAG
AAAGCTTTAGATGAATTTTTAGATTAAAAAAGAGAAGCTTTCTAGCGTTTTTTCTTCTTG
TCAAATGATGAATTACTTGAAATACTATCAACAGTAAAAACACCTTAGTAAGTTGTTCCA
CATCTAAGAAAATTATTTGAAAATATAGACGACATAGAAATTGAAGGGTAAATCTAATAT
TTTATAATATGTAATTTATTTTTACTTTTAAAATACTTAGCCAAAATGCAAGGAAAATGA
TATCTTAAGAAGGCGAAAAAGTTATTTTGAAATACTGCATATTGAAGGGAGAAGTTGAGG
AGTGGCTTTAAATGATTTTAGATTAGATGAAGTATTCTCTCTCACATCTTTTTTTGAATT
GCTTAATTAGATATGAATAAGAAAAAATGACTTTACCGAAATGGATACCCGAATTCCCTA
ATTAAGTAATTCTGACAGTAAATAGAATGTAGTGGACTTATATCTCTGAGGATTACTTAG
ATCCAGAAAATCCATAAGATCTTGGTGAATGGCATTACTCCTTAGTACTATAACTTGAGG
ATATAACTGGTAATCTTTTATTTTAGTTGATTGCTTTCTGATTTAAATAATTTATGTAAA
GGTATGATCAAGCAAAAATTAGAGAAATCTGAAAGGAGAAAGATTGTTGCTTTAGTCACC
TAAATGGTGCATTTTAGAGATATAGTAGAAGATATGTGCTTGAGTGAAACTAGAGTAACA
ACAAATGACTTTAAATGGGCTCAGTAACTTAAATTCTATGAAGAAGATAATGCTATCATC
GCTAAATAAGTTGAAAGTAAATTATACTATGGATACGAGTATATGGGAGCTACTACTAGA
TTGGTTATAACTCCACTTACTGAGCGCTGTTGGATAACAATTACTGGAGCACTTCACATT
AAATTAGGTTAAAAAATTAAAATATCTTTAATTTTATTAATATACTTTTAAAATCAGGTG
CTAATCCCACAGGTCCTGCAGGTACAGGTAAAACTGAAAGTTGTAAAGACTTAGCAAAAG
CCTTAGGAAGGTATTGCATAGTCTTTAATTGCAGTGAATAAGTTAATGTTAAGATTATGG
AATAACTTTTCACTGGATTATCGTACACAGGTGCATGGGCATGCTTGGATGAGTTTAATA
GAATTGACATTGAAGTACTTTCAGTCATTGCTTCTTAAGTATTATTTTTTATAAATTATT
TTTTTATTTAATATGTGATTAATTTATTGTCTTCTAATTTAATAAGGTGCTAACGATAAG
GCAAGCTTTGCTTCAAGATAAAAATCAATTCTTATTTTATGGAAAAAATGTAAACCTCGA
TAAAAATTTGGGAATATTTATTACTATGAATCCAGGATATGCTGGGAGAACAGAATTACC
TGATAATTTAAAGAGTTTATTCAGACCTGTTTCAATGATGGTTCCAGATTACACTCTTAT
AGCAGAAATCATGTTGTATTCAGAAGGTTTTTCTAATGCCAAAGACCTTTCTAAAAAAAT
GACCAAATTATATAAACTTTCTAGTGAGTAATTAAGCCAGTAAGATCACTATGACTTTGG
TATGAGAGCTGTTAAGAGTGTTTTAGTAATGGCTGGTGCTTTGAAAAGATCACACCCTAA
TATACCAGAAGATGTACTACTTATCAAAGCTATGAGAGACAGTAATGTCCCTAAGTTTTT
GAAGTAAAATATTTCATTAAAAACTAACATTAAACTATTTAAAAAAATTATTAAAGCTAA
GATCTGCCTCTTTTCGATGCTATACTTTAGGATTTATTTCCTAATTTAAATCTACCAAGC
ACTGACAATAAGCAGCTATCTGATTATTCAGAAAAAGAAATGATAAAATGTGGGTTAAAA
GAAAGCAAAAAATTTATTGAAAAGGTTATATAAACACATCAAATTATTAATGTTAGATTT
GGCATTATGGTAATAGGACCAACAATGAGTGGAAAGTCGAGTATCTTAAAAATTTTGAAT
AGAGCTTACACAAACAGTAAAGAGTATCAATAAACGAATAACTCAAATTCTATTCTGTCA
AGTTAAGAGCAACTAATTAAATACCCAGAAGTAATTTCTAGGACTGTTAATCCTAAAGCG
ATTGATTTAAATGAGCTCTATGGCGATTTTGATTAAGTTACTTAAAGTTGGAATGATGGT
TTGGTGAGTAAAATTATAAGAGAATATGTAGACGAAACTGCTGGAGAAACAATTCAAGAA
AAGTTATCCAAGATGGAAAATGAGCTCAAGCGAAAAGAGAGTTTTAATTAGGATAATCTA
CAGACTTCTGCTTGGGAAGAAAGCAAAAGATCTTCAATTTTAAATGTCTCAGCAACCTAA
GCCAGCATCATTTCTTCACCTAGTTAAAAAAGATCAGATAGAGAATAATAAAAATGGATA
GTTTTTGATGGACCTGTTGATGCTTTGTGGATTGAAAATATGAATAGTGTATTAGATGAT
TCTATGACATTATGCTTATCAAATGGTGAGAGAATTAAACTTAAACCAAATATCAAAATG
GTTTTTGAAGTTACAGATTTATCATATGCATCACCCGCAACAGTTTCAAGATGCGGAATG
GTTTACGTTGATTAAGGAGTAAATAAAATTTTATTTATAATATTTCATGCTTGAAGTATT
TGGGTTGATATATTTATTATTTTTAATAAAGGTTATTGACACATTTTTAATTACAGATAG
CTATATTGAAAAGGAATTACCTGAAAAATTAGATTAAGAATAAATAGATTTTGTAAAGAC
TCTTGTAAAATAATGTATTGTCAATGGATTGGATTACTTAAGTAGATAATGTAAATATAT
TATTCAGGTATCTGAATAGATTTTAGCATTGTCACTCTGCAGATTGATCAAAGTAAAACA
AATCTTATTATTTACTTGTTTGCTTAAAATTTATTTTGAAGGTTTACATATTCCAAGAGA
AAGAAGATCTAAAGGAAAAGGGAATGCTTATTAAAAAGGTAATTGAGAAAATAGTATTGT
TTTGCTATTATTGGACAACTTATACTTTGATCCACATTGAAGCACTTCCCAGATATGATA
GACACTTAGGAGAAATATTTTCGGCTGATATTGTTAGAGCTAATATGTATGATTACCTAC
TCAAAGTATAAGGATATGAAGCTGAGTTATATCACTGGGATTTGCAAATGGAATAGTTTT
AATACAGAAAAGGGATGAGTTTTTATGAGATGACAGTCTAAACAAAAGAAACTATTTGTG
TTTCATATTTTTTGCAATTGTTCTTGTTCTAACAGTAATCAATTTTTGTTACAGGAGAAA
CAGGTAAAAAATAAATATTTTAATTTAAATAATAATTAAATTTATTTCCTTGATAATTAA
AGGAACTGGGAAGACAGTTATCATAGATAACTTTATCAAGAAATTGTCTTCAAAAGAAAA
GCATGTCACTATCCAACTCAACTTTTCCAGCGAAACAAAGACTCTAAATGTTTAAAATAC
GATAGAATCTAAGCTCATTCAATAGAGAAGGCACTAAAAGCTCTTTTTGGAACCACCTCC
AGGAAAGAAAATGATAGTTTTTATAGATGATGTGAATATGCCTAAGGTCGAAAAGTATGG
AGCATAACCAGTTATAGAGCTATTAAGAGTTTTATAAGAAAATAAGGGACTTTACGAAAG
AAAATCTTTAGTTTGGAGATCTATCTCTTCGACATCTTTAGTTATAGCTGGAGGAATGCC
TGGAGGAGGAAGATCTAATTTGTCAACAAGATTTTTAAGATATTTTAATATAATTAATCT
CAATTAATATTCAGAAGACTCTATGGTTTCTATCTTTTCTAATATATTAAAAACTATTAA
GTATAATTATACATTTAATAATTAAATAAATGATTTGATAGATAGAGGTGTTATTGTTAA
GATTACAATTTAATTATTTCAACATATTTAATAAGAATTACTCCCTACACCATAAAAGTG
TCATTACATTTTTAATATGAGGGATATTGCTAAAATATTTTAAGGAATGTTAATGATTAG
AGCTTAAACAGTAAATACAAAAGAGAATTTTGGTAAGCTGTGGCTCCATGAGTGTTGTAG
AGTATTCATGGATAGATTAGTAAGTATTAAAGATATTGAATGGTTCTAGGAGTTAGCATC
AAAGCTGATTTTTTTTAACTTTCAATTTGAAGTGAAAAATGTTTTTCAATTCTTCGACTC
TCTTTCATTTTCTCCTGTTTACAAATCTGACTCATACGAATATGTCTCAGACGCGGCCGC
CTACAAAAAAAGAATTGAAGAGGTGATGAATACTAAAACATCTATGAATTTAGTTCTCTT
TAGTCATACTATTTAGCATATCACTAGGATGGCAAGAGTGCTTCATTAAGAAAGAGGCCA
CTTCATGAGTGTAGCTGTAATAACTATTTTCTTTTTTAATAATTTTAATTTTTACCTAAA
AATCTTTATTTAAATAAAATTAGGTTGGTGGCTCAGGAAAAAAATCTTTATCAATTTTAT
CAGCTCTCCTAACTGAAATGCCATACTCTTAGATTATGCTTAAATAAAATTATGGTAGAT
ACAATAAAATAAAAATATAATTTAGATTTAATAAAATTTTTTAATTTATGTTAAAAGGTA
TGAAGGATTTTCATGATTTACTTTTAAAGACTATGAAGGAAGTTGCTTTTAAAAATTAAA
ATTAAATACTTCTCATAATGGACAATTAAATTGTTAAAGAATAATTCCTTGAAGAAATAA
ATAACATTATGAATTCTGGTGAAGTTCCGGGTATAATAACTAAAGAAGAGTTAGAAATTA
TTGAAGATAACTTAAAAAGTGATGCAAAACAGTAAGATTCAAAATTATAAGCTTATGATT
TATTTGTTTAGAGAGTAATTAAAATTTTATTTTAAAGATTATTTTCTAGCATAATTTATT
TTATTAGGTTAGGAACAAATTGCATGTTGTTTTAGGAATGAGTCCAGTTGGAGAGAGTTT
TAGAAACAGGATAAGAATGTTTCCAAGTTTAACTAATTGCTGTACAATTGATTGGTTTTA
GCCTTGGCCAGAAGAGGCCTTACTTTAAGTAGCAACGAGCTTTTTAGAAAAAGAAAGCAG
CTTGACTAAGCTAAGCAAATAAATTTTAGCAAAGTGCTTTGTCTTTACTCACTAAGTAAT
TACCCAAAGTATCGAAGATTTTTACAATGTTTGGAAAAGAAAGGTTTACTCAACGCCAAA
GAATTATATTTAAATGATAATGAATTATAGAAATCTATTAAGAACACAAAATAATTATCA
AACATAATAAAAAAATAAACTTCAAAACGGTTTAGATAAGTTATAAGAAGCTAACAAAGT
TATTGATGTTTTAGAAGAAAAATTAACCAAACTTTAACCAGAGTTAGTAAAAAAAACAGA
GGAAATAGAAATTCTTATTGAAAAATTACAGATAGATAAGTAAATAAATTTCTATAAATA
ATTTAACAAATGTAAAATTTTTTTATTTAATTAGGAATGAAGCAAACGAAGCCAAAAAAT
TAGTTGAAATAGAGGAAAAAATAGTAGAGTAAAAGGCAGAAGAAATAAAAAAGCTTTAAA
ATGAAGCGAGTTTGATTCTCAAAAATGCAATGCCTTAACTTCATAAAGCAACAGAAGCTC
TTAACACTTTAAACAGAAATGTAAGTTTACATTAAAAATTAAATTGATTTTCTAATTTTA
ATTTAATTCATCTAGGATATAAGTGAAATGAGAGCATAACACAACCCTCACCAACTGGTT
AGATTTACGTTGGAATGTGTAGCCATTTTACTTGATGAAAAAATGGATTGGGACAATATT
AAAAAAATGATGGCTGATACAAACTTTTTATAAAGATTGAAAAATCTAAATGTAGAAAAA
ATTCCAATAAAAATTCAAAAAGAAATAAAATCAAGAATATAAAATAACCCTGATTTTAAA
CCATCTATCGTTAAAACAATTAATTATGCTGCTAAATCTATGTGTTCATGGGTAAGAGCC
GTGGATAGATTTTAGGATGTCTTTTATGAGATAACATAAAAAAGAGACTATGTTAAAAAA
ATGGATGAAGAATATGCAAATGCATTTAGTATTTTGAAGTAAAAGAGAGATGAACTTGAT
AAAATTATATAAAAATTCTAGAAATTCGAAAATGAACTACAAAATTCTATAAAATAAAAG
GATGATTTAAAAAATGAAATCGAATTAACAAAATAACGTTTGATTAATGCAGTTGAATTG
AAATCTGGGCTTTCAGATGAAGAAGTATGTTATTAAATATTTTAATAAAATAACCAACTT
TTTTTTTCTAGGAAAGATGGAAAAATAAAATTATAGATTTGGAGAATTCAATTGGTTATT
TGCAGGGAAACATGTTTTTAGCAGGTTCTTACATCTGCTATTTTGGTCCTTTCAATGGTG
AATTTAGGTAATTTTTTAGGTTGCTAAGTTTGTTAATTTTACTTACATTTAAAATATTTT
TTATTAATAATTAAAAATGAAATAATTATTGTTGAATTTACAATTTTAAATATTTTTCTT
TTAAAATAGATAAATTATTATTGAACAACTGATGGAAAACCTAAAATAAGAAAATATACT
TTTCAATGAAAAATATAATATTGGGGATGTTCTCGGATACTAAGTTACTATCAGAGATTG
GAATCAAAAAGGTCTCCCAACAGATTTAGTTTCTATAGGAAATGGAATAATAGCACTTAA
TGAATTTAATTATAATAATGATTAGTCATCCTTTCCTTTACTTATTGATCCATAAAATTA
AGCTTTAATATGGTTAAAGCAGATGTTTGGTATTGACAATATTACTATGATTTAGATCAA
TTCTGATAATCTCATCAAAACTGTTGAGATGTGTATAAGAGTGAATAAAATATTATTTAT
TGAGTAGGTAAATGAATAATTCCTTGATCCATAGCTTGATCCAATACTTTTGAAATAATT
CGAATATGTAAATGGTAGGAAGGTTATTAAATTTAATGGATCTAATCTTGAAATGGCACC
AAATTTCAAATTATTTATGTTTACTAACCTTGGAAATCCTAATTATCTTCCTGAAGTCTT
CATAAGAGCAAATGTGATCAACTTTTAGGTAACTGAGCAAGGTAAACAATTCTCATTTTG
TACTTTAATTTTACAATTTTTAAAAATAAAATAGGTCTTGAAGAGCAGCTTTTAGGAGAA
GTTTCTAGTAGAGAAACTCCTGAGCTAGAAAAAGAGAAGCATAATTTAATACTTACAATA
GGAAATGGTAAAACAACTCTCACTAATATAGAAGACAAGATTTTAGAATTATTAGCTAAT
AGTTAAGGAATTATTTTAGATGATAAAGAGTTGATAGATAATCTCAAAAAATCTAAGAAA
ATATCTATTTCAGTTAAGGAGGGTCTTATTTAGAGTGAAATCAAAGAAGAAGAGATAGAA
ATTGTGAGAAATTTGTATAGAAAAGTTGCTCGAAGAGGATCAATTTTATTCTTTTGCATA
TAGAAGCTCTAATTAATTGATCCCATGTATTAATTTTCTCTAAGCTACTTTAATAGATTA
TTTATTCATAACTTGCAAACGTCTCCATAATCAGATGTTCCAGAAGAAAGAGTGGAATTC
ATCAAAAATTGTACAACCTCGAATATATTTTAAAATGTTATAAGATCTCTTTTCAACAAT
CATAAAAAAATTTTTAGTTTTATGCTATGCACATAGATTGCTTTAGACTCTGGTTTACTC
TCTCACTAAGAATACAATTATTTAATTTATGGTGACATATATCTTGATAAATTAATTTCA
TCAATCTCTGAAGAGCAAGTTACTTTACAAAACTATGTTCCTTAATCAAAATAACTTAAA
ATATCTGAAAAACTTTACAAAAATATTCCAAAATTAGAAATTCTTAACCCAATTCTTTTT
AGAGGTTTATGTGAAAAAATGAATTCTTCATTAAAATAATGGAACTATTGGTTAAAATCA
TAGGATCCTTTGTCTAACTTTCCTCCTGGTATTGTAAATGGAGATTTAACACCTATCTAA
AAGTTGCTTCTATTAAAAGCTTTCAGGTCAGATGAATTTGTGTCAGGTATGATGCACTAT
GTTGCATCTGTGCTTGGTCATTAATATGTAGACCATTCACCTGCTTCAATGGAGGAAGTG
TTTGTAGATTCTGATTATACAACTCCTCTAATTTTTATACTTTCTTAAGGTGTTGACCCA
TTAATTAAAATAATGAATTTTGCTACAACTAAAGGAATTGATCAAATAAACATGAACATA
GTGTCTTTGGGAAGAGGTTATTAATTTTTATCTTTAAATTAATCATTAAATTTATATAAT
TATTTATTAATTTTATTAGGTTAAGAATAATAAGCTGAAAAAGCTATTCAAGATGGCTTA
AAAAATGGAAAGTGGGTTATTTTGTTAAATTGTCACTTGGGAAAGGGATTTATGAAATAA
CTTTCTAAGCTAGTTGAATCAATACCAAATGATCCAAGAATTTAAGTTAAGAAACATAAG
GAAACCTTTAGACTATTTTTAACTTCAATGCCATGTGATTATTTCCCAGTTTCTATTTTA
TAAAACGGTATAAAAATTACAAATGAATCTCCTAAAGGAATAAAAGCAAATCTTTAAAAA
ACTTATGTTGAATTACCGTAAAATTGTTTAGATGCTGCTAATGAAATAGGAAATGATAAG
TGGAGAAAGCTCTTGTTTTCATTTTGCTTATTTCATGCAGTAGTATAAGGTAACTTTAGT
GATTTTATGAAGGAAAAATATGAAAACTTATTTTTTTTACTTTATATTTAAAGAAAGAAG
GAAATTTGGTAGCTTAGGTTGGAATATTAGTTATGATTTCAATGAAAGTGATCTTCAAAC
CTCTCTGACTATTTTAACTAACGTATTAAATACATATGACCGTATACCATGGGAAAATTT
ATAGTATATAATTGGAGAGATTACTTATGGTGGCAGAGTTACAGACAATCAAGATAGAAT
ATGTTTGATGTCATAATTGCAATAATTTTGTAATCCTTAAGTTATTTAAGATAATCATTA
ATTTTCTAAAGCATATAAATAAATATCCTTTTAAAATGGCACTTCATATACTGACTAACT
GAAAGAATACCTAGATTAGCTTCCAGCTTAAGACTATGCAGATATATTTGGTATGCATGA
GAATGCAATTATTTCATCTAAAGTAAATTAATTTTATTTTTGGAGAAATTATTTAAAAAT
TATTTTAATAGTTTAATGAAACAAATGAAAGTCTTAAGCTATTTATAGATGCATAACCAA
AGTATTAACAAAGAACTTCAAAGAATTAAGCTAAATCTTAAAGTGAGTAGGAAAAAGATG
AGAATAAGCCTTCTTATATTGTAACTGAGGAAGAGGAGATATTTGATAAATGTAGGTATT
TTGAGAAAAATTTACCTTCTATTATGAAGCATGTTGAGAGAAAACCTAAAAAGCAAAACA
AACAGCTTTATCTTCTTCAACTCTAATAAGAGCAGTTTATGAGTGAAAAGAAAAAGAAGA
AGCACTATTTAAAAATGAATAAAGAAGAATCACGCTAAACTCGTAAAAATTTTATTGACT
CTTTAGAAATGTGCTTGCAGCAAGAAATAGAAAGGTTCAATAGGCTATTAGAAGTAATAA
GTCGTTTCTCTTTTAAAAATATTTATAAATTTTTTATAAACCTAAATAGGTTATGAAATA
AAGCTTATCAAATTTGAAAAGAGCAATAAAAGGTGAAGTAGTTCTATCTAAAAGGCTTGA
ATTAATGTATAACAGCATTTTGCTGAATAGAGTCCCTGAAATCTGGTTAGAGAAAAGCTA
TTTATCAATGAGAAGTTTGTCAAGTTGGTTTAGTAATTTGATAGACAGAGTTAATTTTTT
CACAGAATGGCAAAAGGAAAAACCTAAAGCTTTTTGGCTGAGTGCATTTTTCTTCCCATA
AGGATTTTTAACCTCAGTTTTATAAAACTATGCAAGAAAATACATGGTACCAATCGACAC
ATTAATATTTGATTTTAAATTCATGAACTCCATACCAACAAAAAAATAATAACAAATAGT
TGATAATAATAACTAATAATAAGTTAGAGGGCCTTCTATGACTTAAATAAACCCATAAGA
AATTTACAATGATGAAAGAGAAGAGTTAAAAGCAAAACAAAAGCAAAGACAATTGTAACA
ATAAATTTTACAACAAAAAATTAATGAACTCCTGAAGTAATAAGAAGAGGAGGAAAAAGA
AGAAAACATGGATGGATGTTTAATTTATGGGCTTTATTGTGATGGATGTAGATTCTCTTC
CAGCTTAGATTGTATTGAAGACAATGAAATAGGTATTTTAAATAAATAAGCTCCAGTAAT
TCATTTTATCCCTAAGGAAATAAAATTACTCAGTGAAGCTGAAGTAATAAGACTTCAATA
AGAAAAATATAGATAAATACAAATATAAAATAGATCAGATAAAGATATAAATAATGAAGT
AGGAATGAAACTTGAAACAAATTAAAGTAATAAGAATTTAATTATTAAAAATAATTCATC
ACTGATAAAAGACAGTTAGTTGCTTGAAGGATAAAAACTTGCTCAATTTACATTTTTAAT
GCCTCTTTACAAAACTGTGTAAAGATCAGGAGTTCTTTCAACAACAGGGCATTCCACAAA
TTTTATTATATCAATTTCTGTTCCTACTAAATAACCTTCCTTTTATTGGATTTTAAGAGG
AGCTGCTTTTGTATGTGATCCAGAATCTTGTTGA