Identifiers and Description

Gene Model Identifier

TTHERM_00919540

Standard Name

DYH12 (DYnein Heavy chain )

Aliases

PreTt07050 | 163.m00052 | 3754.m00257

Description

Heavy chain subunit of ciliary single-headed inner arm dynein (IAD); KO mutants swim slowly

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00919540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_189660
WormBaseWBGene000009629.997093137033517e-262locus:dhc-1 Dynein heavy cha
in, cytoplasmic status:Parti
ally_confirmed UniProt:Q1902
0 protein_id:CCD64267.1
Tetrahymena borealisEI9_19179.19.997093137033517e-262dynein heavy chain family prot
ein (5020 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig10418.0.g559.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C2.0004261429631518e-110DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  2. Ref:15468164: Liu S, Hard R, Rankin S, Hennessey T, Pennock DG (2004) Disruption of genes encoding predicted inner arm dynein heavy chains causes motility phenotypes in Tetrahymena. Cell motility and the cytoskeleton 59(3):201-14
  3. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  4. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  5. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_00919540(coding)
ATGAAAAAGAATGCAACTCAGTAGCAACTGCGAGGGGCTTCTGAAACTAGAAAAAATACA
AAACCTGCCCATTATAATAGTAGTTAGAGTTTATCTATTTACCCAACTTAGAGTCAATAA
TAGCTGCAACAATAGTAGAAAACTCTTTCAGGAAGCATTAGCCAGTAAATGTGGATGTCT
AAATCAGACTCTGTTTAGGGAGAATTTTTTTTTGATAACTAGAATTATTAAGCAGGGCAA
TAACAAAAAGCATAAGATAAAAATTTGAGTATTCCCATGAAAAAATTTTTTGGCCATGCT
CCCTAATATAGGAATGCTAATTAAAGCCAATCTTAAACCAGTATAAATGCAAAAATTTAA
AATGTATAATAGAAGTTTTGGTAGGATGTAAGTAAGAGCGATAAATCTTTAATGCGTTTA
GAGTCGGGCAAATCTAGACCTGTAACTGCAGGTTAATTCAAGCCATTAACACGTGCATTT
TCAATGCCAAAATTCAAAAATGAAATGCTTCAAAATCATAACCTATAATCAATAAAGCAA
GAAGAAATAGATGAGAGAGAGTTTCCTCAATTTTAAGAAAATATAGCATATGAAGGATAA
ATATAAAATGCTGTTTAAAATTTGAATAGTTAGGTTAATTTTTAAAGAATAGTAAATATT
CATTAATAGCCCTTTTAGTTTTTAAGTCATGTGGGAGGAAAATATACAAGCATTAAAAAT
ATTTCAAGTGAAGAAGCTAACAATATAATCACAAAGGACCTTTTTCCTACGAAGATCGTT
CCTGTTTAGCAGATGAATCAATATGAATAGCTTCAAATGTTTAAAAAAATAGATATTGAC
AGGAATATTAATGATTAAATATCTAAGCATGCAAAAGTTCCTACAATTATACGTCCTAGT
ACAGCAATATAATCTGCTCATAGCTAAGCAAAATCTACCAGTTAATCTCATGCTGATTAA
ATACCTAGTGCTGTATTGTCAGGTAGACTTTCAAGCTCCAAAGGGAGAACATAGTCTTAA
GCCACTTTGTCTGCAAAGCAATAAACATAGGTTTAAGGTCTTCCACAAGCATAACAAAAT
TTTGGAAAAAGTAGGAATATTTAAACAGCAACTGCTAATATGAAAGCACCTGGTTAGAAG
CTTGAACATTCTTAATCTTAAAATACACTATCTTAAAAGAATTCATTACCTTCCTCTGCT
AATTAGTAAAGGTTACTTAGTGGAAAGTAATAGAGAATATAATCAGCAAAACCTGAGTTA
ATGAGAAGATTGTAAGATAAGAATAAAGTAATTGTTGAAGAAATGAATTAAGTAGATTAG
GAGTTAGATATTTAAGAGGATGTCGTTGGTGATGATGAATTTTATAATCGTGCTGAAAAT
ATTAAAGGTAAAATAGATGGAAAGATGCTATTAGACAATCGTCCTAAATCAAGTCTAGCA
GGAAAGAGGCCAGTTAGTGGAAAAGTAGCTGGAGCAGAATCTTTTTTTAAAGAGTTTAGA
AAATATACTTCATTTAATGCTTTAGATACTCCATATGAAGAATTATTTGATAGAAACGAA
CGTACTATTACAGCTACATTTGCTAAGTTTGGCGATCTGGGATATTATTCTCCAGTACAA
AGAATAGGAAGCTATATGCAATATTCTGCCAAGCTTAAAACTGAGCATCTGCTTGAAATC
GTTTCCCTTCAGTAAACAAGTACAAATATAGAAAAGCCTGAATGTGAAATTCCTATTTAA
TTAGCTATTATTGATGAGTTAAACCCTTATTAAAAGAAATCTAAAACTGGTATTTCAACA
ACTTTTACTCCTGAAGATATGAAAAGAGAGCCTATATCATTAAGTTTGTTCCCTGAATAT
TTCCCAGAAACTGACGAAAATTAAACTCCATAAGATTCTGCTAATGAGTTGTTTTATGAA
ATGCTTTAAGAAATGGGAGGAACTTATGATCCTTTTAGTCTTGGAATTAAAAAATATCAT
TATATTGATCCAGTTTTATGGCCTTAAAGTATAGCAAATTTAGTAGATTCATCTGTTAAA
AGATATAATCACTATATTGAATCTGATATTATTAGAGCAGATGAAATACCTAAATTTAGA
AAAAATTGGATGGTCAATGCTTTTAATCTAATACCATAAGAGCTCTTGAAAAATGAGTTT
ACATCAAGATAAGTTTTTTAAGAAATATTTGAAAATTTCAAAACAGCTATGAAAACAGCT
ATGCTCGATTATATTTTAAGATCTCCTCAAGAAAGAGCTAGATTACATATACAGCTTGTT
CCTAGAAAAGTATTATGCAGTGGTGAGCGTATTGCTAGAGAAGGTGGTTTTAATATTAAT
CTTTACTAAGATTGGCATAATTTTGTAGAATTTGGAAGAGAGTTTTGTCGTGGAAATTTA
GTTTTAATGAATATAATTAATAGTTCCTTACAAAGTTGGTCTTATGAGTTTTCTTCATTG
AGCTTATTTGAGTATGAAGCTTTCAAAAGAGTTAGCACATTAGGATATACATATAGTATT
GAATAATTTACAAAATTGTAACAAGTTTATCGTATGAATGTTATTTCTTTGATGAAAAAT
ATATGGCATAGAGGTGCAATCACTATTATAAAAAAATTTAAATATCTAAGAAGAGTTGAT
ACATCCTATGGAAAATGGACATTAGGAGGGTTTAAGAAGCATATTAAAGAAACCAAATTT
GCCCTCAAAAATGATAGAATTTAGTAAAGATTAATGAATACTGGCAATATTGAAGAAATA
GCAGAAGAAGAGCAATACGAAGAAGATAGTAGATAAAGTCATAATAGAAGGTCAATAAGA
AATCCTTTAGGTGAGAGCAATAGAATACCTGAAGCTAGTGAAGGTTCTCCTTCAAACTAA
TATTATGGCTAATTTGATGATAACCATCATATGTATGATTATGGTGAAGAATATGACGAA
TTTGACTACCTAAATGAAAGTTTGGCATACTTAATTGATATAGATAATGAAATTAACACT
CCTGAAAATGTTTACTTTTAAATGCTTAAGTATAAAATTGAAAGAGAAGTATAAATATTA
GATTAAAAAGGAGGTTATACTAATAGGCTAGATTACTAAGCTGAAATGAATCAATAAATG
CAAGGAAGCTAAAATGAATTTGATTTCTATGATGACATTGAGTTTGAAGATTTAAAAGAT
ATAAGAGACAATAGCGCTTATCGTAAAATAGCATAAAAAACAATGGAGGATGAATAGGTA
TGGAGAGAAGAAAATGGATGGTCTCTTTACACAAAAGAATATAAATCTAGAATTTTAGAT
AATGTTGGTATTCTGATGGGCTTATAACTGCGTAAAATTATAGAAGAATCCTTTGCTTAT
TTAGAGAAAAAAATTATCAGTTACCCAACCTACCGCCGCTGGAAAGCCATATAAGCAAAA
AAGAAGGAAGTAGGGTCTTTAGATTTTATAGAAGATAATATCTAATCTAATTGCGAGATT
GACGAAGATGATGAAGAATAAGAGGCTTCAAAAAGCGGGCTTGGTTTGGGAAGCAATGCT
CCTTCAAATGACAAAAGCCCTTATGATCTAAACGGGCTTCTTCCTAATTAAAATTTAAAA
TCCAAATCTAGACTATTTATTTTGAATTAAAGCATAAATAATGTTAGTGCAAGTGCAGCT
TAAAATTCTAAATTAGATACCAGCAAGCGTACATCATAAATGAGACTACCTTCTAATAAT
TAATTAGGAAGTAACTAAACAGCTAGGCCTCTCAGCTCAAATAGATCAAGGGCTGGATTA
AATGCTGATAAAAGCAGCTTAGCTTACATACCATAAGATGGGATTAATACAGAGTCTAAT
ATTAAGACTCTGATATAACTTTACCCTAAAGATAGCTAAATCTTTTATAAAAAGGCAGAT
TTTATGAAAGATCAAGATGACTTATCACCAATATTATCTTTATCTTTGTATGTTGAAGAA
GAGTAAATTAAATTTAGAGAAAATTCTGATTTAATCAAAAACGAATTCCGTAAATTATTT
AATGATATGGTAACTTCATTTGACTAGTTTTTGCATCCTCGTTATTGTAAAGTCAAATTA
GAAAAAAATTAGCAAACTCTATAGCGCGATACTTCATATATTTCAGAAGGCGCTTAAGGT
AAAGACGAAAGGTCAAAATCTAATTAAAAGGGAGTAACTCGTAAATAATTTATGTCTAAT
GCACCTAAAAGCTTAAAGACTGCTTTTGATAATGTTACTCCTGAAGATTTTGAGGCTAAT
TGCTAAGATAGATTTGATGAGTTCTATAAAAAGTTCTGCAGCTTTGTACAAGTTTAAGAA
AAATAAGCTAAAGTGGGTGGTTAATAAGCAAATACATAAACAGAAGGTGATGAAAAAGAT
GCTCATGCCACTAACAATAATTAAAACGATGAATTTGCCAACAGAATCTTAAATAGTTTG
GTAGCACCAGGACAGAAGAAGAAGAAATTCTTGCAAATGGCAAATTTCAACGAAGCCTAC
TTTGCAGGAGTTGTAAACAGAACTATTACACATATCCTAAAGCATTTAGAAGAGAGTACA
ATAGTTTTGACTGTTTTTGATTAATTCAAGCCATTTATTGAGAAGTAAGCAGAAAGAGAA
ATAAGAAATGTTATTAACAAAAAATAAAATATGACAAATGAAGAATTTAAAAATTACTAT
GAAATCTTAGAAAAGTTCGACAATCTCTCTGATTAAATTCCTGACAAAGTCAAATTAACA
TTATTTGATGTAAGATGTACAGATGTTAAATAATACATCAAAAAGTAGATCAAGGATTTA
CAATAGCGCTTAATTTTTGCCTTTGAAGATATCATTTTAACAACCCTAAGATCGGTAACT
GAAAAATATTCAAGAATAGCAAGTTTTATTAGAAAATCAACAACAACTGCTGATGAGGTA
GAAGAAATGGAGAAATTTTTAGCAGAATTAACTGGCGATAGAATACAAATCAAATTAAGG
ACAAGTGCCTGCTTTTAAAAAATAGTTTTCCTTCAAAAGTTAAATGTAAAAGGTAACTAA
CAAATAGCAGATTTAGCTAAAGATGTTCATGAATGGCCTGAGAAACTAGATAAAGAGCTT
ATTGCATAAGAAGAAAAACACTAAATTGAACGCTCAAGAATTGAAGAAAAGCTAAGAGAG
AAGAGAACAATATTTGAAAATAGAGTTAGTGTATATCTTGAAGATCTCAAAGATTTAGAA
AAGTTTACAGAATATTATAAGCATAAGGATTATATAGTAGAAATTGATGAGTTTGAAAGA
CTCCTCAATGATGCTAAAGATCTGATGGAAGATATTAATGATCAAGAAAAGAAGCTCTTT
GGTATCAGCTCTAATTTTGAAAAATTTTTCACTTTACAATAAGATTTTGAGCCCTATCAA
AAGCTTTGGCGTGCTATTAGCGTATTCAGTGAGAATAAAAAAAAATGGATGGGTGACTCT
GCAAGCACTCTCGATTCTTCAGATGCAGAATCTATTGTTAAAGAGCATAATAAAATTTCT
AGTAAATTACTCTATGCATTCAGATCTGATTCGATTGCATCAACAATTAGCTAAAAATTC
AAAGAAGAAGTAACACAAATGAGTGTATATCTTCCTGTAATTGAAATAATATCAAGGCCA
GGCATTTAAAAGAGACATTGGGATAAAATTTAAAAAGTTTTAAGAATTCCTGATGATGAG
TTTAACTATGATAAAATTTCTCTCAAGTATCTTTTAGCTAAAGGAATTCAAGAAAAAATA
ACAGAAGTAGAAGAAATTTCAGAAAATGCATCAAAAGAATTTGGTCTTGAAACTGCTCTT
GATAAAATGGAGAAGGAATGGGAAAATTTATCATTTTAAATAGTAAATTGGAAAAATAGA
GGGGTATTTATTTTGCAAGGTTCTTCAGTAGAAGATATCCAAATTTTGTTGGATGACCAC
ACATTAAAAGCTTAAACAATCAGAGCTAACCCCAATATTAAATTTGCAGAGTAAAGAGCT
GTTAGATGGGAGAAATTAATGCTATTTATCTAGTCAGTTTTGGAAAACTGGATCAAAGTG
TAAACTCTGTATCTATATCTTGAGCCTATATTTAGTTTTGAAGATATAAGCAAAACTTTA
GTCACAGAGACTGATAAATTTAATATAGTCAATAAAACTTGGAAATAGATTATGGAATGT
GTATAAAATGATCCTAAAGTCTTGAGTGTAGAAAAGATCCCTAATGTAGAAGAAGAGTTA
ATTCATTGCCTAAAGCTTATTGAAGAAATCTAAAAAGGTTTAGAAGAACACCTTGAATCC
AAAAGATTAGAATTTCCTCGTTTCTTCTTTTTATCAAATGACGACTTACTTAATATTTTA
GCTGAAACTAGAGATCCATTGCTAGTTTAGCCTCATATGAAGAAATGTTTTGAAGGTATC
TCTGAGTTACTCTTTAATTACAATGTTGACATTACAGGTATGCGTAGTAGTGAGAAAGAA
GAAATTTAATTTTTAGAGAGAATTTCACCTCGTAATTTCAAGTCAAATGTAGAAAAATGG
CTTTTAGAAGTTGAAAAATAAATGAGAACTTCATTGTCTAAAGTGATGGAAGAAGGATTA
TTAGATCTCTAGTCTGGCTAAGAAAAAAGATCAGAGTGGGTAAGAAAGTGGCCAGGATAG
GTAGTTATAGCAATTTCATAATTAATATGGACTGAAAGTTTAGAAGAAAGCTTAAACTAG
TCAGGTCTAAATGGATTAAAGCAATTCTATGAGATTTGCTAAGGCGGATTAGAAGAAATA
GTTACACTTGTAAGATAAAATTTAACATATTTAGAAACAATTACTCTTGGTGCTTTAATC
GTAATCGAAGTTCATAATAAAGATGTTGTCAAGAGGCTTATTGATGATGAAATAAGCAAC
ACTTAATAATTCGAATGGCTTTCAGAAATGAGATATTATTGGGATGCTTCAGTTAATAAA
TTGAATGTAAAGATGATGTCTACTTCTATGAGATATGGATACGAATATTTAGGAAACACT
GGAAGACTAGTTATCACTCCTCTTACAGATAGATGCTATCGAACTCTCATGAATGCTCTT
TAACTTAATTTAGGAGGTGCTCCTGAAGGACCTGCAGGAACAGGTAAAACAGAAAGTACC
AAGGATTTAGCCAAAGCTATTGCTATGCAGTGCATTGTTTTTAACTGTTCAGATGGTCTT
AATATACATGCTATGGCCAAATTCTTTAAAGGGTTAATAGCAACTGGAGCTTGGAGTTGT
TTTGATGAGTTCAATCGTATTGATTTAGAAGTTCTTTCTGTCATAGCTCAATAAATACTT
TAAATACAATAATGCAAAGCTGCTATGAAAACAAACATATTATTTGAAGGAACTGAGCTT
GTCCTTAAGCACAGCTGTAATGTTTTTATTACTATGAATCCTGGTTATGCAGGTCGTTCT
GAATTACCAGATAACTTAAAGGCACTCTTTAGACCAGTAGCTATGATGGTTCCAGATTAT
TCATTAATTGCTGAAATTTCGTTATATTCTTTTGGTTTCGTAGATGCAAGAAGCTAAGCT
AGAAAGATAGTAGCTGTATATAAACTTTGTAGTGAATAGTTAAGTAGCTAAGATCACTAT
GATTATGGTATGAGAGCAGTTAAAGCTGTTTTAACTGCTGCTTCTTAGCTAAAGAGAAAA
TATCCAAATGAAAGGGAAGATGTTCTTATTTTGCGTTCTATTACAGATGTTAATCTTCCT
AAATTCTTATAGTAGGATGTAGATCTTTTTAAGAATATAACAAGTGACTTATTCCCTGGA
GTTAAACTACCTAATCCAGATTATAACACTTTAAACACAGCTATGACTTCTGTCTTGGCT
ACTATGAATCTGTAAAGTGTCTAAAATTTCCGTAAAAAAGTTCTCTAACTTTATGAAGTA
GTTAACACTCGTCATGGATTAATGCTTGTCGGATAGCCATTTTCTGGAAAATCTAGCTGC
TATAAAGTTTTGGCAGCAACCTTAACATATGCCTGTAAGAAATTAGGGTCTTTAGATGAG
TTACCTACAAATTATTACATTATAAATCCTAAATCAATATCATTAAACTTTTTATATGGT
TACTCTGATCCTGTTTCTAAAGAATGGACTGAGGGAGTCTTAGCTGAAGTATATAGAAAG
TGTGCCACTGCTACTGTTCCTGATAGATAGTTTATAGTCTTTGATGGACCTGTAGATGCT
GATTGGATTGAAAACATGAATACAGTCTTGGATGATAATAAAAAATTGTGTTTAATGAGT
GGTGAAACGATTCCCATGTCAAATTCTATGACTATGATGTTCGAAGTTGCAGATTTGAGA
TAAGCTTCTCCTGCTACAGTTTCTCGTTGCGGTATGGTCTATATGCAACCAGAATAATTA
GGATGGTGGCCTTTGGTACTTTCATGGCTATCACAGATTTCAGAATTTTTAGATGAATCT
CTAATTGAACACTTAAATGAGTTATTTGATGCCACTACTGGATAATGTGTTCATTATATC
AAAACGAGATGCAAAGAGTATCAGAACGTACCAGAAGGAACTCTAGTTGTGCAGCTTATG
AGACTTCTTAGAGCCTTTTTGCACAAATATAGATTTTTTGAAAAAGAATATATTTCTAAA
ATAAAGCTAGAAGTTGTTTAAAACTCTTTAGATATGATTTTTATTTATTGTACTATATGG
AGTATTGGTGCTACTATAGATGAAAAAGGAAGATAAGATTTTGATCGCTATTTAAAGTAG
CTAATAAAAAATCCTTAAAAATGCGAAACTAAAAAAGACAAACTTATTAAATTTGAGAAG
TAAGCAATGCTACCTGAAGCAGGTCCTCATGTTTTAGTGTACGATTATTATTTGGAATAA
GAAGAAAGTGGATCATGCAAATGGAAAAATTATCAATAAATTATAGATTCTGTTTCTGCA
ACAGACTCTATCCCTGCAGATGAATCTTATCATAATATTGTGATAAAAACAGCAGAATAG
TTGAGATTAACGGAACTTCTTTAAGTTGCCATTTAATATCATTATCCTTTCTTGGTGATA
GGGTAAACTGGTACAGGAAAGTCTACTTACATAAATACATATTTGAAGTCGCTCTCACAC
GAAAAATATTTACTTGTTGGTATCAACTTCAGTGCTTAGACATCATCAGAAGAAACTCAA
CTGATTGTAGATTCAAAATTAGACAGAAGAAGAAAAGGTATTTTTGGTCCTCCTATAGGA
GTTAGTTGTCTTGTCTTTGTGGATGATCTAAATATGCCTTAACTAGATAAATATGGTGCT
CAACCTCCTATAGAACTACTCAGATAATTTTTAGATTAGAAGGGTTGGTATGGAAAAGAT
AGAAAGTTTATGGAAATAATTGAAACTTCTTTGATTGGTGCTATGGGTCCTCCTGGAGGT
GGTCGTAACTAAATAACATCAAGATTATTAAGACATTTTAATGTCCTATGCAGCAGTGAG
CCTAATTAATTATAAATGGAAAGAATTTTTACAGAGCTTATGAGCTGGTATATGAACAAA
ATATAACTTAATGATGAAAATCTAAGAAGAACTTTTAAGCTATGCATTGAAGCTACAGTA
GAAATGTATATGAACATTGTTTAAAACTTAAAACCCACTCCTGCTAAATGCCATTATCTT
TTCAATCTTCGTGATGTAAGTAGAGTTGTTTAAGGATTGCAACTAATATCTAAAAACTAA
ATTGAAAATGACAAAAAAATAATAAGACTATGGATAAATGAAGTTAGCAGAGTATTTTAT
GACAGATTATCGTTTGAATAAGATTAAGTTTGGTTTTATAATGCATTATGCAGTTCAATT
AGAAATAAAATAAAAGAAGACATCAAAATGGTAATGAAAGGTCCCTATGACCATATAAAA
TATAATCTGCTTACTCCTGAACCTATAAAAGTCATTAGATTTGGTGAACTCTTAGGAAAT
GTAGATGGAGATAGATTCTATGATGAAATGATTGATATGGAAAAAATATTTGCAAAAGTT
GAATACTTTTTGGAAGATTACAACCAAAATAATAAAAGACCTATGACTTTAGTACTTTTT
GAATTTGCAATCGGACATATTATAAATATATGTAGAATACTTAGATTGCAAGGAGGACAT
GGACTTTTAATTGGTTTGGGTGGTTCTGGAAGATAGTCACTCACTTATCTATCAGCTCAT
ATTAGAGACTTAAGATTGACTTAAATTGAGATGAGTAAAAGCTACTAAAAGGAATAGTGG
ATTGAAGATATGAGAAAAGTAATGATTCAAGCAGGAGTTGATAGCAAAGAATCAGTTTTT
ATTATAAATGATAGCCAAATGTCTAAATCTTTTATTTTAGAAGACCTAAATAATTTACTT
AATTCTGGTGACATTCCAAATTTATTTTCTTAAGAAGATTTTATTCCAGTAATAGATAGA
TTAAGATAAAATGCTAAAAAAGAAGGAAAAGTTAAACTTCTTGAATAAGGCACTAATTAA
TAATTTTATGATTATTTTGTCTAGACTGTTAAGAAGAAACTCCATATAATAGTAACACAA
AGTCCTATTGGTGATACTCTAAGAAATAGAATCAGAAACTTCCCAAATATTGTAAATTGT
ACTAATATTATTTGGTATAGATAGTGGCCAGAAGAGGCTTTGGATGCTGTCGGACATAAA
TTAATTTCTGAGCTATATTTAGATGGTTCTATTAGTAGAAAATTAGTTAACACTTGCAAA
CATTTACATTAGTCTTCTTTAGATCTTAGCTAAGAGTATTTAAGAAATGAGAAAAGAGTC
AATTACATAACACCTTCTTCATATTTAGAATTACTTCATAACTTGAAAATATTGCTTTAG
TAACAAAGGAAAAAACTAGAAGAAAATCGCAACGTCTATTCAAATGGTGTTTAAAAATTA
ATTTCTACTGCTGAGTAAGTGAAGCGTATGGAAGAAGAATTGATTGAAAAGAAACCTATC
TTGATTTAGATGAATGAAGAAACACAAAAAATTGCATCTGAAATTAAAGCACAAGCTTTA
GCTATGGAACCAAAGCGTATTCAAGCAGAAAAGTAAGAAGAAGAAGTTAACGTAAGAGTG
TAGGAAGCAGAGCTAATTAAGCAAGATTGTGAAAGAGAATTGAGTGTTGCAAAGCCTCAG
TTAAAAAAAGCAGAAGATGCTCTAAACACACTAGATTCTAATGATATAAATAAAATGAAG
GCAATGCTTAAGCCCCCAGAGACCGTATAGCTTGTTATGGAAGCAGTTTGTGTGCTTTGC
AAAGTACCTCCACTTCCTGTTCCTAATCCTAAATATCCTAAAGAAAGAATTATGAGTTAT
TGGGAAGCTTCTAAGAAATTTTTATCAGATAAATATTTCTTAAACACACTTATTCAATAT
GATAAGGAAAATATTGATGAATAAGTTATGAAGAAAGTGAGAGACAAATATATTTCTTAA
ACAAAATTATTTAATCCCAAGAGAGTAGAATAGGCAAGTTCAGCCGCTAAAGGTCTTTGT
GAGTGGATTTTAGCCTTGAGTGAATTTGAGAAAGTTTTGTAAATAGTGCGCCCTAAACAA
TAAAGATATAATTAATCCAAGCAAGAAGTTGCTATTTTATAAAATGATTTAAAATAGACT
CGTGATGAGCTTGCGTAACTCAATAAAGAAATAGCTAATTTACAAGATAGCTATGATTAA
ATTCGTAAAAAATAACAATAGCTTGAAGATGATATCTTGGACTGTGAAAAGAAACTGCTT
CGTGCAAGTTCCCTAATTGGAGGATTAGGTGGTGAACAAGAAAGATGGTTAAAAGTATCA
GAAAAATTAGAAAACTAATTATAGTTTGTTGTTGGAGATATAACAATATCAACTGGTATT
ATTTCTTATTTGGGACCATTTAGTTAGACTTATAGAAACAAGTAAGTGAAAGCTTGGATA
GATTACTGCAAGGGACTTTCTATCTAGATAAGTGAAGGATATTCCTTAGAAAGTACGTTA
GGAGAACCTATCATAATTAGAAAGTGGAATATGAATGGTTTGCCTTCAGATGCTTTTTCA
AGAGAAAATGGTATTATTACTTATAATACTAGAAGATGGCCTCTGATGATTGATCCTTAA
CAACAAGCTAACAGATGGATTAGAAAAAATGAATTCGATAATAAAGTAACTGTTGTTAAA
TAATCCGATTCTAACTTTATTCGCTCGCTTGAAACATGTATTTAGTTTGGCTAATGTTTG
ATTATAGAAAATGTTAAAGAAGAAATCGATTCAATACTTGATCCAATTTTATCCAAACAA
ACATTCAAAAACGCAGGTGTCCTAAGCATTAAAGTTGGCGATAATATAATTGATTATTCA
AAATAATTCAAGCTATTTTTAACATCAAAACTTAGAAGTCCTCACTTTACTCCTGAAATA
TCAACTAAACTAACTCTAATTAACTTCACTATAACTAAAGAAGGTCTTGAAGATCAACTT
CTTGAAATTTGTGTTCAAAAGGAAAATCCTAATGATGAAAACTAGAGAGTTCAACTTATC
ATTTAAAATCACAAATATTAATAACAATTGGAAGACATTGAAAAGTAAATCTTGGAAGTT
TTAAATAAAGCAGATAACATTTTAGATGACGAATAAGGTGTTTAGGTCTTATAGCAATCT
AAATAAGTTTCTAATGATATTATGGAAAGATAAGAAGATGCTAAAGTAACTGAATAAAGA
CTTGAGTAGTCAAGACAAGAATATAAGCCTATAGCAAATCACAGTGCAGTTCTCTTCTTT
GCTATTATGGATATGGCTTCATAAGATTTTATGTATTAATACTCACTCAATTGGTTCATA
AACTTGTATATTGACTCATTTGATAAAGCAGAAAAGAGTAAATCAGCTAAAGCTTAAGAT
AGAGTAATTGCTGTTAGCTAGTACTTAACATATTCTATATACTCTAATGTTTGCCGTTCA
TTATTCGAAAAAGATAAATTATTATTTAGCTTCTTACTATTATTAAGAATTTAAGAAAAT
AAAAAACATATAGACAATAATGAATTAAATTTCTTGATTTCTCCTATTGATATTTCTTCT
GAAGATGTGATTAATTCTGCTCATGATTTATAAGAAAATCCAGCAAAATCATTTTTACCT
TAGACAACATGGTTGAGAATTGTAGCTTTATCTAGAATTTCTCCAAAATTCAAACCCTTA
CCACAATCTATTAGCGATGATTTATAATTCTGGCATAGCTTTTATTTCGATAGTTAAGCT
CATACTTTAAAATTACCCGTTCCATTTAATGGTTGTACATAAATGTAAAAAATATGTATT
ATCAAAGCCATCAGACCAGATAGAGTTAATTTAGCAGTGCAAGACTTCATCAGAGCAGAT
TTAGGTGAAAAGTTCACATCACCTCCTCCTTTTAATTTATAACTTAGTTTTAATGATTCT
AATTGCTACTAGCCTTTAATCTTCATCCTTCCAGGTACTGATCCAATGAATAATTTAATT
AATTTTGCTGATTAAAAGTAGAAATATTTGAAAGCTATATCACTTGGTCAAGGATAAGGC
GTTCATGCAGAAAAAGCTATTGATGAAGCTCAAAAGTAAGGAACTTGGGTAATTCTTTAA
AATTGTCATTTAGCTCCTAGTTGGATGCCAAAATTAGAAAAAATTTGTGAAGAAATGCAA
AATAATTCACAAAATAAAGAAAAAATTAATGTAAACTTTAGATTATGGTTGACAAGTTAT
CCCAGCTCTGATTTCCCTATTTCAATCTTGTAGAATAGTGTTAAAATGACTAACGAACCT
CCTAAAGGTGTTAAATCTAATATGTTAGTTTCCTTTATGAGTGACTAGATTTAAGATTAA
ACATTCTTCGAAACCCACAGTAAGCCTAAGCAATTTAAAACTCTTCTTTATGGACTTTGC
TTTTTCCATGCAGTGCTTTAAGAAAGAAGAACTTATGGACCTCTTGGTTGGAATATCTTA
TATGACTTTAATTAATCTGATTTGCGTATAAGTGTGAGATAATTGTATATCTTATTGTAG
GAGTATTAAGACATACCTTACAAAGCTCTTCATTACATGGTTGGTGAGTGTAATTATGGT
GGAAGAGTAACAGATGATAGAGATAGAAGAATTCTTCATGCTTTGATGCAAGATTTCTTT
TCAGATTAAATTTTCCAATAAAACTTTTGCTTCGCAAACGATTCAAATTATATTGTTCCT
CCTATCGGTAATCATGCTGAATATATAAAATTCATTGAAGAAAAAATTCCTCTTAACTAA
AGCCCAAGTATATTCGGTTTCCATGACAATGGTGTAATAGTTAAAGATCTTAAAGAAACA
GACGATTTATGTGGAGCTCTTTTAATGATGATGGGTGGAAATTCTATGAATAATACTGAA
GGAGATACAGAAACATAACTAAGAGCTATTTCATAAGATATATTAACAAAAATACCAAAG
AAATTTGATCCTGAGTTAGTTTCAGCTAAATATCCTATATCCTATGAGAATTCTTTAAAT
ACTGTTCTACAATAAGAAATTATAAGGTATAATAATTTAACGAATGTGATAGTGTCTTCT
CTTAAAGAAATAGAAAATGCTCTTTAAGGTATAGTTGTGATGTCTTCTAATCTTGAAAAA
GTATGCAATAGTTTGCTTAAAGGTCTTGTTCCTGATTTATGGAAGAAATCTTCATATCCT
TCATTAAAACCATTAGGATCTTACATTACAGATTTAGTGAAGAGATTAAAATACTACTAG
AATTGGATTGATCACGATGTACCTAAGTGTCACTGGATAAGCGGCTTCTACTTTACACAA
ACATTTTTAACAGCAACTTTACAAAACTTTGCTCGTAAATATACAATCCCAATTGATAAT
CTAGTTTTTGAATTTAATTTTTATGGTGAACCTCCTGAGAATGTGAACGATGCAGCTCAA
TATATAGACATCACAGATGGTTAGTTAATGTATGGACTCTATATAGAGGGATGTAAATGG
GATTACGATGAAAGATGTCTCGCTGAAAGTGACCTTAAAGTTTTATCAGTATAAGCTCCT
ATTATATGGTTGAAACCAACTGAAATATCTCAAGTAAACAGTTAATAGTAAATATATAAG
TGCCCAGTTTATAAAACATCAGAAAGAAAAGGTACTCTTTCAACAACAGGTCACTCTACT
AATTTTATAATGAGCATAGATATGCCCACGACTATTAGTTCTTCACACTGGGTAAAGCGC
GGTGTAGCTATGCTTTGCTAATTAAGCGATTGA


>TTHERM_00919540(protein)
MKKNATQQQLRGASETRKNTKPAHYNSSQSLSIYPTQSQQQLQQQQKTLSGSISQQMWMS
KSDSVQGEFFFDNQNYQAGQQQKAQDKNLSIPMKKFFGHAPQYRNANQSQSQTSINAKIQ
NVQQKFWQDVSKSDKSLMRLESGKSRPVTAGQFKPLTRAFSMPKFKNEMLQNHNLQSIKQ
EEIDEREFPQFQENIAYEGQIQNAVQNLNSQVNFQRIVNIHQQPFQFLSHVGGKYTSIKN
ISSEEANNIITKDLFPTKIVPVQQMNQYEQLQMFKKIDIDRNINDQISKHAKVPTIIRPS
TAIQSAHSQAKSTSQSHADQIPSAVLSGRLSSSKGRTQSQATLSAKQQTQVQGLPQAQQN
FGKSRNIQTATANMKAPGQKLEHSQSQNTLSQKNSLPSSANQQRLLSGKQQRIQSAKPEL
MRRLQDKNKVIVEEMNQVDQELDIQEDVVGDDEFYNRAENIKGKIDGKMLLDNRPKSSLA
GKRPVSGKVAGAESFFKEFRKYTSFNALDTPYEELFDRNERTITATFAKFGDLGYYSPVQ
RIGSYMQYSAKLKTEHLLEIVSLQQTSTNIEKPECEIPIQLAIIDELNPYQKKSKTGIST
TFTPEDMKREPISLSLFPEYFPETDENQTPQDSANELFYEMLQEMGGTYDPFSLGIKKYH
YIDPVLWPQSIANLVDSSVKRYNHYIESDIIRADEIPKFRKNWMVNAFNLIPQELLKNEF
TSRQVFQEIFENFKTAMKTAMLDYILRSPQERARLHIQLVPRKVLCSGERIAREGGFNIN
LYQDWHNFVEFGREFCRGNLVLMNIINSSLQSWSYEFSSLSLFEYEAFKRVSTLGYTYSI
EQFTKLQQVYRMNVISLMKNIWHRGAITIIKKFKYLRRVDTSYGKWTLGGFKKHIKETKF
ALKNDRIQQRLMNTGNIEEIAEEEQYEEDSRQSHNRRSIRNPLGESNRIPEASEGSPSNQ
YYGQFDDNHHMYDYGEEYDEFDYLNESLAYLIDIDNEINTPENVYFQMLKYKIEREVQIL
DQKGGYTNRLDYQAEMNQQMQGSQNEFDFYDDIEFEDLKDIRDNSAYRKIAQKTMEDEQV
WREENGWSLYTKEYKSRILDNVGILMGLQLRKIIEESFAYLEKKIISYPTYRRWKAIQAK
KKEVGSLDFIEDNIQSNCEIDEDDEEQEASKSGLGLGSNAPSNDKSPYDLNGLLPNQNLK
SKSRLFILNQSINNVSASAAQNSKLDTSKRTSQMRLPSNNQLGSNQTARPLSSNRSRAGL
NADKSSLAYIPQDGINTESNIKTLIQLYPKDSQIFYKKADFMKDQDDLSPILSLSLYVEE
EQIKFRENSDLIKNEFRKLFNDMVTSFDQFLHPRYCKVKLEKNQQTLQRDTSYISEGAQG
KDERSKSNQKGVTRKQFMSNAPKSLKTAFDNVTPEDFEANCQDRFDEFYKKFCSFVQVQE
KQAKVGGQQANTQTEGDEKDAHATNNNQNDEFANRILNSLVAPGQKKKKFLQMANFNEAY
FAGVVNRTITHILKHLEESTIVLTVFDQFKPFIEKQAEREIRNVINKKQNMTNEEFKNYY
EILEKFDNLSDQIPDKVKLTLFDVRCTDVKQYIKKQIKDLQQRLIFAFEDIILTTLRSVT
EKYSRIASFIRKSTTTADEVEEMEKFLAELTGDRIQIKLRTSACFQKIVFLQKLNVKGNQ
QIADLAKDVHEWPEKLDKELIAQEEKHQIERSRIEEKLREKRTIFENRVSVYLEDLKDLE
KFTEYYKHKDYIVEIDEFERLLNDAKDLMEDINDQEKKLFGISSNFEKFFTLQQDFEPYQ
KLWRAISVFSENKKKWMGDSASTLDSSDAESIVKEHNKISSKLLYAFRSDSIASTISQKF
KEEVTQMSVYLPVIEIISRPGIQKRHWDKIQKVLRIPDDEFNYDKISLKYLLAKGIQEKI
TEVEEISENASKEFGLETALDKMEKEWENLSFQIVNWKNRGVFILQGSSVEDIQILLDDH
TLKAQTIRANPNIKFAEQRAVRWEKLMLFIQSVLENWIKVQTLYLYLEPIFSFEDISKTL
VTETDKFNIVNKTWKQIMECVQNDPKVLSVEKIPNVEEELIHCLKLIEEIQKGLEEHLES
KRLEFPRFFFLSNDDLLNILAETRDPLLVQPHMKKCFEGISELLFNYNVDITGMRSSEKE
EIQFLERISPRNFKSNVEKWLLEVEKQMRTSLSKVMEEGLLDLQSGQEKRSEWVRKWPGQ
VVIAISQLIWTESLEESLNQSGLNGLKQFYEICQGGLEEIVTLVRQNLTYLETITLGALI
VIEVHNKDVVKRLIDDEISNTQQFEWLSEMRYYWDASVNKLNVKMMSTSMRYGYEYLGNT
GRLVITPLTDRCYRTLMNALQLNLGGAPEGPAGTGKTESTKDLAKAIAMQCIVFNCSDGL
NIHAMAKFFKGLIATGAWSCFDEFNRIDLEVLSVIAQQILQIQQCKAAMKTNILFEGTEL
VLKHSCNVFITMNPGYAGRSELPDNLKALFRPVAMMVPDYSLIAEISLYSFGFVDARSQA
RKIVAVYKLCSEQLSSQDHYDYGMRAVKAVLTAASQLKRKYPNEREDVLILRSITDVNLP
KFLQQDVDLFKNITSDLFPGVKLPNPDYNTLNTAMTSVLATMNLQSVQNFRKKVLQLYEV
VNTRHGLMLVGQPFSGKSSCYKVLAATLTYACKKLGSLDELPTNYYIINPKSISLNFLYG
YSDPVSKEWTEGVLAEVYRKCATATVPDRQFIVFDGPVDADWIENMNTVLDDNKKLCLMS
GETIPMSNSMTMMFEVADLRQASPATVSRCGMVYMQPEQLGWWPLVLSWLSQISEFLDES
LIEHLNELFDATTGQCVHYIKTRCKEYQNVPEGTLVVQLMRLLRAFLHKYRFFEKEYISK
IKLEVVQNSLDMIFIYCTIWSIGATIDEKGRQDFDRYLKQLIKNPQKCETKKDKLIKFEK
QAMLPEAGPHVLVYDYYLEQEESGSCKWKNYQQIIDSVSATDSIPADESYHNIVIKTAEQ
LRLTELLQVAIQYHYPFLVIGQTGTGKSTYINTYLKSLSHEKYLLVGINFSAQTSSEETQ
LIVDSKLDRRRKGIFGPPIGVSCLVFVDDLNMPQLDKYGAQPPIELLRQFLDQKGWYGKD
RKFMEIIETSLIGAMGPPGGGRNQITSRLLRHFNVLCSSEPNQLQMERIFTELMSWYMNK
IQLNDENLRRTFKLCIEATVEMYMNIVQNLKPTPAKCHYLFNLRDVSRVVQGLQLISKNQ
IENDKKIIRLWINEVSRVFYDRLSFEQDQVWFYNALCSSIRNKIKEDIKMVMKGPYDHIK
YNLLTPEPIKVIRFGELLGNVDGDRFYDEMIDMEKIFAKVEYFLEDYNQNNKRPMTLVLF
EFAIGHIINICRILRLQGGHGLLIGLGGSGRQSLTYLSAHIRDLRLTQIEMSKSYQKEQW
IEDMRKVMIQAGVDSKESVFIINDSQMSKSFILEDLNNLLNSGDIPNLFSQEDFIPVIDR
LRQNAKKEGKVKLLEQGTNQQFYDYFVQTVKKKLHIIVTQSPIGDTLRNRIRNFPNIVNC
TNIIWYRQWPEEALDAVGHKLISELYLDGSISRKLVNTCKHLHQSSLDLSQEYLRNEKRV
NYITPSSYLELLHNLKILLQQQRKKLEENRNVYSNGVQKLISTAEQVKRMEEELIEKKPI
LIQMNEETQKIASEIKAQALAMEPKRIQAEKQEEEVNVRVQEAELIKQDCERELSVAKPQ
LKKAEDALNTLDSNDINKMKAMLKPPETVQLVMEAVCVLCKVPPLPVPNPKYPKERIMSY
WEASKKFLSDKYFLNTLIQYDKENIDEQVMKKVRDKYISQTKLFNPKRVEQASSAAKGLC
EWILALSEFEKVLQIVRPKQQRYNQSKQEVAILQNDLKQTRDELAQLNKEIANLQDSYDQ
IRKKQQQLEDDILDCEKKLLRASSLIGGLGGEQERWLKVSEKLENQLQFVVGDITISTGI
ISYLGPFSQTYRNKQVKAWIDYCKGLSIQISEGYSLESTLGEPIIIRKWNMNGLPSDAFS
RENGIITYNTRRWPLMIDPQQQANRWIRKNEFDNKVTVVKQSDSNFIRSLETCIQFGQCL
IIENVKEEIDSILDPILSKQTFKNAGVLSIKVGDNIIDYSKQFKLFLTSKLRSPHFTPEI
STKLTLINFTITKEGLEDQLLEICVQKENPNDENQRVQLIIQNHKYQQQLEDIEKQILEV
LNKADNILDDEQGVQVLQQSKQVSNDIMERQEDAKVTEQRLEQSRQEYKPIANHSAVLFF
AIMDMASQDFMYQYSLNWFINLYIDSFDKAEKSKSAKAQDRVIAVSQYLTYSIYSNVCRS
LFEKDKLLFSFLLLLRIQENKKHIDNNELNFLISPIDISSEDVINSAHDLQENPAKSFLP
QTTWLRIVALSRISPKFKPLPQSISDDLQFWHSFYFDSQAHTLKLPVPFNGCTQMQKICI
IKAIRPDRVNLAVQDFIRADLGEKFTSPPPFNLQLSFNDSNCYQPLIFILPGTDPMNNLI
NFADQKQKYLKAISLGQGQGVHAEKAIDEAQKQGTWVILQNCHLAPSWMPKLEKICEEMQ
NNSQNKEKINVNFRLWLTSYPSSDFPISILQNSVKMTNEPPKGVKSNMLVSFMSDQIQDQ
TFFETHSKPKQFKTLLYGLCFFHAVLQERRTYGPLGWNILYDFNQSDLRISVRQLYILLQ
EYQDIPYKALHYMVGECNYGGRVTDDRDRRILHALMQDFFSDQIFQQNFCFANDSNYIVP
PIGNHAEYIKFIEEKIPLNQSPSIFGFHDNGVIVKDLKETDDLCGALLMMMGGNSMNNTE
GDTETQLRAISQDILTKIPKKFDPELVSAKYPISYENSLNTVLQQEIIRYNNLTNVIVSS
LKEIENALQGIVVMSSNLEKVCNSLLKGLVPDLWKKSSYPSLKPLGSYITDLVKRLKYYQ
NWIDHDVPKCHWISGFYFTQTFLTATLQNFARKYTIPIDNLVFEFNFYGEPPENVNDAAQ
YIDITDGQLMYGLYIEGCKWDYDERCLAESDLKVLSVQAPIIWLKPTEISQVNSQQQIYK
CPVYKTSERKGTLSTTGHSTNFIMSIDMPTTISSSHWVKRGVAMLCQLSD


>TTHERM_00919540(gene)
ATGAAAAAGAATGCAACTCAGTAGCAACTGCGAGGGGCTTCTGAAACTAGAAAAAATACA
AAACCTGCCCATTATAATAGTAGTTAGAGTTTATCTATTTACCCAACTTAGAGTCAATAA
TAGCTGCAACAATAGTAGAAAACTCTTTCAGGAAGCATTAGCCAGTAAATGTGGATGTCT
AAATCAGACTCTGTTTAGGGAGAATTTTTTTTTGATAACTAGAATTATTAAGCAGGGCAA
TAACAAAAAGCATAAGATAAAAATTTGAGTATTCCCATGAAAAAATTTTTTGGCCATGCT
CCCTAATATAGGAATGCTAATTAAAGCCAATCTTAAACCAGTATAAATGCAAAAATTTAA
AATGTATAATAGAAGTTTTGGTAGGATGTAAGTAAGAGCGATAAATCTTTAATGCGTTTA
GAGTCGGGCAAATCTAGACCTGTAACTGCAGGTTAATTCAAGCCATTAACACGTGCATTT
TCAATGCCAAAATTCAAAAATGGTAAACACATTTATAAATATACATAGTATTGAAGTTCT
AAATTATGAGATGGACTATTAAATATTTTTAAAAACTTAAATTATATTTAAAAAATTAAT
AACTCAAATAAGAAAAACATTATGAAAACTAATCGAGCTCTATATTAATTTAAATATTTT
CTATTATTATTTTAATAAATAATATAATTTTTTAATTATAGAAATGCTTCAAAATCATAA
CCTATAATCAATAAAGCAAGAAGAAATAGATGAGAGAGAGTTTCCTCAATTTTAAGAAAA
TATAGCATATGAAGGATAAATATAAAATGCTGTTTAAAATTTGAATAGTTAGGTTAATTT
TTAAAGGTAAAGATTTATTTTAAATTTAAATTTTAAGATAATTACTACTAAAATGAATGT
AGAAGGAGAGTTTAATAATAAATAGATAACTGGTTTTAAAACAAATTTAAATTTTAAATA
TAGTTTAAAATATTTTTTAATAATAATTTATATTTTTATAGAATAGTAAATATTCATTAA
TAGCCCTTTTAGTTTTTAAGTCATGTGGGAGGAAAATATACAAGCATTAAAAATATTTCA
AGTGAAGAAGCTAACAATATAATCACAAAGGACCTTTTTCCTACGAAGATCGTTCCTGTT
TAGCAGATGAATCAATATGAATAGCTTCAAATGTTTAAAAAAATAGATATTGACAGGAAT
ATTAATGATTAAATATCTAAGCATGCAAAAGTTCCTACAATTATACGTCCTAGTACAGCA
ATATAATCTGCTCATAGCTAAGCAAAATCTACCAGTTAATCTCATGCTGATTAAATACCT
AGTGCTGTATTGTCAGGTAGACTTTCAAGCTCCAAAGGGAGAACATAGTCTTAAGCCACT
TTGTCTGCAAAGCAATAAACATAGGTTTAAGGTCTTCCACAAGCATAACAAAATTTTGGA
AAAAGTAGGAATATTTAAACAGCAACTGCTAATATGAAAGCACCTGGTTAGAAGCTTGAA
CATTCTTAATCTTAAAATACACTATCTTAAAAGAATTCATTACCTTCCTCTGCTAATTAG
TAAAGGTATACATTTTTTAATTTAATAGAAACATTCTTATCAAAATAAATGATATAGGTT
ACTTAGTGGAAAGTAATAGAGAATATAATCAGCAAAACCTGAGTTAATGAGAAGATTGTA
AGATAAGAATAAAGTAATTGTTGAAGAAATGAATTAAGTAGATTAGGAGTTAGATATTTA
AGAGGATGTCGTTGGTGATGATGAATTTTATAATCGTGCTGAAAATATTAAAGGTAAAAT
AGATGGAAAGATGCTATTAGACAATCGTCCTAAATCAAGTCTAGCAGGAAAGAGGCCAGT
TAGTGGAAAAGTAGCTGGAGCAGAATCTTTTTTTAAAGAGTTTAGAAAATATACTTCATT
TAATGCTTTAGATACTCCATATGAAGAATTATTTGATAGAAACGAACGTACTATTACAGC
TACATTTGCTAAGTTTGGCGATCTGGGATATTATTCTCCAGTACAAAGAATAGGAAGCTA
TATGCAATATTCTGCCAAGCTTAAAACTGAGCATCTGCTTGAAATCGTTTCCCTTCAGTA
AACAAGTACAAATATAGAAAAGCCTGAATGTGAAATTCCTATTTAATTAGCTATTATTGA
TGAGTTAAACCCTTATTAAAAGAAATCTAAAACTGGTATTTCAACAACTTTTACTCCTGA
AGATATGAAAAGAGAGCCTATATCATTAAGTTTGTTCCCTGAATATTTCCCAGAAACTGA
CGAAAATTAAACTCCATAAGATTCTGCTAATGAGTTGTTTTATGAAATGCTTTAAGAAAT
GGGAGGAACTTATGATCCTTTTAGTCTTGGAATTAAAAAATATCATTATATTGATCCAGT
TTTATGGCCTTAAAGTATAGCAAATTTAGTAGATTCATCTGTTAAAAGATATAATCACTA
TATTGAATCTGATATTATTAGAGCAGATGAAATACCTAAATTTAGAAAAAATTGGATGGT
CAATGCTTTTAATCTAATACCATAAGAGCTCTTGAAAAATGAGTTTACATCAAGATAAGT
AAAAATTATTTTTAATCATAGCAATTTTTAAAAATGTATTTCAAAAATTAATTTAGGTTT
TTTAAGAAATATTTGAAAATTTCAAAACAGCTATGAAAACAGCTATGCTCGATTATATTT
TAAGATCTCCTCAAGAAAGAGCTAGATTACATATACAGCTTGTTCCTAGAAAAGTATTAT
GCAGTGGTGAGCGTATTGCTAGAGAAGGTGGTTTTAATATTAATCTTTACTAAGATTGGC
ATAATTTTGTAGAATTTGGAAGAGAGTTTTGTCGTGGAAATTTAGTTTTAATGAATATAA
TTAATAGTTCCTTACAAAGTTGGTCTTATGAGTTTTCTTCATTGAGCTTATTTGAGTATG
AAGCTTTCAAAAGAGTTAGCACATTAGGATATACATATAGTATTGAATAATTTACAAAAT
TGTAACAAGTTTATCGTATGAATGTTATTTCTTTGATGAAAAATATATGGCATAGAGGTG
CAATCACTATTATAAAAAAATTTAAATATCTAAGAAGAGTTGATACATCCTATGGAAAAT
GGACATTAGGAGGTAATTAATAGTATTTATCTTTTTTAAATTTACATTTTATTTGTTAAA
AATTAGGGTTTAAGAAGCATATTAAAGAAACCAAATTTGCCCTCAAAAATGATAGAATTT
AGTAAAGATTAATGAATACTGGCAATATTGAAGAAATAGCAGAAGAAGAGCAATACGAAG
AAGATAGTAGATAAAGTCATAATAGAAGGTCAATAAGAAATCCTTTAGGTGAGAGCAATA
GAATACCTGAAGCTAGTGAAGGTTCTCCTTCAAACTAATATTATGGCTAATTTGATGATA
ACCATCATATGTATGATTATGGTGAAGAATATGACGAATTTGACTACCTAAATGAAAGTT
TGGCATACTTAATTGATATAGATAATGAAATTAACACTCCTGAAAATGTTTACTTTTAAA
TGCTTAAGTATAAAATTGAAAGAGAAGTATAAATATTAGATTAAAAAGGAGGTTATACTA
ATAGGCTAGATTACTAAGCTGAAATGAATCAATAAATGCAAGGAAGCTAAAATGAATTTG
ATTTCTATGATGACATTGAGTTTGAAGATTTAAAAGATATAAGAGACAATAGCGCTTATC
GTAAAATAGCATAAAAAACAATGGAGGATGAATAGGTATGGAGAGAAGAAAATGGATGGT
CTCTTTACACAAAAGAATATAAATCTAGAATTTTAGATAATGTTGGTATTCTGATGGGCT
TATAACTGCGTAAAATTATAGAAGAATCCTTTGCTTATTTAGAGAAAAAAATTATCAGTT
ACCCAACCTACCGCCGCTGGAAAGCCATATAAGCAAAAAAGAAGGAAGTAGGGTCTTTAG
ATTTTATAGAAGATAATATCTAATCTAATTGCGAGATTGACGAAGATGATGAAGAATAAG
AGGCTTCAAAAAGCGGGCTTGGTTTGGGAAGCAATGCTCCTTCAAATGACAAAAGCCCTT
ATGATCTAAACGGGCTTCTTCCTAATTAAAATTTAAAATCCAAATCTAGACTATTTATTT
TGAATTAAAGCATAAATAATGTTAGTGCAAGTGCAGCTTAAAATTCTAAATTAGATACCA
GCAAGCGTACATCATAAATGAGACTACCTTCTAATAATTAATTAGGAAGTAACTAAACAG
CTAGGCCTCTCAGCTCAAATAGATCAAGGGCTGGATTAAATGCTGATAAAAGCAGCTTAG
CTTACATACCATAAGATGGGATTAATACAGAGTCTAATATTAAGACTCTGATATAACTTT
ACCCTAAAGATAGCTAAATCTTTTATAAAAAGGCAGATTTTATGAAAGATCAAGATGACT
TATCACCAATATTATCTTTATCTTTGTATGTTGAAGAAGAGTAAATTAAATTTAGAGAAA
ATTCTGATTTAATCAAAAACGAATTCCGTAAATTATTTAATGATATGGTAACTTCATTTG
ACTAGTTTTTGCATCCTCGTTATTGTAAAGTCAAATTAGAAAAAAATTAGCAAACTCTAT
AGCGCGATACTTCATATATTTCAGAAGGCGCTTAAGGTAAAGACGAAAGGTCAAAATCTA
ATTAAAAGGGAGTAACTCGTAAATAATTTATGTCTAATGCACCTAAAAGCTTAAAGACTG
CTTTTGATAATGTTACTCCTGAAGATTTTGAGGCTAATTGCTAAGATAGATTTGATGAGT
TCTATAAAAAGTTCTGCAGCTTTGTACAAGTTTAAGAAAAATAAGCTAAAGTGGGTGGTT
AATAAGCAAATACATAAACAGAAGGTGATGAAAAAGATGCTCATGCCAGTAAAATTTATT
TCTAAAATATAAAAACTTAATATTTTAATTATAGCTAACAATAATTAAAACGATGAATTT
GCCAACAGAATCTTAAATAGTTTGGTAGCACCAGGACAGAAGAAGAAGAAATTCTTGCAA
ATGGCAAATTTCAACGAAGCCTACTTTGCAGGAGTTGTAAACAGAACTATTACACATATC
CTAAAGCATTTAGAAGAGAGTACAATAGTTTTGACTGTTTTTGATTAATTCAAGCCATTT
ATTGAGAAGTAAGCAGAAAGAGAAATAAGAAATGTTATTAACAAAAAATAAAATATGACA
AATGAAGAATTTAAAAATTACTATGAAATCTTAGAAAAGTTCGACAATCTCTCTGATTAA
ATTCCTGACAAAGTCAAATTAACATTATTTGATGTAAGATGTACAGATGTTAAATAATAC
ATCAAAAAGTAGATCAAGGATTTACAATAGCGCTTAATTTTTGCCTTTGAAGATATCATT
TTAACAACCCTAAGATCGGTAACTGAAAAATATTCAAGAATAGCAAGTTTTATTAGAAAA
TCAACAACAACTGCTGATGAGGTAACCAATAATTTACATATTTTATTTATTTTTAAGTTA
AATACTTTTAAAGGTAGAAGAAATGGAGAAATTTTTAGCAGAATTAACTGGCGATAGAAT
ACAAATCAAATTAAGGACAAGTGCCTGCTTTTAAAAAATAGTTTTCCTTCAAAAGTTAAA
TGTAAAAGGTAACTAACAAATAGCAGATTTAGCTAAAGATGTTCATGAATGGCCTGAGAA
ACTAGATAAAGAGCTTATTGCATAAGAAGAAAAACACTAAATTGAACGCTCAAGAATTGA
AGAAAAGCTAAGAGAGAAGAGAACAATATTTGAAAATAGAGTTAGTGTATATCTTGAAGA
TCTCAAAGATTTAGAAAAGTTTACAGAATATTATAAGCATAAGGATTATATAGTAGAAAT
TGATGAGTTTGAAAGACTCCTCAATGATGCTAAAGATCTGATGGAAGATATTAATGATCA
AGAAAAGAAGCTCTTTGGTATCAGCTCTAATTTTGAAAAATTTTTCACTTTACAATAAGA
TTTTGAGCCCTATCAAAAGCTTTGGCGTGCTATTAGCGTATTCAGTGAGAATAAAAAAAA
ATGGATGGGTGACTCTGCAAGCACTCTCGATTCTTCAGATGCAGAATCTATTGTTAAAGA
GCATAATAAAATTTCTAGTAAATTACTCTATGCATTCAGATCTGATTCGATTGCATCAAC
AATTAGCTAAAAATTCAAAGAAGAAGTAACACAAATGAGTGTATATCTTCCTGTAATTGA
AATAATATCAAGGCCAGGCATTTAAAAGAGACATTGGGATAAAATTTAAAAAGTAATTCT
TAACAATATAATAAAATAGTTAAATTTTAATTTAAAAATAGGTTTTAAGAATTCCTGATG
ATGAGTTTAACTATGATAAAATTTCTCTCAAGTATCTTTTAGCTAAAGGAATTCAAGAAA
AAATAACAGAAGTAGAAGAAATTTCAGAAAATGCATCAAAAGAATTTGGTCTTGAAACTG
CTCTTGATAAAATGGAGAAGGAATGGGAAAATTTATCATTTTAAATAGTAAATTGGAAAA
ATAGAGGGGTATTTATTTTGCAAGGTTCTTCAGTAGAAGATATCCAAATTTTGTTGGATG
ACCACACATTAAAAGCTTAAACAATCAGAGCTAACCCCAATATTAAATTTGCAGAGTAAA
GAGCTGTTAGATGGGAGAAATTAATGCTATTTATCTAGTCAGTTTTGGAAAACTGGATCA
AAGTGTAAACTCTGTATCTATATCTTGAGCCTATATTTAGTTTTGAAGATATAAGCAAAA
CTTTAGTCACAGAGACTGATAAATTTAATATAGTCAATAAAACTTGGAAATAGATTATGG
AATGTGTATAAAATGATCCTAAAGTCTTGAGTGTAGAAAAGATCCCTAATGTAGAAGAAG
AGTTAATTCATTGCCTAAAGCTTATTGAAGAAATCTAAAAAGGTTTAGAAGAACACCTTG
AGTAAGTTTGATATATTTACAACACATTTTAAATTTCATTTAATGAATAAAAAAGATCCA
AAAGATTAGAATTTCCTCGTTTCTTCTTTTTATCAAATGACGACTTACTTAATATTTTAG
CTGAAACTAGAGATCCATTGCTAGTTTAGCCTCATATGAAGAAATGTTTTGAAGGTATCT
CTGAGTTACTCTTTAATTACAATGTTGACATTACAGGTATGCGTAGTAGTGAGAAAGAAG
AAATTTAATTTTTAGAGAGAATTTCACCTCGTAATTTCAAGTCAAATGTAGAAAAATGGC
TTTTAGAAGTTGAAAAATAAATGAGAACTTCATTGTCTAAAGTGATGGAAGAAGGATTAT
TAGATCTCTAGTCTGGCTAAGAAAAAAGATCAGAGTGGGTAAGAAAGTGGCCAGGATAGG
TAGTTATAGCAATTTCATAATTAATATGGACTGAAAGTTTAGAAGAAAGCTTAAACTAGT
CAGGTCTAAATGGATTAAAGCAATTCTATGAGATTTGCTAAGGCGGATTAGAAGAAATAG
TTACACTTGTAAGATAAAATTTAACATATTTAGAAACAATTACTCTTGGTGCTTTAATCG
TAATCGAAGTTCATAATAAAGATGTTGTCAAGAGGCTTATTGATGATGAAATAAGCAACA
CTTAATAATTCGAATGGCTTTCAGAAATGAGATATTATTGGGATGCTTCAGTTAATAAAT
TGAATGTAAAGATGATGTCTACTTCTATGAGATATGGATACGAATATTTAGGAAACACTG
GTACAATTTAAATTTAATTAAATAAACATATTTTAATATAATTATTTTACAGGAAGACTA
GTTATCACTCCTCTTACAGATAGATGCTATCGAACTCTCATGAATGCTCTTTAACTTAAT
TTAGGAGGTGCTCCTGAAGGACCTGCAGGAACAGGTAAAACAGAAAGTACCAAGGATTTA
GCCAAAGCTATTGCTATGCAGTGCATTGTTTTTAACTGTTCAGATGGTCTTAATATACAT
GCTATGGCCAAATTCTTTAAAGGGTTAATAGCAACTGGAGCTTGGAGTTGTTTTGATGAG
TTCAATCGTATTGATTTAGAAGTTCTTTCTGTCATAGCTCAATAAATACTTTAAATACAA
TAATGCAAAGCTGCTATGAAAACAAACATATTATTTGAAGGAACTGAGCTTGTCCTTAAG
CACAGCTGTAATGTTTTTATTACTATGAATCCTGGTTATGCAGGTCGTTCTGAATTACCA
GATAACTTAAAGGCACTCTTTAGACCAGTAGCTATGATGGTTCCAGATTATTCGTAAATT
AAAATATTAAAAATTTTATTAAAAATAAGAAATTTTACTTAAAAAAAAGATTAATTGCTG
AAATTTCGTTATATTCTTTTGGTTTCGTAGATGCAAGAAGCTAAGCTAGAAAGATAGTAG
CTGTATATAAACTTTGTAGTGAATAGTTAAGTAGCTAAGATCACTATGATTATGGTATGA
GAGCAGTTAAAGCTGTTTTAACTGCTGCTTCTTAGCTAAAGAGAAAATATCCAAATGAAA
GGGAAGATGTTCTTATTTTGCGTTCTATTACAGATGTTAATCTTCCTAAATTCTTATAGT
AGGATGTAGATCTTTTTAAGAATATAACAAGTGACTTATTCCCTGGAGTTAAACTACCTA
ATCCAGATTATAACACTTTAAACACAGCTATGACTTCTGTCTTGGCTACTATGAATCTGT
AAAGTGTCTAAAATTTCCGTAAAAAAGTTCTCTAACTTTATGAAGTAGTTAACACTCGTC
ATGGATTAATGCTTGTCGGATAGCCATTTTCTGGAAAATCTAGCTGCTATAAAGTTTTGG
CAGCAACCTTAACATATGCCTGTAAGAAATTAGGGTCTTTAGATGAGTTACCTACAAATT
ATTACATTATAAATCCTAAATCAATATCATTAAACTTTTTATATGGGTAAAATAATTAAT
TAAATTTATTAATTTTTTAAACAAATTTAAATTTTATTAATTTTTAGTTACTCTGATCCT
GTTTCTAAAGAATGGACTGAGGGAGTCTTAGCTGAAGTATATAGAAAGTGTGCCACTGCT
ACTGTTCCTGATAGATAGTTTATAGTCTTTGATGGACCTGTAGATGCTGATTGGATTGAA
AACATGAATACAGTCTTGGATGATAATAAAAAATTGTGTTTAATGAGTGGTGAAACGATT
CCCATGTCAAATTCTATGACTATGATGTTCGAAGTTGCAGATTTGAGATAAGCTTCTCCT
GCTACAGTTTCTCGTTGCGGTATGGTCTATATGCAACCAGAATAATTAGGATGGTGGCCT
TTGGTACTTTCATGGCTATCACAGGTACTTATTTAGTTTATCAAATAATTAAAATATTTA
TTAATTTGAAAATAAAGATTTCAGAATTTTTAGATGAATCTCTAATTGAACACTTAAATG
AGTTATTTGATGCCACTACTGGATAATGTGTTCATTATATCAAAACGAGATGCAAAGAGT
ATCAGAACGTACCAGAAGGAACTCTAGTTGTGCAGCTTATGAGACTTCTTAGAGCCTTTT
TGCACAAATATAGATTTTTTGAAAAAGAATATATTTCTAAAATAAAGCTAGAAGTTGTTT
AAAACTCTTTAGATATGATTTTTATTTATTGTACTATATGGAGTATTGGTGCTACTATAG
ATGAAAAAGGAAGATAAGATTTTGATCGCTATTTAAAGTAGCTAATAAAAAATCCTTAAA
AATGCGAAACTAAAAAAGACAAACTTATTAAATTTGAGAAGTAAGCAATGCTACCTGAAG
CAGGTCCTCATGTTTTAGTGTACGATTATTATTTGGAATAAGAAGAAAGTGGATCATGCA
AATGGAAAAATTATCAATAAATTATAGATTCTGTTTCTGCAACAGACTCTATCCCTGCAG
ATGAATCTTATCATAATATTGTGATAAAAACAGCAGAATAGTTGAGATTAACGGAACTTC
TTTAAGTTGCCATTTAATATCATTATCCTTTCTTGGTGATAGGGTAAACTGGTACAGGAA
AGTCTACTTACATAAATACATATTTGAAGTCGCTCTCACACGAAAAATATTTACTTGTTG
GTATCAACTTCAGTGCTTAGACATCATCAGAAGAAACTCAACTGATTGTAGATTCAAAAT
TAGACAGAAGAAGAAAAGGTATTTTTGGTCCTCCTATAGGAGTTAGTTGTCTTGTCTTTG
TGGATGATCTAAATATGCCTTAACTAGATAAATATGGTGCTCAACCTCCTATAGAACTAC
TCAGATAATTTTTAGATTAGAAGGGTTGGTATGGAAAAGATAGAAAGTTTATGGAAATAA
TTGAAACTTCTTTGATTGGTGCTATGGGTCCTCCTGGAGGTGGTCGTAACTAAATAACAT
CAAGGTAACTAACTACATAATTTTTTAATTAATTTAAAAATAATAAATTATTGTTAATTA
AAGATTATTAAGACATTTTAATGTCCTATGCAGCAGTGAGCCTAATTAATTATAAATGGA
AAGAATTTTTACAGAGCTTATGAGCTGGTATATGAACAAAATATAACTTAATGATGAAAA
TCTAAGAAGAACTTTTAAGCTATGCATTGAAGCTACAGTAGAAATGTATATGAACATTGT
TTAAAACTTAAAACCCACTCCTGCTAAATGCCATTATCTTTTCAATCTTCGTGATGTAAG
TAGAGTTGTTTAAGGATTGCAACTAATATCTAAAAACTAAATTGAAAATGACAAAAAAGT
AAATATTTTTAAAAAATAAAAATACTTTCTTTAAACAATTTTAATAAAATTTATTTAGAT
AATAAGACTATGGATAAATGAAGTTAGCAGAGTATTTTATGACAGATTATCGTTTGAATA
AGATTAAGTTTGGTTTTATAATGCATTATGCAGTTCAATTAGAAATAAAATAAAAGAAGA
CATCAAAATGGTAATGAAAGGTCCCTATGACCATATAAAATATAATCTGCTTACTCCTGA
ACCTATAAAAGTCATTAGATTTGGTGAACTCTTAGGAAATGTAGATGGAGATAGATTCTA
TGATGAAATGGTATTTATTTAGTTCAAAATGAACATTTATTAACTTAATAATTTCTATTT
ATAAAATAAATTAGATTGATATGGAAAAAATATTTGCAAAAGTTGAATACTTTTTGGAAG
ATTACAACCAAAATAATAAAAGACCTATGACTTTAGTACTTTTTGAATTTGCAATCGGAC
ATATTATAAATATATGTAGAATACTTAGATTGCAAGGAGGACATGGACTTTTAATTGGTT
TGGGTGGTTCTGGAAGATAGTCACTCACTTATCTATCAGCTCATATTAGAGACTTAAGAT
TGACTTAAATTGAGATGAGTAAAAGCTACTAAAAGGAATAGTGGATTGAAGATATGAGAA
AAGTAATGATTCAAGCAGGAGTTGATAGCAAAGAATCAGTTTTTATTATAAATGATAGCC
AAATGTCTAAATCTTTTATTTTAGAAGACCTAAATAATTTACTTAATTCTGGTGACATTC
CAAATTTATTTTCTTAAGAAGATTTTATTCCAGTAATAGATAGATTAAGATAAAATGCTA
AAAAAGAAGGAAAAGTTAAACTTCTTGAATAAGGCACTAATTAATAATTTTATGATTATT
TTGTCTAGACTGTTAAGAAGAAACTCCATATAATAGTAACACAAAGTCCTATTGGTGATA
CTCTAAGAAATAGAATCAGAAACTTCCCAAATATTGTAAATTGTACTAATATTATTTGGT
ATAGATAGTGGCCAGAAGAGGCTTTGGATGCTGTCGGACATAAATTAATTTCTGAGCTGT
ATATATTTTTTCATTTTAATTAAATTTTAAATAAATTTTTAAAAATTAGATATTTAGATG
GTTCTATTAGTAGAAAATTAGTTAACACTTGCAAACATTTACATTAGTCTTCTTTAGATC
TTAGCTAAGAGTATTTAAGAAATGAGAAAAGAGTCAATTACATAACACCTTCTTCATATT
TAGAATTACTTCATAACTTGAAAATATTGCTTTAGTAACAAAGGAAAAAACTAGAAGAAA
ATCGCAACGTCTATTCAAATGGTGTTTAAAAATTAATTTCTACTGCTGAGTAAGTGAAGC
GTATGGAAGAAGAATTGATTGAAAAGAAACCTATCTTGATTTAGATGAATGAAGAAACAC
AAAAAATTGCATCTGAAATTAAAGCACAAGCTTTAGCTATGGAACCAAAGCGTATTCAAG
CAGAAAAGTAAGAAGAAGAAGTTAACGTAAGAGTGTAGGAAGCAGAGCTAATTAAGCAAG
ATTGTGAAAGAGAATTGAGTGTTGCAAAGCCTCAGTTAAAAAAAGCAGAAGATGCTCTAA
ACACACTAGATTCTAATGATATAAATAAAATGAAGGCAATGCTTAAGCCCCCAGAGACCG
TATAGCTTGTTATGGAAGCAGTTTGTGTGCTTTGCAAAGTAATTTTTTATAGTTAATTAA
AAAGTATCATTATGAAATAACAATAATTTACAAAAATAGGTACCTCCACTTCCTGTTCCT
AATCCTAAATATCCTAAAGAAAGAATTATGAGTTATTGGGAAGCTTCTAAGAAATTTTTA
TCAGATAAATATTTCTTAAACACACTTATTCAATATGATAAGGAAAATATTGATGAATAA
GTTATGAAGAAAGTGAGAGACAAATATATTTCTTAAACAAAATTATTTAATCCCAAGAGA
GTAGAATAGGCAAGTTCAGCCGCTAAAGGTCTTTGTGAGTGGATTTTAGCCTTGAGTGAA
TTTGAGAAAGTTTTGTAAATAGTGCGCCCTAAACAATAAAGATATAATTAATCCAAGCAA
GAAGTTGCTATTTTATAAAATGATTTAAAATAGACTCGTGATGAGCTTGCGTAACTCAAT
AAAGAAATAGCTAATTTACAAGATAGCTATGATTAAATTCGTAAAAAATAACAATAGCTT
GAAGATGATATCTTGGACTGTGAAAAGAAACTGCTTCGTGCAAGTTCCCTAATTGGAGGA
TTAGGTGGTGAACAAGAAAGATGGTTAAAAGTATCAGAAAAATTAGAAAACTAATTATAG
TTTGTTGTTGGAGATATAACAATATCAACTGGTATTATTTCTTATTTGGGACCATTTAGT
TAGACTTATAGAAACAAGTAAGTGAAAGCTTGGATAGATTACTGCAAGGGACTTTCTATC
TAGATAAGTGAAGGATATTCCTTAGAAAGTACGTTAGGAGAACCTATCATAATTAGAAAG
TGGAATATGAATGGTTTGCCTTCAGATGCTTTTTCAAGAGAAAATGGTATTATTACTTAT
AATACTAGAAGATGGCCTCTGATGATTGATCCTTAACAACAAGCTAACAGATGGATTAGA
AAAAATGAATTCGATAATAAAGTAACTGTTGTTAAATAATCCGATTCTAACTTTATTCGC
TCGCTTGAAACATGTATTTAGTTTGGCTAATGTTTGATTATAGAAAATGTTAAAGAAGAA
ATCGATTCAATACTTGATCCAATTTTATCCAAACAAACATTCAAAAACGCAGGTGTCCTA
AGCATTAAAGTTGGCGATAATATAATTGATTATTCAAAATAATTCAAGCTATTTTTAACA
TCAAAACTTAGAAGTCCTCACTTTACTCCTGAAATATCAACTAAACTAACTCTAATTAAC
TTCACTATAACTAAAGAAGGTCTTGAAGATCAACTTCTTGAAATTTGTGTTCAAAAGGAA
AATCCTAATGATGAAAACTAGAGAGTTCAACTTATCATTTAAGTATCTTTATCTTTTTTT
ATTTTATATTGAACTAAAATATTTAATTTTTATAAAATAGAATCACAAATATTAATAACA
ATTGGAAGACATTGAAAAGTAAATCTTGGAAGTTTTAAATAAAGCAGATAACATTTTAGA
TGACGAATAAGGTGTTTAGGTCTTATAGCAATCTAAATAAGTTTCTAATGATATTATGGA
AAGATAAGAAGATGCTAAAGTAACTGAATAAAGACTTGAGTAGTCAAGACAAGAATATAA
GCCTATAGCAAATCACAGTGCAGTTCTCTTCTTTGCTATTATGGATATGGCTTCATAAGA
TTTTATGTATTAATACTCACTCAATTGGTTCATAAACTTGTATATTGACTCATTTGATAA
AGCAGAAAAGAGTAAATCAGCTAAAGCTTAAGATAGAGTAATTGCTGTTAGCTAGTACTT
AACATATTCTATATACTCTAATGTTTGCCGTTCATTATTCGAAAAAGATAAATTATTATT
TAGCTTCTTACTATTATTAAGAATTTAAGAAAATAAAAAACATATAGACAATAATGAATT
AAATTTCTTGATTTCTCCTATTGATATTTCTTCTGAAGATGTGATTAATTCTGCTCATGA
TTTATAAGAAAATCCAGCAAAATCATTTTTACCTTAGACAACATGGTTGAGAATTGTAGC
TTTATCTAGAATTTCTCCAAAATTCAAACCCTTACCACAATCTATTAGCGATGATTTATA
ATTCTGGCATAGCTTTTATTTCGATAGTTAAGCTCATACTTTAAAATTACCCGTTCCATT
TAATGGTTGTACATAAATGTAAAAAATATGTATTATCAAAGCCATCAGACCAGATAGAGT
TAATTTAGCAGTGCAAGACTTCATCAGAGCAGGTAATTAGAAATAAATGATAAAAAAGTT
AACATATGATTAAATTTTTTTTATTTATAATCAAATATAGATTTAGGTGAAAAGTTCACA
TCACCTCCTCCTTTTAATTTATAACTTAGTTTTAATGATTCTAATTGCTACTAGCCTTTA
ATCTTCATCCTTCCAGGTACTGATCCAATGAATAATTTAATTAATTTTGCTGATTAAAAG
TAGAAATATTTGAAAGCTATATCACTTGGTCAAGGATAAGGCGTTCATGCAGAAAAAGCT
ATTGATGAAGCTCAAAAGTAAGGAACTTGGGTAATTCTTTAAAATTGTCATTTAGCTCCT
AGTTGGATGCCAAAATTAGAAAAAATTTGTGAAGAAATGCAAAATAATTCACAAAATAAA
GAAAAAATTAATGTAAACTTTAGGTAAATTTTAATGAAAATTAAGTTTTAATTAGAATTC
AAATTACCATTTTTATTTTTAGATTATGGTTGACAAGTTATCCCAGCTCTGATTTCCCTA
TTTCAATCTTGTAGAATAGTGTTAAAATGACTAACGAACCTCCTAAAGGTGTTAAATCTA
ATATGTTAGTTTCCTTTATGAGTGACTAGATTTAAGATTAAACATTCTTCGAAACCCACA
GTAAGCCTAAGCAATTTAAAACTCTTCTTTATGGACTTTGCTTTTTCCATGCAGTGCTTT
AAGAAAGAAGAACTTATGGACCTCTTGGTTGGAATATCTTATATGACTTTAATTAATCTG
ATTTGCGTATAAGTGTGAGATAATTGTATATCTTATTGTAGGAGTATTAAGACATACCTT
ACAAAGCTCTTCATTACATGGTTGGTGAGTGTAATTATGGTGGAAGAGTAACAGATGATA
GAGATAGAAGAATTCTTCATGCTTTGATGCAAGATTTCTTTTCAGATTAAATTTTCCAAT
AAAACTTTTGCTTCGCAAACGATTCAAATTATATTGTAAAATTATGATTTAGTTGTAAGT
TAATTATTTATAATTATTTATTTTCTCAATAGGTTCCTCCTATCGGTAATCATGCTGAAT
ATATAAAATTCATTGAAGAAAAAATTCCTCTTAACTAAAGCCCAAGTATATTCGGTTTCC
ATGACAATGGTGTAATAGTTAAAGATCTTAAAGAAACAGACGATTTATGTGGAGCTCTTT
TAATGATGATGGGTGGAAATTCTATGAATAATACTGAAGGAGATACAGAAACATAACTAA
GAGCTATTTCATAAGATATATTAACAAAAATACCAAAGAAATTTGATCCTGAGTTAGTTT
CAGCTAAATATCCTATATCCTATGAGAATTCTTTAAATACTGTTCTACAATAAGAAATTA
TAAGGTATAATAATTTAACGAATGTGATAGTGTCTTCTCTTAAAGAAATAGAAAATGCTC
TTTAAGGTATAGTTGTGATGTCTTCTAATCTTGAAAAAGTAAATTTTTCACATTTAAAAA
AATAATAATAAAATAATTAATCTATTTATATAGGTATGCAATAGTTTGCTTAAAGGTCTT
GTTCCTGATTTATGGAAGAAATCTTCATATCCTTCATTAAAACCATTAGGATCTTACATT
ACAGATTTAGTGAAGAGATTAAAATACTACTAGAATTGGATTGATCACGATGTACCTAAG
TGTCACTGGATAAGCGGCTTCTACTTTACACAAACATTTTTAACAGCAACTTTACAAAAC
TTTGCTCGTAAATATACAATCCCAATTGATAATCTAGTTTTTGAATTTAATTTTTATGGT
GAACCTCCTGAGAATGTGAACGATGCAGCTCAATATATAGACATCACAGATGGTTAGTTA
ATGTATGGACTCTATATAGAGGGATGTAAATGGGATTACGATGAAAGATGTCTCGCTGAA
AGTGACCTTAAAGTTTTATCAGTATAAGCTCCTATTATATGGTTGAAACCAACTGAAATA
TCTCAAGTAAACAGTTAATAGTAAATATATAAGTGCCCAGTTTATAAAACATCAGAAAGA
AAAGGTACTCTTTCAACAACAGGTCACTCTACTAATTTTATAATGAGCATAGATATGCCC
ACGACTATTAGTTCTTCACACTGGGTAAAGCGCGGTGTAGCTATGCTTTGCTAATTAAGC
GATTGA