Identifiers and Description

Gene Model Identifier

TTHERM_01104900

Standard Name

DYH13 (DYnein Heavy chain )

Aliases

PreTt01882 | 235.m00033

Description

Heavy chain subunit of ciliary single-headed inner arm dynein (IAD)"

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02370 ) M protein repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF03028 ) Dynein heavy chain
  • ( PF05271 ) Tobravirus 2B protein
  • ( TIGR01257 ) rim ABC transporter
  • ( PF09177 ) Syntaxin 6, N-terminal
  • ( TIGR02640 ) gas vesicle protein GvpN
  • ( PF04949 ) Family of unknown function (DUF662)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF07492 ) Neutral trehalase Ca2+ binding domain
  • ( TIGR00088 ) tRNA (guanine-N1)-methyltransferase
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( PF06400 ) Alpha-2-macroglobulin RAP, N-terminal domain
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein
  • ( PF07749 ) Endoplasmic reticulum protein ERp29, C-terminal
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01104900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_189660
WormBaseWBGene000009629.997093137033517e-262locus:dhc-1 Dynein heavy cha
in, cytoplasmic status:Parti
ally_confirmed UniProt:Q1902
0 protein_id:CCD64267.1
Tetrahymena borealisEI9_16526.19.997093137033517e-262dynein heavy chain family prot
ein (4344 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig145.0.g209.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  2. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  3. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  4. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_01104900(coding)
ATGGATTTAAAAATATAGCATTTCTAACTTGAAGACATTTACTAGAGATGTTCAAATAAG
GTTACATAATAAGAAGGTCTAGAAAGATTATAAATACCATCTGAAGTGTTCTTTGAATCA
TGGAATGCCTTCAACAAATGGTGCAAGAGTTAATTAGATTTAGAAAGAACAATATCGATT
CCCAATTTTGGTAATCTGACTTACAAAAAGTTAAGTGATGGAAGCGACATAAATAATTAA
AATGCAAAAACAATAATGATATACTTTAGTGAGAATCTTATAATCTCCAAAAATTTGAAA
TACAGAGGTGACATTGACAACTCAAATTTCCCTCCAATTAAAATTAATTATAGTGCTGTT
CATAAGCTTTGCCCTGAAATCAATAAATAGGCAGTTAAGGTTTGCATTGAATCCATATTT
AATGAAATAAATGAAGTTCTTAGCATTAATAATGTAGAAGTAGATCTTGGAAATTTTGGA
AAAATAAATTGCTTTGAAAGGACATTGAGCCTTGAACCATTTATCTTAAATAAGAAAGTG
TAAAATGGAAAGTCAAAGCAAACAGTCAGATCACTTCTTGATTCTCGTAAAGGTTTATCA
GCCTCTGTACATATGCTGAGAGCAGCTAATAAAGAAATTGATTATTTTGGAGGAACAGGA
AACAATACTCCTTAATCCAAAGGAGTTAATTCTAACTCTAATTTTAATAGCATTAATAAT
CCTTAAAGCTTAGATGCTAGTGCTCAACTAAACGCTTCGAAGCTTAAATTATAATTAAGT
ATAAGCGCTGGAGATAGCATTGACAATAGTAATATGAATAATTCACAATTTAACCGCAAA
AATTTAAGGATGACTAAAAATTCAGTGGCTTCTAAATTTGTTTAAAATAATGATAAATAA
TAATATTCGCCCACTAGAAGATATAAGCACAATAATGTCTAGATTGATCCTGAGCTTTTG
GCAGCAGGCACAGACCCGTTATCAAAGAACTAAGACTTCTCTAAGCTAGCAAATAGTGCT
AGTTTACTTATAAATTCTAGTTTTTTAAAGCCCCCATAAGCTAGTATAAGGTTCCCTCCC
ATACTTGATAGATTCTCAAGAACATTGGCTTCACCGTTAGCTGCTTAAAAGCATAATTTA
TCAGTAAGCGCTAGAATAGCTTCAAATTATACTCCTACTGCAAAGAAACTCTCTTTTGAC
TAAGAAACAAAAGGTATTAAAATAATGAAGCTATTTGATACATCAGTATAATTCACAGCT
AATTAAGAGCTCCTATAACCTCCTGCAACATTCTTCGAAGAACTTTCTTTTGTTGTCGAT
GGAGTAAGAAATTAAGAATTAAACAACAAGATGAAGGCAAAAAGAACCTGCTATGAAAGA
TATAAAGCATACATTGAGAATGAAATACCTATTGAATTTGTTGCTTCTATTAACAATTAT
TGGATAACTGATATTTTAGATTTGATCCCTCACTAACTATAATATGTTGATAGGTAAGTG
ATGGAGAATATGATTAATCAAATGCTTAATGAAATTAACAAAGACTACTATGACTCAGTG
CGTAAAGCTATACTTGATTATGTTCTTAAAGATGAAACAGAAATGCTTAGAATTGGAATT
ATGGAGATCTATGATGGAGTTGTTGATTATGGAGACAATTATTATAAAGGAATAGAACCT
GATTTGGACTGGAAGGAAGATGTGAATGCCGCTAAATAAGAGATTATTTCTAATCTTGTC
ATTAATTCTAGTTCGACATTAAAACTTATGCAACTATGGAAAAGATATGAAAAAATGCAT
TTCTTAGTATTACCAACAAAGAAAGATTAAACAATGACCATTCAAAACTTCTTAGAAATT
TAACTCAAAAATATCACAGAAGTTAAAAACCACCTGATTTCAGAATGGCATAAAGATGTT
ATTGACATCTATCAAGAAGAATTAAATTAGATGAACAAAAACAAACGATAGGCAATTCTT
TTCTTCAATTCAAATGCTACTCTTATGTCTAATTAGATAAGATAGCTTGTTTCCGATTCT
CTCATTTTATATAAGGAATTCTTTTAGCGCTTTAAGAAGAACAAACTTCTAACTCCTAAA
GATATTATAGAGCGTGAGAAAAATCACAACAATTCTATTGAAGATGTCTTTCTACATGTT
AAATTGACTGCTGAGGATAGAAGAATTGAATTTGCAGATGATTTGTATGAAAGTATACAC
AAAGAATTGATAAAAATCATAGATGACATAATTGCAACCACTCAAGGTTTCCCTAGACCT
GAAAACACTATAGCTAGAAGTGTTGTAAAATCTCTTTGGGCTGTTCCTAGAGATGATGAA
ATATTCTTAAATGTGAAAGAAGAAATAGATAGCATCTTGGAAAGGAATCTAAAGAATGTG
CAAGAAGTTGTAAAGGTTTATGATAAATACTCATATTTGTTAGAAGAAAAGCAAAGAGTT
GAAGCATGGACAAGGACACCTAGGAAAAGAGAAGAGTTCACAGCTGAAATGAACAAATAT
AAAAAACTGTATGACGAAATAAATAAAGAAATACCTTTTTATGTCAGAACTAATATGGTT
TTAGTTGATGGTGTTGATGTCAAAAAGATTTTCTTGTAAATCTGTTAAGATATAGTGATA
ATTCTCCAGACAAGTATACATCATTATTTACTTTCAAAGAATGCTGAAATAGCCAAGGAG
ATTAACACAATTTAAGAATTCATAAAGAGTAAGGCAGAAAATTATGAAAAAATGAAAGAC
CTAGAAATAACAATAGATAAAATTAAAAAAACTGATCACAAAAGAATTTAGGGTGACTAT
TAGGATGTTAAAGTGTGGTTCAATTTACTTTACAATACAGTTCACAAAGTGAGCGAAGAT
GATTTAAAGTAGCTTTACATTACAGCTAGCTTAGTTTATAATCTGATGAATGTTGTTGAA
TAAGAAGAGTCTAGGTTATAAAAGGAAAAAGAAGAACTTGAATAAAGATTAAAAAGAAAG
AAAGATGAATTCGAATTAAATATTTAGGATATTCATTAGAAAATTGATTAACTAAATACT
ACATATGCTAATGAATATTCAAAGGAAGAAGCCTGTAAAGCTATTGAAGGTTACAGTTAA
ACACTTAAGGAATACACTGCTGAAATGAAAGAAATAAACCTTAGAGAAGAGCTTATTGGT
TGGACTTAATCTGAATTCCCAAAACTCCAAGAAGCTGAAAACAATCTATTACCATACTAA
GATTTATGGTTTTTAATTAGAGATAAAAGCGACAAAATAGACTTATGGAAGAAAGTAAAG
TCTGTTTTCACCTTAGATCCTGAAGAAATTGAAAGAGATGTTAAGACTATGTTAAATAAA
GCAACTAAACTTAAAATTATGTTTTCTAAGGCTAAAAATATGGTTAATCCTTTAGAATTA
ACACATACAGTTCTTGAAGATTTAAGAGAATTTTAAAAGCACTAGCTATTAATTCACGTA
TTCTCAAATAAAGGACTTAAAGAAAGACATTGGGATGAGATAAGTAACTTAGTAGGTTTT
AAAGTAGATCCCCATAAAAAGGAATCCTTAAGCAGGTTTATTGGTCTTAATCTAGAAGAT
AAATATTAAAAACTAGAAGAAATTTCTGATTCTGCAACTAAAGAATTCAGCATAGAAAAA
ATTTTAGATAAGATGAGAGAAGACTGGGAACCAATAGTAACAGAGCTCAAATCATGGAAA
GACACAGGTACTTTTATTGTTTCAGGAGGAAGTGTCGATGAAACTCAAACTATTTTGGAC
GATTAAATTGTTAAAACCATGACAATGAAGGGTTCACCATATGCAAAGATATTTGAAGAT
AGAATTATTGAATGGGAAGATTGGTTAAATTACACCCAAAGTCTCTTTGATTATTTTCTC
AAGGTGTAATCTGTTTGGTTGTACCTCGAACCTGTCTTTACCTCTCCTGATATAACAAAG
CATTTGCCTATGGAAGGAGAAGAATTCAGAAAGGTTGACTTTGATTGGCGTAACCAAGTT
ATGGGAAAGGTTTGCAGAGATCCCAAGGTAGTAGAATTCACTAAAGATAAAAGAATGCTT
GATATCCTCAAAGAATCTCATATTAGATTAGAAAAAGTCCAAAAAGGTTTGAACAGCTAC
TTGGAAGGAAAGAGATCTAACTTCCCTCGTTTCTATTTCTTGTCAAATGATGAATTGTTA
GAAATTTTATCAGAAACCAAAGATCCTTAGCGTGTACAACCCCATCTTAAGAAGTGCTTT
GAAGGTATTTAAAAACTCAAAATCGATAACGAAAAAAAGATTTTGGGTATGTATTCATCA
GAAGGAGAATATGTCGAATTCCTCACACTTGTTGATACTAATCAGGCAAGAGGTAATGTA
GATGAATGGTTGGTATGGGTAGAAGAGAGAATGATTGAGAGTATTCACAGTGTAACAGCA
ATAGCTTTCGAAGATTATCAATAAATGAAAAGAAGGGAATTTGTTTTAAATAGGTGTGGT
ATGGCAGTATTAAGTGTGAATATGACATATTGGACATATGGAACTGAGAAGAATCTAAAT
GATCATGGAAACAAGGGTGCTGTTCTATTTGCATAAGAATGTACTGAATAACTTGAGTAA
ATTGTAGATCTAGTCAGATCTGATATATCTCCTTTGGATAGATGCACTATAGAAGCTCTT
ATAGTATTGGATGTTCATAATAGAGACTGCATAACTCAGTTAGCAGAGAAAAATATTGAC
AAAATATCAGATTTTGATTGGTAAGCATAGCTTAGATATTATTGGTAAGATAATGATACA
ATAGTAAAAATTATCAATGCAGTCTGCGATTATAACTATGAGTATTTAGGTAATTCTAGT
CGTTTGGTCATTACACCACTCACAGACAGGTGCTATAGAACACTTTGCGGAGCTATTCAT
TTAAATTATGGAGGTGCTCCAGAAGGACCTGCAGGTACTGGTAAGACAGAAACAGTAAAA
GATTTAGCCAAAGCTCTTGCTAGATAGTGTGTTGTATTTAATTGTTCAGATGGTTTAGAT
TATAAGGCTATGGGAAAATTCTTCAAAGGATTAGCAAGTAGTGGTGCTTGGAGCTGCTTC
GATGAGTTCAATCGTATAGATTTAGAAGTACTTTCAGTCGTTGCACAGTAGATGCTCACA
ATATAATTAGCACGTGCTGAAGGAAAGAAAGAGTTCTTTTTCGAAGATTCAACAATACGT
TTAAAACCAACTTGCAACGCATTTATCACGATGAATCCTGGTTATGCAGGACGTTCAGAA
CTTCCAGATAACTTAAAAGCCTTGTTCCGTTCAGTTGCTATGATGGTTCCTGATTATGCT
ATGATTTCTGAAATTTGTCTTTATTCATATGGTTTTTCAGATGCTAGAAACCTTGCTCGT
AAAATCGTTACTACTTACAAGTTGTGTTCTGAATAGCTTTCATCATAAGACCACTATGAT
TATGGTATGAGAGCAGTAAAGTCTGTCTTGACTGCAGCTGGTAATTTAAAGAGAAAATTC
GTTAATGAAAACGAAAGTATTTTAATGCTTAGAGCAATCAATGATGTAAATCTTGCCAAG
TTCTTGGCTTTTGATCTTCCTCTTTTCAAAGGTATAACAAGTGATTTATTCCCAGGAATT
TCTTTACCTGAAATCGATTATCAAAATATGCATGATTGCATAGATTTAACTCTCAAAAAA
TTAAATCTTTAGAAAGTTCCATATTTCATTGAGAAAATTATTTAACTCTATGAAATGATT
CTTGTAAGACATGGTTTGATGGTCGTTGGTATGCCGTTTTCTGGAAAGACATCAGCTATT
AAAGTTTTGGCTGGAGCACTTACTCTTTTGAATGAAAGAAACTAAATGAACGAGAAAAAA
GTGTAAATAACTACTATTAATCCTAAGTCAATAACTATGAATTAACTCTATGGTTTTTCA
GATGAAGTCTCTCATGAATGGGCAGACGGAGTTTTAGCTATTAAATTCAGAGCATTTGCA
AAATAAGAAAATGATGATAGAAAATGGTTAATTTTTGATGGACCTGTTGATGCTGTTTGG
ATTGAAAATATGAATACAGTCTTAGATGATAACAAAAAACTTTGTTTGAATTCTGGTGAA
ATTATAGCTATGAGTAAAAGTATGAATATGATGTTTGAGCCTATGGATTTAGCAGCTGCT
TCTCCTGCCACAGTATCAAGATGTGGTATGATTTATATGGAACCTTCTTCGATGGGATGG
AGACCTCTCTATAATAGTTGGAAGAAAAATTTACCTTCTACTCTTCGTGAAGAAGATTAT
GTTGAAATAGATATGCTCTTTAACTGGGTTGTAGATCCAGCACTTAAATATCTCAGATAA
AGCTTAAAAGAAATCTCTCCAACTCAAGATTAAAATTTAGTTGTTACTTTAATGAGAATA
TTTAGGGGTTTATTGAAAGATTTAGAAAATCAAGAAACATATGATAAGTTAGACATCAAA
TAGCGTTTCTAATAAATCGACATGAAGTTTATTTTCTCTTACATGTGGTCTATTGGAGGA
TCTTTATGTACATCTGTTGATAGAAAATAGTTTGATCTATTTTCTAAGAGACTTTTTGGC
AAAGATATAGTTGTTTAAGTGGAGAGTAAGAAAATTTCACTTCCAGAAAGAGGTACTATG
TATGATTATATCTATAAGATTGAAGATAAAAAACCTGAAGGTGATTGGTAACTTTGGATT
GATTAAATCGTGCCTGAAGAAATAAATCCTAAAAAGAAACCCAATGAGATTATAATTCAA
ACTTCTGATACTGCTCGTTATAGCTATTTATTAAAGTAAAATATAAAGATGGAGGTTCCA
ACACTGTTTTGTGGTCCAACTGGAACTGGAAAATCTACTTACATCAAAAATTTACTGATG
AATGATTTACCACGTTCTTAATATATGAATATTGAAGTTGGTTTTTCAGCTCAAACAAGC
TCAACTCAGACTATGGATATTATTGATAAGAAATTAGATAGATTGAAGAAAGGTGTTTAT
GGACCTAAATAAGGTAAATGCATTATTTTTGTTGATGATTTGAATATGCCAACAAAAGAA
AAATGGGGAGCACAACCTCCTATTGAAATTCTCCGTTAAATGCTTGATTAAGGTGGCTGG
TATGATTTAAGTGATAAAGAAAAACCTTTTAAATAAATTGTAGAAATCATATTTGTAAGT
GCTATGGGTCCTCCAGGAGGTGGAAGAACTTTTATAACTCCTAGATTATTGCGTCACTTA
AATTTAGTAGCTCTTGCTAACTTTGATGAAGAAACACTTAATAGAATTTTCGGAACAATC
CTGCATTGGTACATGTAAGTGAACCAATTTTCTCCAGAAGTTATTAAAAATGAAAATAAA
GTTATCAACGCTACTCTAGAAATTTATAAGATGGCTATGAATGAATTGTTACCTACTCCT
ATGAAGAGTCATTATCTCTTTAACTTAAGAGATTTTGCTAAGGTTATTATGGGTGTTTGT
ATGAGTGATAAAGACACAATCGCAAATCCAGATATCTTGATAAGACTTTGGGTTCATGAA
TGCTGGAGAGTTTTTGCTGATAGATTAATTAATGAGGATGATAGACTTTTAATGCTTAAG
GGGTTAAGAGAAACAGTTAAAAAGATATTTGGACTTAACTTTGATACAGTTTTCTAACAC
TTGGACAACCCTAATGATAAGGATGAAAAAATTGATACATTAGATGAGATGAGAGGATTA
ATCTTTACAGATATATTGACACCTTTAGGTGCACCTAAAAGGCCATACGAAGAAGTTATT
GATAAGAATAAGTTACAAGCTGCTTGTGATGAAGCTTTAGGAAATTATAATATGCTAAGT
GATAAACCTATGGACCTTGTTTTATTCTCATTTGCTATAGAACACTTGTTAATTATTGAA
AGAATACTTAAATAACCTTCGGGAAACGCTCTATTAGTTGGTGTTGGAGGTTCTGGCCGT
TAATCTTTGACTAGATTAGCAGGTTCTATGGTTGATGCATCAATTATTCAAATTGAAATC
AGTAAAACTTATGGTAAAAATGAGTGGTAAGAAGACCTTAGAAAAGTTCTTAAAAATGCA
GGAGCAAAAGGTCTACCTACTGTCTTCTTATTTACAGATTCACAGATTAAATAAGAAGGT
TTTGTTGAAGATATAAATAACTTACTAAATACTTGCGAAGTTCCAAATCTCTTCCCTGCA
GAAGATAAGGCAGAAATTTAAGAAGCTGTTCGTGCACCTTCCAAAGCAGAAGGAAAATGT
CCTGATGGTCATCCAGAATAACTATATTCTTACTTCGTAGAGAGATGTAAGTAAAATTTA
CATATTGTGCTTTGCTTTTCTCCTATTGGTGATGCTTTCAGAAACAGAGTTAGAATGTTC
CCTTCTCTAGTTAATTGTTGCACAATTGATTGGTTCTTCGAGTGGCCCTAAGATGCATTA
GTTTCTGTAGCTAAGAAATTCTTAGAAAAAATTGAAATGGATGTTGAAATAAAGTAGTCT
TGTACAGAGATGGTTTAGTATTTCCATCAGTCTACTATTTAATGGTCTAATAAATTCTAC
AGTCACTTAAAAAGAAAATTCTATGTAACACCTACTTCTTATCTTGAAATGATCATTACT
TTCCAGAATTTACTTGCTGAAAAACGCAAAGAAGTAAAGTCCTCAATAGATAAGTATGAA
AATGGTTATAATCAAATTATAGAAACAGAGAAAGCTGTAGGTAAAATGCAAATTGATTTG
ACAGATATGGTCCCTAAATTAAAGAAAGCCGCTGAAGATACTGAAGAAAAGATGAAGATT
GTAGCAAAGGAGAAATCTGCTGCAGATATCTTAGCTTCTGGTATTTAGAAAGAAGAAGCT
GTTGTTCAAATTGCTGTTAATGAAGCTAATCTTATTAAAGAAGATTGTGAAAAAGATTTA
GCAGAAGCAATGCCAGCATTAGAAGCTGCAGAAAATGCACTAAATTGTATTTAAAAAGCC
GATATTGATTTCTTGAAATAAATGAGAAATCCTGTTGAGCCTATCAGAGCTACTATGAAA
GCTGTCTGCTTGATTCTTTATCCAAATCCAACTGAGAAAAAGAAAGATGGACTTAAAACT
GTGATTGATTGGTGGGCTGCTTCAGTAAAGCTTTTGAATAACCCACAACTCCTTAAAGAT
ATGAAAGGATATAATAAAGAAGCAATAGAGGACAAGATAATTTAAAGTTTGGGTTCCTAC
TTTAATGATCCAGAAGCAAAGGATAGTTTAGAAAAGAGTGTAGTAGAAAAAGCTTCACCA
GTTTGCTACTCTATGCTTATGTGGGTAAGAGCTATGTACGACTTCTATTTTGTCAACAAA
AAGGTTAAGCCTAAAAAAGCTGCTCTTGAAGAATCAAATGAAAAAGTGTCAAAACTTAAT
GCCTAACTTTACGAGAAGCAAAAAGAACTTAAGGTGGCTACAGATAAAGTTGATGCTCTT
AATAAAGATCTAAAAATAACATAAGATAATAAACAAAATTTAGAAAAGAGATATGAAGAC
TGTTCAAAACAACTAGAAAGAGCTAAAACATTAATAGAAAACTTAGGAGGTGAAAAAGGA
AGATGGGGAGACTTTGCTGAAAAATTAAAGTAATTCTTCACGTTATTAACTGGAGATGTT
ATTATTTCATCTGGTGTTATAGCATATTTAGGCCCTTTCACTCCTACTTACAGACAATAA
ATAATTGAAGAGTGGGTCCTTAAATGCTCTGATAAAAATATTCCAAGAAGTGATAAATTT
AGCTTAGTATAAGTTCTAGGAGATTAAGTAAAGATTAGAGCTTGGAACATTGATGGACTT
CCTAGTGACAGTTTCTCAATTGAAAACGGTATCATAGTATTTAAATCTAGAAGATGGCCT
CTTTGCATTGATCCCTAAGGATAAGCAAATAAGTGGATTAAAAAAATGGAACAATCTAGA
GGAATTAGTATCATAAAATTGACTGATGGTGATTATTTGAGAACTTTAGAAAATAGTATT
CAATTTGGTAAACCTGTTTTGTTAGAAAATGTTGGAGAAGATCTCGATCCTTCTCTAACT
CCAATATTACTCAAGCAAGTATTCAGTAAAGGAAATACTCAATATATAAAATTAGGTGAA
AGTGTGATTGAATACTCTCAAGATTTTAGGTTCTATATCACTACAAAGCTTAGAAATCCT
CACTATCTACCAGAACTTTCAACAAAAGTGACTATCCTTAACTTCATGATTACTTATGAA
GGATTAAATGACTAATTGTTAGGTATTTTAGTCAAGAAAGAAAGACCTGATTTGGCCTCT
GAAAAGGAGAGACTTATTATAGAAGGTGCTAGCAACAAGAAACAGCTAGCTGAAATAGAA
GATAAGATATTGCAAGTTTTATCTGGAAACAAAAACATTTTAACAGATGAATCTGCCATT
AATATATTAACTGCTTCTAAGGTAACTTCAAATGAAATTAGTGAAAAGTAAATTATAGCT
GAAAAGACAGAAAAAGAAATTGATGAAGCTAGACAAACTTACTAGCCTGTATCAACTTAA
GCATCCTGCTTATTCTTCTCTATTTCAGATTTGGGTAATCTTGATCCTATGTATCAGTAT
TCTTTGGTTTACTATTTAGATCTATTTACTTAAGGTATTATCAATGCAGAATAATCAGAA
AGTTTTGATTAAAGATTATTGAATCTAAAGGATTATTTCTTGTATTCATTGTATTCAAAT
ATTTGTAGATCTCTTTTTGAAAAAGATAAGCTCGTATTCTCCACTCTTTTGTGTGTTAGG
TTGCTAGAATTTAGAGGAGAGGAAAATATAAACGATTTTTGGAGATTCCTTTTAACAGGA
GGTATTGCCCTTAGCGATTAACTTCCTTAAAAACCTACTCATCTTAGTTGGCTTTCAGCT
AAATCTTGGGGTGAGCTTGTCCGTCTATCTGATTTACATGGATTCTAAGATTTCTATAAA
TTGTTATTGGATCCATCAAATGGAGAATAATTCAGATAAATATATGAATCAAATGAACCT
TAAAATGTACCTCTTCCATAATGTATTAACATTCCTAAAATGAACAAGCTAGGAAAGTTG
TGCATTTTAAGAACCATTCGTCCTGATAAAATTATTCCTGCAGTTTAAGACTTTATTAAA
GATAATTTAGGTCAGCCATTCATAGAACCTCCTCCTTTTGATCTTAGTTTAATTTATAAG
GATTCTCTGGCTACTACTCCTCTTATTTTTGTTTTATCTCCTGGTTCTGATCCGTTTGCA
AGTTTGAATGCTTTTGCACAAAAGATAAACAAGAATATAAAAGCTATTTCTCTTGGTTAA
GGATAAGGACCAATTGCTTTAAGAATGATCAATGAAGGCTAATAATCTGGAGATTGGATC
GTCTTATAAAATTGTCATTTAGCAGTTACATGGATGACCACTCTTGAAAAGCTATGCGAA
GAGATTTCACCAGATCCTAAAGTCACCAACCCTGAATTCAGACTATGGCTTACATCTTAT
CCTTCAAAAGATTTCCCTACTTCCGTGCTTTAGGCTGGTATAAAGATGACTAATGAACCT
CCTAAAGGCTTGAAGAACAATATCTAAGGTAGTTATCTCATTGATCCTATTAATAAATCT
GAATTCTTTGACACATGCTAGAATTCTCCTGCATTCAAAAAGCTCCTATTTGGTTTATGT
TTCTTCCACGCTGTAATCTAAGAAAGAAGAAAATATGGACCTCTTGGTTGGAATATATCT
TATGAGTTCAATGAGTCAGACTTACGTATTTGTGTTCGTTAACTGAAGATGTTCTTAGAT
GAATTTGGAAATTAAATTCCTTATGATGCTCTAAAGTATCTGACAGCTGAATGTAATTAT
GGAGGTAGAGTTACTGATGATAAAGATAGAAGATTAATTACAACTCTTTTAGAAGACTAT
TACTGTGATAAAACTGTTAACGATCCAAATTACTAATTTGCAAACAATCCAGTATATAAG
CCACCTAATGTAGAAACTAGCTAAGACTTTATATAATATATTAAAGACAATTTCCCACTC
ATAACTCCTCCAGATGTCTTTGGTTTCCACACTAACGCTGATATCACCAAAGACATGAAT
GAAACTAATCTTTTCACTGATTCACTACTCATTTGCTCTTCAGCTTCAAGTGGTGGAGGC
GGAAACTCATATGAAGAAACATTAAATAGTGTTTGCGATAGCATTTTGCATGACTTCCCT
GAACCTTTTAATACTGAGCAAATCCTTGAAAAATATCCAGTTCTTTACGAAGAAAGTATG
AACACAGTATTAAACTAAGAACTTACTCGTTTCAACAAATTAATAAGAGTAATTAAGAGC
TCTTTAAATGATATCAAGAAAGCTCTTAAGGGTTTGATATTAATGTCACCTTAGTTAGAA
GCTGCTTCTAAGAGCATATTTGACGGAAAAGTACCAGAAATGTGGATGAGTAATAGTTAC
CCTTCACTCAAGCCTTTGGGTGGATATGTCAAAGATTTAAGACAAAGATTAAGCTTTTTC
TAAAACTGGATTGATGAGGGAACTCCTATGTCATTCTGGTTAAGTGGTTTCTATTTCACA
CAAAGTTTCTTAACAGGTGTTCTATAAAACTATGCTAGAAAGTATACTATTCCTATTGAT
GAAATCGTCTTCGACTACTTATGCATAAAAGAAGAAAAAATTGAAAATAAGCCTGAAGAT
GGTGCATTTATATATGGACTTTTCATAGAAGGTTCTAAATGGAATTATGAAACTATGTTA
TTGGATGAGTCTGATCCAAAGATTCTCTTTGTAAAGTGCCCTATATTATAGCTTGTTCCA
TGCCACGTAAAGAACGTAAAACCCCCTCAACATTATAATTGCCCAGTATACAAAACTTCA
GCTCGTAAAGGTACTCTTAGTACTACCGGTCACTCCACAAACTTTGTAATGTGGATAAGA
CTGCCAACTGATAAAGAGCAAAGACACTGGATAAAGCGTGGTGTCGCTCTTCTCACCTAA
TTAGACGATTGA


>TTHERM_01104900(protein)
MDLKIQHFQLEDIYQRCSNKVTQQEGLERLQIPSEVFFESWNAFNKWCKSQLDLERTISI
PNFGNLTYKKLSDGSDINNQNAKTIMIYFSENLIISKNLKYRGDIDNSNFPPIKINYSAV
HKLCPEINKQAVKVCIESIFNEINEVLSINNVEVDLGNFGKINCFERTLSLEPFILNKKV
QNGKSKQTVRSLLDSRKGLSASVHMLRAANKEIDYFGGTGNNTPQSKGVNSNSNFNSINN
PQSLDASAQLNASKLKLQLSISAGDSIDNSNMNNSQFNRKNLRMTKNSVASKFVQNNDKQ
QYSPTRRYKHNNVQIDPELLAAGTDPLSKNQDFSKLANSASLLINSSFLKPPQASIRFPP
ILDRFSRTLASPLAAQKHNLSVSARIASNYTPTAKKLSFDQETKGIKIMKLFDTSVQFTA
NQELLQPPATFFEELSFVVDGVRNQELNNKMKAKRTCYERYKAYIENEIPIEFVASINNY
WITDILDLIPHQLQYVDRQVMENMINQMLNEINKDYYDSVRKAILDYVLKDETEMLRIGI
MEIYDGVVDYGDNYYKGIEPDLDWKEDVNAAKQEIISNLVINSSSTLKLMQLWKRYEKMH
FLVLPTKKDQTMTIQNFLEIQLKNITEVKNHLISEWHKDVIDIYQEELNQMNKNKRQAIL
FFNSNATLMSNQIRQLVSDSLILYKEFFQRFKKNKLLTPKDIIEREKNHNNSIEDVFLHV
KLTAEDRRIEFADDLYESIHKELIKIIDDIIATTQGFPRPENTIARSVVKSLWAVPRDDE
IFLNVKEEIDSILERNLKNVQEVVKVYDKYSYLLEEKQRVEAWTRTPRKREEFTAEMNKY
KKLYDEINKEIPFYVRTNMVLVDGVDVKKIFLQICQDIVIILQTSIHHYLLSKNAEIAKE
INTIQEFIKSKAENYEKMKDLEITIDKIKKTDHKRIQGDYQDVKVWFNLLYNTVHKVSED
DLKQLYITASLVYNLMNVVEQEESRLQKEKEELEQRLKRKKDEFELNIQDIHQKIDQLNT
TYANEYSKEEACKAIEGYSQTLKEYTAEMKEINLREELIGWTQSEFPKLQEAENNLLPYQ
DLWFLIRDKSDKIDLWKKVKSVFTLDPEEIERDVKTMLNKATKLKIMFSKAKNMVNPLEL
THTVLEDLREFQKHQLLIHVFSNKGLKERHWDEISNLVGFKVDPHKKESLSRFIGLNLED
KYQKLEEISDSATKEFSIEKILDKMREDWEPIVTELKSWKDTGTFIVSGGSVDETQTILD
DQIVKTMTMKGSPYAKIFEDRIIEWEDWLNYTQSLFDYFLKVQSVWLYLEPVFTSPDITK
HLPMEGEEFRKVDFDWRNQVMGKVCRDPKVVEFTKDKRMLDILKESHIRLEKVQKGLNSY
LEGKRSNFPRFYFLSNDELLEILSETKDPQRVQPHLKKCFEGIQKLKIDNEKKILGMYSS
EGEYVEFLTLVDTNQARGNVDEWLVWVEERMIESIHSVTAIAFEDYQQMKRREFVLNRCG
MAVLSVNMTYWTYGTEKNLNDHGNKGAVLFAQECTEQLEQIVDLVRSDISPLDRCTIEAL
IVLDVHNRDCITQLAEKNIDKISDFDWQAQLRYYWQDNDTIVKIINAVCDYNYEYLGNSS
RLVITPLTDRCYRTLCGAIHLNYGGAPEGPAGTGKTETVKDLAKALARQCVVFNCSDGLD
YKAMGKFFKGLASSGAWSCFDEFNRIDLEVLSVVAQQMLTIQLARAEGKKEFFFEDSTIR
LKPTCNAFITMNPGYAGRSELPDNLKALFRSVAMMVPDYAMISEICLYSYGFSDARNLAR
KIVTTYKLCSEQLSSQDHYDYGMRAVKSVLTAAGNLKRKFVNENESILMLRAINDVNLAK
FLAFDLPLFKGITSDLFPGISLPEIDYQNMHDCIDLTLKKLNLQKVPYFIEKIIQLYEMI
LVRHGLMVVGMPFSGKTSAIKVLAGALTLLNERNQMNEKKVQITTINPKSITMNQLYGFS
DEVSHEWADGVLAIKFRAFAKQENDDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGE
IIAMSKSMNMMFEPMDLAAASPATVSRCGMIYMEPSSMGWRPLYNSWKKNLPSTLREEDY
VEIDMLFNWVVDPALKYLRQSLKEISPTQDQNLVVTLMRIFRGLLKDLENQETYDKLDIK
QRFQQIDMKFIFSYMWSIGGSLCTSVDRKQFDLFSKRLFGKDIVVQVESKKISLPERGTM
YDYIYKIEDKKPEGDWQLWIDQIVPEEINPKKKPNEIIIQTSDTARYSYLLKQNIKMEVP
TLFCGPTGTGKSTYIKNLLMNDLPRSQYMNIEVGFSAQTSSTQTMDIIDKKLDRLKKGVY
GPKQGKCIIFVDDLNMPTKEKWGAQPPIEILRQMLDQGGWYDLSDKEKPFKQIVEIIFVS
AMGPPGGGRTFITPRLLRHLNLVALANFDEETLNRIFGTILHWYMQVNQFSPEVIKNENK
VINATLEIYKMAMNELLPTPMKSHYLFNLRDFAKVIMGVCMSDKDTIANPDILIRLWVHE
CWRVFADRLINEDDRLLMLKGLRETVKKIFGLNFDTVFQHLDNPNDKDEKIDTLDEMRGL
IFTDILTPLGAPKRPYEEVIDKNKLQAACDEALGNYNMLSDKPMDLVLFSFAIEHLLIIE
RILKQPSGNALLVGVGGSGRQSLTRLAGSMVDASIIQIEISKTYGKNEWQEDLRKVLKNA
GAKGLPTVFLFTDSQIKQEGFVEDINNLLNTCEVPNLFPAEDKAEIQEAVRAPSKAEGKC
PDGHPEQLYSYFVERCKQNLHIVLCFSPIGDAFRNRVRMFPSLVNCCTIDWFFEWPQDAL
VSVAKKFLEKIEMDVEIKQSCTEMVQYFHQSTIQWSNKFYSHLKRKFYVTPTSYLEMIIT
FQNLLAEKRKEVKSSIDKYENGYNQIIETEKAVGKMQIDLTDMVPKLKKAAEDTEEKMKI
VAKEKSAADILASGIQKEEAVVQIAVNEANLIKEDCEKDLAEAMPALEAAENALNCIQKA
DIDFLKQMRNPVEPIRATMKAVCLILYPNPTEKKKDGLKTVIDWWAASVKLLNNPQLLKD
MKGYNKEAIEDKIIQSLGSYFNDPEAKDSLEKSVVEKASPVCYSMLMWVRAMYDFYFVNK
KVKPKKAALEESNEKVSKLNAQLYEKQKELKVATDKVDALNKDLKITQDNKQNLEKRYED
CSKQLERAKTLIENLGGEKGRWGDFAEKLKQFFTLLTGDVIISSGVIAYLGPFTPTYRQQ
IIEEWVLKCSDKNIPRSDKFSLVQVLGDQVKIRAWNIDGLPSDSFSIENGIIVFKSRRWP
LCIDPQGQANKWIKKMEQSRGISIIKLTDGDYLRTLENSIQFGKPVLLENVGEDLDPSLT
PILLKQVFSKGNTQYIKLGESVIEYSQDFRFYITTKLRNPHYLPELSTKVTILNFMITYE
GLNDQLLGILVKKERPDLASEKERLIIEGASNKKQLAEIEDKILQVLSGNKNILTDESAI
NILTASKVTSNEISEKQIIAEKTEKEIDEARQTYQPVSTQASCLFFSISDLGNLDPMYQY
SLVYYLDLFTQGIINAEQSESFDQRLLNLKDYFLYSLYSNICRSLFEKDKLVFSTLLCVR
LLEFRGEENINDFWRFLLTGGIALSDQLPQKPTHLSWLSAKSWGELVRLSDLHGFQDFYK
LLLDPSNGEQFRQIYESNEPQNVPLPQCINIPKMNKLGKLCILRTIRPDKIIPAVQDFIK
DNLGQPFIEPPPFDLSLIYKDSLATTPLIFVLSPGSDPFASLNAFAQKINKNIKAISLGQ
GQGPIALRMINEGQQSGDWIVLQNCHLAVTWMTTLEKLCEEISPDPKVTNPEFRLWLTSY
PSKDFPTSVLQAGIKMTNEPPKGLKNNIQGSYLIDPINKSEFFDTCQNSPAFKKLLFGLC
FFHAVIQERRKYGPLGWNISYEFNESDLRICVRQLKMFLDEFGNQIPYDALKYLTAECNY
GGRVTDDKDRRLITTLLEDYYCDKTVNDPNYQFANNPVYKPPNVETSQDFIQYIKDNFPL
ITPPDVFGFHTNADITKDMNETNLFTDSLLICSSASSGGGGNSYEETLNSVCDSILHDFP
EPFNTEQILEKYPVLYEESMNTVLNQELTRFNKLIRVIKSSLNDIKKALKGLILMSPQLE
AASKSIFDGKVPEMWMSNSYPSLKPLGGYVKDLRQRLSFFQNWIDEGTPMSFWLSGFYFT
QSFLTGVLQNYARKYTIPIDEIVFDYLCIKEEKIENKPEDGAFIYGLFIEGSKWNYETML
LDESDPKILFVKCPILQLVPCHVKNVKPPQHYNCPVYKTSARKGTLSTTGHSTNFVMWIR
LPTDKEQRHWIKRGVALLTQLDD


>TTHERM_01104900(gene)
ATGGATTTAAAAATATAGCATTTCTAACTTGAAGACATTTACTAGAGATGTTCAAATAAG
TAATATTTTTAGCACATATTAATTTAAATATAATTTCTATTTTATTCTTTTAAGGGTTAC
ATAATAAGAAGGTCTAGAAAGATTATAAATACCATCTGAAGTGTTCTTTGAATCATGGAA
TGCCTTCAACAAGTAACTCGCTTTTTAAAATATTTAAAAGATAATTATAATGCTAATTAA
AAACTTAATCTAAAGATGGTGCAAGAGTTAATTAGATTTAGAAAGAACAATATCGATTCC
CAATTTTGGTAAATATTTATTTTGTCTTGAAATTTGAAAACATATCAGCATTCATTCTCA
TTGAGTATTTTAATAATAATCAATTAATGTATTTAAAAATAAGGTAATCTGACTTACAAA
AAGTTAAGTGATGGAAGCGACATAAATAATTAAAATGCAAAAACAATAATGATATACTTT
AGTGAGAATCTTATAATCTCCAAAAATTTGAAATACAGAGTATTTTTTTTATATTCTACT
TGAAAAAATATTTAAAAAAAACATCTTTTTAGATTAATTTGAATTTTTTGTTTATTTCTA
CTTAGTAGAAACTATTCTCTATTCAATAATTAACTTAATTTCCTTCTAGTTACTATAGAA
GTTTAATTTCAAATGAAGTTTTATATTTATATGATAACTGTTTATTATAGGGTGACATTG
ACAACTCAAATTTCCCTCCAATTAAAATTAATTATAGTGCTGTTCATAAGCTTTGCCCTG
AAATCAATAAATAGGCAGTTAAGGTTTGCATTGAATCCATATTTAATGAAATAAATGAAG
TAAATATTTTGTATTTTTAATATATTTACAAAAAAAAATAGGATTGAATAAATTTATGAA
AGTAGAAGTTTAAAAATTAAAAATCAAAATCATAGGTCTGTTAAAATTTTATATTTTTCT
TTATATTTTAACTCATGCTATTAAAAGAAGTCTATATTATTATTATTCTTCTTCTTCTTT
AAATTAAATTAAATTAAATTATATTTATTTTTATTATAAAGGTTCTTAGCATTAATAATG
TAGAAGTAGATCTTGGAAATTTTGGAAAAATAAATTGCTTTGAAAGGACATTGAGCCTTG
AACCATTTATCTTAAATAAGAAAGTGTAAAATGGAAAGTCAAAGCAAACAGTCAGATCAC
TTCTTGATTCTCGTAAAGGTTTATCAGCCTCTGTACATATGCTGAGAGCAGCTAATAAAG
AAATTGATTATTTTGGAGGAACAGGAAACAATACTCCTTAATCCAAAGGAGTTAATTCTA
ACTCTAATTTTAATAGCATTAATAATCCTTAAAGCTTAGATGCTAGTGCTCAACTAAACG
CTTCGAAGCTTAAATTATAATTAAGTATAAGCGCTGGAGATAGCATTGACAATAGTAATA
TGAATAATTCACAATTTAACCGCAAAAATTTAAGGATGACTAAAAATTCAGTGGCTTCTA
AATTTGTTTAAAATAATGATAAATAATAATATTCGCCCACTAGAAGATATAAGCACAATA
ATGTCTAGATTGATCCTGAGCTTTTGGCAGCAGGCACAGACCCGTTATCAAAGAACTAAG
TAGCTATTTACTTTATTTTTGAAATTTTAAATAATTATTATTTAAATATAATAAAAAGGA
CTTCTCTAAGCTAGCAAATAGTGCTAGTTTACTTATAAATTCTAGTTTTTTAAAGCCCCC
ATAAGCTAGTATAAGGTTCCCTCCCATACTTGATAGATTCTCAAGAACATTGGCTTCACC
GTTAGCTGCTTAAAAGCATAATTTATCAGTAAGCGCTAGAATAGCTTCAAATTATACTCC
TACTGCAAAGAAACTCTCTTTTGACTAAGAAACAAAAGGTATTAAAATAATGAAGCTATT
TGATACATCAGTATAATTCACAGCTAATTAAGAGCTCCTATAACCTCCTGCAACATTCTT
CGAAGAACTTTCTTTTGTTGTAAATAAATAAATTATAAATGATTGATACAATTTTTAATA
TTAAAATTTTATAAATAGGTCGATGGAGTAAGAAATTAAGAATTAAACAACAAGATGAAG
GCAAAAAGAACCTGCTATGAAAGATATAAAGCATACATTGAGAATGAAATACCTATTGAA
TTTGTTGCTTCTATTAACAATTATTGGATAACTGATATTTTAGATTTGATCCCTCACTAA
CTATAATATGTTGATAGGTAAGTGATGGAGAATATGATTAATCAAATGCTTAATGAAATT
AACAAAGACTACTATGACTCAGTGCGTAAAGCTATACTTGATTATGTTCTTAAAGATGAA
ACAGAAATGCTTAGAATTGGAATTATGGAGATCTATGATGGAGTTGTTGATTATGGAGAC
AATTATTATAAAGGAATAGAACCTGATTTGGACTGGAAGGAAGATGTGAATGCCGCTAAA
TAAGAGATTATTTCTAATCTTGTCATTAATTCTAGTTCGACATTAAAACTTATGCAACTA
TGGAAAAGATATGAAAAAATGCATTTCTTAGTATTACCAACAAAGAAAGATTAAACAATG
ACCATTCAAAACTTCTTAGAAATTTAAGTAAATAATTCATTTATATTTAAAATTGATTAT
TTAAATTTAATAAAATAAATAATTAAATAGCTCAAAAATATCACAGAAGTTAAAAACCAC
CTGATTTCAGAATGGCATAAAGATGTTATTGACATCTATCAAGAAGAATTAAATTAGATG
AACAAAAACAAAGTAAATTTTTTGAAATATATTTAAAGCAAATTAAAATTTTTATTAAAA
ATTAAATAGCGATAGGCAATTCTTTTCTTCAATTCAAATGCTACTCTTATGTCTAATTAG
ATAAGATAGCTTGTTTCCGATTCTCTCATTTTATATAAGGAATTCTTTTAGCGCTTTAAG
AAGAACAAACTTCTAACTCCTAAAGATATTATAGAGCGTGAGAAAAATCACAACAATTCT
ATTGAAGATGTCTTTCTACATGTTAAATTGACTGCTGAGGATAGAAGAATTGAATTTGCA
GATGATTTGTATGAAAGTATACACAAAGAATTGATAAAAATCATAGATGACATAATTGCA
ACCACTCAAGGTTTCCCTAGACCTGAAAACACTATAGCTAGAAGTGTTGTAAAATCTCTT
TGGGCTGTTCCTAGAGATGATGAAGTAATTTAATTTAAAATATTTTTTTCTTTAATAAAT
TTTTAATACCAAATAGATATTCTTAAATGTGAAAGAAGAAATAGATAGCATCTTGGAAAG
GAATCTAAAGAATGTGCAAGAAGTTGTAAAGGTTTATGATAAATACTCATATTTGTTAGA
AGAAAAGCAAAGAGTTGAAGCATGGACAAGGACACCTAGGAAAAGAGAAGAGTTCACAGC
TGAAATGAACAAATATAAAAAACTGTATGACGAAATAAATAAAGAAATACCTTTTTATGT
CAGAACTAATATGGTTTTAGTTGATGGTGTTGATGTCAAAAAGATTTTCTTGTAAATCTG
TTAAGATATAGTGATAATTCTCCAGACAAGTATACATCATTATTTACTTTCAAAGAATGC
TGAAATAGCCAAGGAGATTAACACAATTTAAGAATTCATAAAGAGTAAGGCAGAAAATTA
TGAAAAAATGAAAGACCTAGAAATAACAATAGATAAAATTAAAAAAACTGATCACAAAAG
AATTTAGGGTGACTATTAGGATGTTAAAGTGTGGTTCAATTTACTTTACAATACAGTTCA
CAAAGTGAGCGAAGATGATTTAAAGTAGCTTTACATTACAGCTAGCTTAGTTTATAATCT
GATGAATGTTGTTGAATAAGAAGAGTCTAGGTTATAAAAGGTAAAATATAATTTATTAAC
TAGTATCTTTTTAATTTTTATGTTAAATTAATTAGGAAAAAGAAGAACTTGAATAAAGAT
TAAAAAGAAAGAAAGATGAATTCGAATTAAATATTTAGGATATTCATTAGAAAATTGATT
AACTAAATACTACATATGCTAATGAATATTCAAAGGAAGAAGCCTGTAAAGCTATTGAAG
GTTACAGTTAAACACTTAAGGAATACACTGCTGAAGTAGAAATATTTAAGTTTAAATTAA
TTTTTAATTAAATAACTTATTTTATAATAGATGAAAGAAATAAACCTTAGAGAAGAGCTT
ATTGGTTGGACTTAATCTGAATTCCCAAAACTCCAAGAAGCTGAAAACAATCTATTACCA
TACTAAGATTTATGGTTTTTAATTAGAGATAAAAGCGACAAAATAGACTTATGGAAGAAA
GTAAAGTCTGTTTTCACCTTAGATCCTGAAGAAATTGAAAGAGATGTTAAGACTATGTTA
AATAAAGCAACTAAACTTAAAATTATGTTTTCTAAGGCTAAAAATATGGTTAATCCTTTA
GAATTAACACATACAGTTCTTGAAGATTTAAGAGAATTTTAAAAGCACTAGCTATTAATT
CACGTATTCTCAAATAAAGGACTTAAAGAAAGACATTGGGATGAGATAAGTAACTTAGTA
GGTTTTAAAGTAGATCCCCATAAAAAGGAATCCTTAAGCAGGTTTATTGGTCTTAATCTA
GAAGATAAATATTAAAAACTAGAAGAAATTTCTGATTCTGCAACTAAAGAATTCAGCATA
GAAAAAATTTTAGATAAGGTAAAATACACTGATAAATTTCATTTATTTGTTTTCAATTTT
AAATAATTAAATATAGATGAGAGAAGACTGGGAACCAATAGTAACAGAGCTCAAATCATG
GAAAGACACAGGTACTTTTATTGTTTCAGGAGGAAGTGTCGATGAAACTCAAACTATTTT
GGACGATTAAATTGTTAAAACCATGACAATGAAGGGTTCACCATATGCAAAGATATTTGA
AGATAGAATTATTGAATGGGAAGATTGGTTAAATTACACCCAAAGTCTCTTTGATTATTT
TCTCAAGGTGTAATCTGTTTGGTTGTACCTCGAACCTGTCTTTACCTCTCCTGATATAAC
AAAGCATTTGCCTATGGAAGGAGAAGAATTCAGAAAGGTTGACTTTGATTGGCGTAACCA
AGTTATGGGAAAGGTTTGCAGAGATCCCAAGGTAGTAGAATTCACTAAAGATAAAAGAAT
GCTTGATATCCTCAAAGAATCTCATATTAGATTAGAAAAAGTCCAAAAAGGTTTGAACAG
CTACTTGGAAGGAAAGAGATCTAACTTCCCTCGTTTCTATTTCTTGTCAAATGATGAATT
GTTAGAAATTTTATCAGAAACCAAAGATCCTTAGCGTGTACAACCCCATCTTAAGAAGTG
CTTTGAAGGTATTTAAAAACTCAAAATCGATAACGAAAAAAAGATTTTGGGTATGTATTC
ATCAGAAGGAGAATATGTCGAATTCCTCACACTTGTAAATTTTTATTTTTGAATTAAGTT
TAAAGAATCATTAAAAATAAAATTTTTTAATAATTTAAATGTAAGAGTTTAAATTAATAT
GATAATTTTATGTGCAAAAAAGAAGACATTTAAACAATTTAATATTTATTTGACTTTTTT
TGTAAAGGTTGATACTAATCAGGCAAGAGGTAATGTAGATGAATGGTTGGTATGGGTAGA
AGAGAGAATGATTGAGAGTATTCACAGTGTAACAGCAATAGCTTTCGAAGATTATCAATA
AATGAAAAGAAGGGAATTTGTTTTAAATAGGTGTGGTATGGCAGTATTAAGTGTGAATAT
GACATATTGGACATATGGAACTGAGAAGAATCTAAATGATCATGGAAACAAGGGTGCTGT
TCTATTTGCATAAGAATGTACTGAATAACTTGAGTAAATTGTAGATCTAGTCAGATCTGA
TATATCTCCTTTGGATAGATGCACTATAGAAGCTCTTATAGTATTGGATGTTCATAATAG
AGACTGCATAACTCAGTTAGCAGAGAAAAATATTGACAAAATATCAGATTTTGATTGGTA
AGCATAGCTTAGATATTATTGGTAAGATAATGATACAATAGTAAAAATTATCAATGCAGT
CTGCGATTATAACTATGAGTATTTAGGTAATTCTAGTCGTTTGGTCATTACACCACTCAC
AGACAGGTGCTATAGAACACTTTGCGGAGCTATTCATTTAAATTATGGAGGTGCTCCAGA
AGGACCTGCAGGTATAAAATTGAAATAATATTAATAAAAATGATATTTTCTTGAAGTTAA
AAATTATTTTTGAAGGTTTTAATTGAATAAATAAAACAATTTTTTGAATTTTGATAAAAA
ATGTTATATTATTATAATAATAAAGGTACTGGTAAGACAGAAACAGTAAAAGATTTAGCC
AAAGCTCTTGCTAGATAGTGTGTTGTATTTAATTGTTCAGATGGTTTAGATTATAAGGCT
ATGGGAAAATTCTTCAAAGGATTAGCAAGTAGTGGTGCTTGGAGCTGCTTCGATGAGTTC
AATCGTATAGATTTAGAAGTACTTTCAGTCGTTGCACAGTAGATGCTCACAATATAATTA
GCACGTGCTGAAGGAAAGAAAGAGTTCTTTTTCGAAGATTCAACAATACGTTTAAAACCA
ACTTGCAACGCATTTATCACGATGAATCCTGGTTATGCAGGACGTTCAGAACTTCCAGAT
AACTTAAAAGCCTTGTTCCGTTCAGTTGCTATGATGGTTCCTGATTATGCTATGATTTCT
GAAATTTGTCTTTATTCATATGGTTTTTCAGATGCTAGAAACCTTGCTCGTAAAATCGTT
ACTACTTACAAGTTGTGTTCTGAATAGCTTTCATCATAAGACCACTATGATTATGGTAAG
CAAATGTTTTAATTTTTAAAATTTATATTTCAAAACAAATAAAATATAAATTAAAAGGTA
TGAGAGCAGTAAAGTCTGTCTTGACTGCAGCTGGTAATTTAAAGAGAAAATTCGTTAATG
AAAACGAAAGTATTTTAATGCTTAGAGCAATCAATGATGTAAATCTTGCCAAGTTCTTGG
CTTTTGATCTTCCTCTTTTCAAAGGTATAACAAGTGATTTATTCCCAGGAATTTCTTTAC
CTGAAATCGATTATCAAAATATGCATGATTGCATAGATTTAACTCTCAAAAAATTAAATC
TTTAGAAAGTTCCATATTTCATTGAGAAAATTATTTAACTCTATGAAATGATTCTTGTAA
GACATGGTTTGATGGTCGTTGGTATGCCGTTTTCTGGAAAGACATCAGCTATTAAAGTTT
TGGCTGGAGCACTTACTCTTTTGAATGAAAGAAACTAAATGAACGAGAAAAAAGTGTAAA
TAACTACTATTAATCCTAAGTCAATAACTATGAATTAACTCTATGGTTTTTCAGATGAAG
TCTCTCATGAATGGGCAGACGGAGTTTTAGCTATTAAATTCAGAGCATTTGCAAAATAAG
AAAATGATGATAGAAAAGTATATTAATTTTTTTTCAGTTAAATATTAAAATTTACTTTTT
TATAAAAAGTGGTTAATTTTTGATGGACCTGTTGATGCTGTTTGGATTGAAAATATGAAT
ACAGTCTTAGATGATAACAAAAAACTTTGTTTGAATTCTGGTGAAATTATAGCTATGAGT
AAAAGTATGAATATGATGTTTGAGCCTATGGATTTAGCAGCTGCTTCTCCTGCCACAGTA
TCAAGATGTGGTATGATTTATATGGAACCTTCTTCGATGGGATGGAGACCTCTCTATAAT
AGTTGGAAGAAAAATTTACCTTCTACTCTTCGTGAAGAAGATTATGTTGAAATAGATATG
CTCTTTAACTGGGTTGTAGATCCAGCACTTAAATATCTCAGATAAAGCTTAAAAGAAATC
TCTCCAACTCAAGATTAAAATTTAGTTGTTACTTTAATGAGAATATTTAGGGGTTTATTG
AAAGATTTAGAAGTAAACTTTTTTCTTAAATTTAAAAATTTTTTTTAAATTAAAAAAGAA
ATTATTTAAAAGTCTATTTTAAACAATAAAATAATATGTGCTCTTTTAAATAATAATATT
CTTTATGTCCTTTTATTTGAATAAAATAATAAATAGCAAACCTTAATATTTTTAATTTAA
AAATATATTAAAAATTCTAAAAAATTAAAAAAAGAATCAAGAAACATATGATAAGTTAGA
CATCAAATAGCGTTTCTAATAAATCGACATGAAGTTTATTTTCTCTTACATGTGGTCTAT
TGGAGGATCTTTATGTACATCTGTTGATAGAAAATAGTTTGATCTATTTTCTAAGAGACT
TTTTGGCAAAGATATAGTTGTTTAAGTGGAGAGTAAGAAAATTTCACTTCCAGAAAGAGG
TACTATGTATGATTATATCTATAAGATTGAAGATAAAAAACCTGAAGGTGATTGGTAACT
TTGGATTGATTAAATCGTGCCTGAAGAAATAAATCCTAAAAAGAAACCCAATGAGATTAT
AATTCAAACTTCTGATACTGCTCGTTATAGCTATTTATTAAAGTAAAATATAAAGATGGA
GGTTCCAACACTGTTTTGTGGTCCAACTGGAACTGGAAAATCTACTTACATCAAAAATTT
ACTGATGAATGATTTACCACGTTCTTAATATATGAATATTGAAGTTGGTTTTTCAGCTCA
AACAAGCTCAACTCAGACTATGGATATTATTGATAAGAAATTAGATAGATTGAAGAAAGG
TGTTTATGGACCTAAATAAGGTAAATGCATTATTTTTGTTGATGATTTGAATATGCCAAC
AAAAGAAAAATGGGGAGCACAACCTCCTATTGAAATTCTCCGTTAAATGCTTGATTAAGG
TGGCTGGTATGATTTAAGTGATAAAGAAAAACCTTTTAAATAAATTGTAGAAATCATATT
TGTAAGTGCTATGGGTCCTCCAGGAGGTGGAAGAACTTTTATAACTCCTAGATTATTGCG
TCACTTAAATTTAGTAGCTCTTGCTAACTTTGATGAAGAAACACTTAATAGAATTTTCGG
AACAATCCTGCATTGGTACATGTAAGTGAACCAATTTTCTCCAGAAGTTATTAAAAATGA
AAATAAAGTTATCAACGCTACTCTAGAAATTTATAAGATGGCTATGAATGAATTGTTACC
TACTCCTATGAAGAGTCATTATCTCTTTAACTTAAGAGATTTTGCTAAGGTTATTATGGG
TGTTTGTATGAGTGATAAAGACACAATCGCAAATCCAGATATCTTGATAAGACTTTGGGT
TCATGAATGCTGGAGAGTTTTTGCTGATAGATTAATTAATGAGGATGATAGACTTTTAAT
GCTTAAGGGGTTAAGAGAAACAGTTAAAAAGATATTTGGACTTAACTTTGATACAGTTTT
CTAAGTACATATTTAAACATTTTTATTTTGAATTACAATTTTAAATTTAAATTATATGAA
TAAAAAAAGCACTTGGACAACCCTAATGATAAGGATGAAAAAATTGATACATTAGATGAG
ATGAGAGGATTAATCTTTACAGATATATTGACACCTTTAGGTGCACCTAAAAGGCCATAC
GAAGAAGTTATTGATAAGAATAAGTTACAAGCTGCTTGTGATGAAGCTTTAGGAAATTAT
AATATGCTAAGTGATAAACCTATGGACCTTGTTTTATTCTCATTTGCTATAGAACACTTG
TTAATTATTGAAAGAATACTTAAATAACCTTCGGGAAACGCTCTATTAGTTGGTGTTGGA
GGTTCTGGCCGTTAATCTTTGACTAGATTAGCAGGTTCTATGGTTGATGCATCAATTATT
CAAATTGAAATCAGTAAAACTTATGGTAAAAATGAGTGGTAAGAAGACCTTAGAAAAGTT
CTTAAAAATGCAGGAGCAAAAGGTCTACCTACTGTCTTCTTATTTACAGATTCACAGATT
AAATAAGAAGGTTTTGTTGAAGATATAAATAACTTACTAAATACTTGCGAAGTTCCAAAT
CTCTTCCCTGCAGAAGATAAGGCAGAAATTTAAGAAGCTGTTCGTGCACCTTCCAAAGCA
GAAGGAAAATGTCCTGATGGTCATCCAGAATAACTATATTCTTACTTCGTAGAGAGATGT
AATTATAGCATTCAACAAATTAATATTTAACATATATTTATATAAAGGTAAGTAAAATTT
ACATATTGTGCTTTGCTTTTCTCCTATTGGTGATGCTTTCAGAAACAGAGTTAGAATGTT
CCCTTCTCTAGTTAATTGTTGCACAATTGATTGGTTCTTCGAGTGGCCCTAAGTAAATTT
ATCAAATATTCTTAAAATAACTTAAAAAATAAATTTTTCTAAAAAAGGATGCATTAGTTT
CTGTAGCTAAGAAATTCTTAGAAAAAATTGAAATGGATGTTGAAATAAAGTAGTCTTGTA
CAGAGATGGTTTAGTATTTCCATCAGTCTACTATTTAATGGTCTAATAAATTCTACAGTC
ACTTAAAAAGAAAATTCTATGTAACACCTACTTCTTATCTTGAAATGATCATTACTTTCC
AGAATTTACTTGCTGAAAAACGCAAAGAAGTAAAGTCCTCAATAGATAAGTATGAAAATG
GTTATAATCAAATTATAGAAACAGAGAAAGCTGTAGGTAAAATGCAAATTGATTTGACAG
ATATGGTCCCTAAATTAAAGAAAGCCGCTGAAGATACTGAAGAAAAGATGAAGATTGTAG
CAAAGGAGAAATCTGCTGCAGATATCTTAGCTTCTGGTAATTAACATTAAAAATATTTTG
ATATATTTTTATTTCAACTTATCGATAAAATATAGGTATTTAGAAAGAAGAAGCTGTTGT
TCAAATTGCTGTTAATGAAGCTAATCTTATTAAAGAAGATTGTGAAAAAGATTTAGCAGA
AGCAATGCCAGCATTAGAAGCTGCAGAAAATGCACTAAATTGTATTTAAAAAGCCGATAT
TGATTTCTTGAAATAAATGAGAAATCCTGTTGAGCCTATCAGAGCTACTATGAAAGCTGT
CTGCTTGATTCTTTATCCAAATCCAACTGAGAAAAAGAAAGATGGACTTAAAACTGTGAT
TGATTGGTGGGCTGCTTCAGTAAAGCTTTTGAATAACCCACAACTCCTTAAAGATATGAA
AGGATATAATAAAGAAGCAATAGAGGACAAGATAATTTAAAGTTTGGGTTCCTACTTTAA
TGATCCAGAAGCAAAGGATAGTTTAGAAAAGAGTGTAGTAGAAAAAGCTTCACCAGTTTG
CTACTCTATGCTTATGTGGGTAAGAGCTATGTACGACTTCTATTTTGTCAACAAAAAGGT
TAAGCCTAAAAAAGCTGCTCTTGAAGAATCAAATGAAAAAGTGTCAAAACTTAATGCCTA
ACTTTACGAGAAGCAAAAAGAACTTAAGGTGGCTACAGATAAAGTTGATGCTCTTAATAA
AGATCTAAAAATAACATAAGATAATAAACAAAATTTAGAAAAGAGATATGAAGACTGTTC
AAAACAACTAGAAAGAGCTAAAACATTAATAGAAAACTTAGGAGGTGAAAAAGGAAGATG
GGGAGACTTTGCTGAAAAATTAAAGTAATTCTTCACGTTATTAACTGGAGATGTTATTAT
TTCATCTGGTGTTATAGCATATTTAGGCCCTTTCACTCCTACTTACAGGTATAATTTTTT
TATTCATTCAAATTTAAAATAAGATTTACTAAATATTAAATAGACAATAAATAATTGAAG
AGTGGGTCCTTAAATGCTCTGATAAAAATATTCCAAGAAGTGATAAATTTAGCTTAGTAT
AAGTTCTAGGAGATTAAGTAAAGATTAGAGCTTGGAACATTGATGGACTTCCTAGTGACA
GTTTCTCAATTGAAAACGGTATCATAGTATTTAAATCTAGAAGATGGCCTCTTTGCATTG
ATCCCTAAGGATAAGCAAATAAGTGGATTAAAAAAATGGAACAATCTAGAGGAATTAGTA
TCATAAAATTGACTGATGGTGATTATTTGAGAACTTTAGAAAATAGTATTCAATTTGGTA
AACCTGTTTTGTTAGAAAATGTTGGAGAAGATCTCGATCCTTCTCTAACTCCAATATTAC
TCAAGCAAGTATTCAGTAAAGGAAATACTCAATATATAAAATTAGGTGAAAGTGTGATTG
AATACTCTCAAGATTTTAGGTAATTTTATAAAATTTAGTGAAATGATTTTATTCTTAAAA
ATATTAAACGTTTTAGGTTCTATATCACTACAAAGCTTAGAAATCCTCACTATCTACCAG
AACTTTCAACAAAAGTGACTATCCTTAACTTCATGATTACTTATGAAGGATTAAATGACT
AATTGTTAGGTATTTTAGTCAAGAAAGAAAGACCTGATTTGGCCTCTGAAAAGGAGAGAC
TTATTATAGAAGGTGCTAGCAACAAGAAACAGCTAGCTGAAATAGAAGATAAGATATTGC
AAGTTTTATCTGGAAACAAAAACATTTTAACAGATGAATCTGCCATTAATATATTAACTG
CTTCTAAGGTAAATCAACATATTTAATATACAAAAAACTTTAAATAAATTGATAACTAAT
AAATTAAAGGTAACTTCAAATGAAATTAGTGAAAAGTAAATTATAGCTGAAAAGACAGAA
AAAGAAATTGATGAAGCTAGACAAACTTACTAGCCTGTATCAACTTAAGCATCCTGCTTA
TTCTTCTCTATTTCAGATTTGGGTAATCTTGATCCTATGTATCAGTATTCTTTGGTTTAC
TATTTAGATCTATTTACTTAAGGTAATTTAAATTTTGATTGGATGAATTGTCAAAAAATT
TTATTTAAATTAAAGGTATTATCAATGCAGAATAATCAGAAAGTTTTGATTAAAGATTAT
TGAATCTAAAGGATTATTTCTTGTATTCATTGTATTCAAATATTTGTAGATCTCTTTTTG
AAAAAGATAAGCTCGTATTCTCCACTCTTTTGTGTGTTAGGTTGCTAGAATTTAGAGGAG
AGGAAAATATAAACGATTTTTGGAGATTCCTTTTAACAGGAGGTATTGCCCTTAGCGATT
AACTTCCTTAAAAACCTACTCATCTTAGTTGGCTTTCAGCTAAATCTTGGGGTGAGCTTG
TCCGTCTATCTGATTTACATGGATTCTAAGATTTCTATAAAGTAAATATAACTATTTTTT
AATACAAATTAATAAAATTTTTATTTAAATAAATAGTTGTTATTGGATCCATCAAATGGA
GAATAATTCAGATAAATATATGAATCAAATGAACCTTAAAATGTACCTCTTCCATAATGT
ATTAACATTCCTAAAATGAACAAGCTAGGAAAGTTGTGCATTTTAAGAACCATTCGTCCT
GATAAAATTATTCCTGCAGTTTAAGACTTTATTAAAGATAATTTAGGTCAGCCATTCATA
GAACCTCCTCCTTTTGATCTTAGTTTAATTTATAAGGATTCTCTGGCTACTACTCCTCTT
ATTTTTGTTTTATCTCCTGGTTCTGATCCGTTTGCAAGTTTGAATGCTTTTGCACAAAAG
ATAAACAAGAATATAAAAGGTAATAAAAATAACATTTAAAATAAAATTAAAAAATTTTAT
ATGAAAAATAGCTATTTCTCTTGGTTAAGGATAAGGACCAATTGCTTTAAGAATGATCAA
TGAAGGCTAATAATCTGGAGATTGGATCGTCTTATAAAATTGTCATTTAGCAGTTACATG
GATGACCACTCTTGAAAAGCTATGCGAAGAGATTTCACCAGATCCTAAAGTCACCAACCC
TGAATTCAGACTATGGCTTACATCTTATCCTTCAAAAGATTTCCCTACTTCCGTGCTTTA
GGCTGGTATAAAGATGACTAATGAACCTCCTAAAGGCTTGAAGAACAATATCTAAGGTAG
TTATCTCATTGATCCTATTAATAAATCTGAATTCTTTGACACATGCTAGAATTCTCCTGC
ATTCAAAAAGCTCCTATTTGGTTTATGTTTCTTCCACGCTGTAATCTAAGAAAGAAGAAA
ATATGGACCTCTTGGTTGGAATATATCTTATGAGTTCAATGAGTCAGACTTACGTATTTG
TGTTCGTTAACTGAAGATGTTCTTAGATGAATTTGGAAATTAAATTCCTTATGATGCTCT
AAAGTATCTGACAGCTGAATGTAATTATGGAGGTAGAGTTACTGATGATAAAGATAGAAG
ATTAATTACAACTCTTTTAGAAGACTATTACTGTGATAAAACTGTTAACGATCCAAATTA
CTAATTTGCAAACAATCCAGTATATAAGCCACCTAATGTAGAAACTAGCTAAGACTTTAT
ATAATATATTAAAGACAATTTCCCACTCATAACTCCTCCAGATGTCTTTGGTTTCCACAC
TAACGCTGATATCACCAAAGACATGAATGAAACTAATCTTTTCACTGATTCACTACTCAT
TTGCTCTTCAGCTTCAAGTAAATTTAAACTTAATTTGTTTGTTTTTATATTATAATAAAA
AATAAAATTATTATTAAAAAGGTGGTGGAGGCGGAAACTCATATGAAGAAACATTAAATA
GTGTTTGCGATAGCATTTTGCATGACTTCCCTGAACCTTTTAATACTGAGCAAATCCTTG
AAAAATATCCAGTTCTTTACGAAGAAAGTATGAACACAGTATTAAACTAAGAACTTACTC
GTTTCAACAAATTAATAAGAGTAATTATTAATTAATTATTTTTTTGATTAACTGATGGTT
ATTTAAATTTTTTTTAAAAAAATAGGTAATTAAGAGCTCTTTAAATGATATCAAGAAAGC
TCTTAAGGGTTTGATATTAATGTCACCTTAGTTAGAAGCTGCTTCTAAGAGCATATTTGA
CGGAAAAGTACCAGAAATGTGGATGAGTAATAGTTACCCTTCACTCAAGCCTTTGGGTGG
ATATGTCAAAGATTTAAGACAAAGATTAAGCTTTTTCTAAAACTGGATTGATGAGGGAAC
TCCTATGTCATTCTGGTTAAGTGGTTTCTATTTCACACAAAGTTTCTTAACAGGTGTTCT
ATAAAACTATGCTAGAAAGTATACTATTCCTATTGATGAAATCGTCTTCGACTACTTAGT
AATTAATTAATTATGACTTTCAATATATCATTTTACTTTGCTATAATTATTGAGAATTTT
ATTTAATTTATTATCCTAATTTAATAGTGCATAAAAGAAGAAAAAATTGAAAATAAGCCT
GAAGATGGTGCATTTATATATGGACTTTTCATAGAAGGTTCTAAATGGAATTATGAAACT
ATGTTATTGGATGAGTCTGATCCAAAGATTCTCTTTGTAAAGTGCCCTATATTATAGCTT
GTTCCATGCCACGTAAAGAACGTAAAACCCCCTCAACATTATAATTGCCCAGTATACAAA
ACTTCAGCTCGTAAAGGTACTCTTAGTACTACCGGTCACTCCACAAACTTTGTAATGTGG
ATAAGACTGCCAACTGATAAAGAGCAAAGACACTGGATAAAGCGTGGTGTCGCTCTTCTC
ACCTAATTAGACGATTGA