Identifiers and Description

Gene Model Identifier

TTHERM_00252430

Standard Name

DYH11 (DYnein Heavy chain )

Aliases

PreTt25325 | 22.m00270

Description

Heavy chain subunit of ciliary single-headed inner arm dynein (IAD)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00252430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_80070
WormBaseWBGene000004859.997093137033517e-262locus:che-3 Cytoplasmic dyne
in 2 heavy chain 1 status:Pa
rtially_confirmed UniProt:Q1
9542 protein_id:CAA99830.2
Tetrahymena borealisEI9_10445.19.997093137033517e-262dynein heavy chain family prot
ein (4239 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig17454.0.g509.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  2. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  3. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  4. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_00252430(coding)
ATGAGTAAAAGACCTTCAAAGAAATCTCTTGGACCTTTATACAAGATCAATTTTCCAAGA
TTTTAGTTCGAAGAAGCTGATTAAGAAGAAAAATTTGTAGATTAAGCAATAATAGCATAT
TAATAAGGAAAGCCTGTATAGAGACAAACTCCAACTAGGCCATAGAAAAATTAAAAACTA
CCTCCTTTAGAATAAAATGATATCTTTAGTCCTAAATTTAGTGTTGAGTAATCTAATAGC
ATTATGAGTAATGGTAATAAAGGTTAATTGAGATATAATTAATCAGAGCATAATCTTTAT
TAGAGTCTCTAAATACCACTTTAGCAGTAATAATTATAATCATAGTAAGACCCATTTCCA
ATAGTAAGAACCTCAGGAGCAGGTGGTTCATTAAGCATGACAATAGATCAAACATAAATG
CAAAAGAATCTTTTAAATAAACCAGGACGTAATTTAAAGGTCAACTAATCTTAAAAGATT
TCTACACCAACTCAGTAGATTTAAAATCAATAAGTTAGCTCTAAACTACTCGGATTATAG
TAAAGCTAAGCAACTCCTCTAAGAGGGGCTGACGGTTACAAATAAACAGATAACAGCTTC
TCTCATAATTACTCATCTCTCGCAGGTGGAAATTAGCCTTACTCTCCATAAATATCAAAG
AAGGCTCTCCATACGCATGGTGAAGAATAGAATTTAGAGGATACAGGAAAAGATTTTGCA
GATAAAGGACTAAATACTAATAAAAACCTTCGTAATTATGACTGTTGGGATGAAGAAACT
ACTCCCTTACAATGGCTTGAAAAATTCAAAAAGAATCCCTAAGGCCCACATGGCAAATGC
CCTATCTATTTAAATAAATAGTATGTGTGGACTGATGTATAAGTTTTAGATTATGATGAA
AATACCGATAAATATTTGGTAAGAATTATTGCTACAGATCAATTAAAGCATGTTGTAAGG
TTATCTTTGATGTTCAATGAAGAAGATTAAACTAAATTTAAGGAAAGAGTTGACCTCTCC
AAGTCAAGATAAGTCAATGCAGAAGATGCCTTAAGATTTGACAAATATGTAAATAAAGTG
TCTGATGATCTCATTTAGCCTATGTCTGCTGAATGGAGAAAGCAAATTTTTAATTTTGTT
ACAAAAAAACCAAAGCATAGTTAAGAGGAAAAAGTAGAAGAAATTTACAAAAGCAAGTAT
GTTCAAGAGTTATTTGAAGATGCTGAGAGACAATATATTTTTTTCATCAAAAAATGCTAT
GTTTTGAAGGAAATGGCTGACCCTAAGAACGAACAAAAATGGCAAAAATATAGAATTAGA
AATAGATACGAAGAAAAAATTCTTCCATTCTATGGCACATATGTTTAGCTTTAATATAAT
TATAATGAAAATTAGGACAGCTTATCAAAATTACATGTCTCAAATAAATAACTAGTTGTT
AAGACTTTGAATATGGTCACTCATAGAACATTTTTATATGAAAACCACAAGCTTATAAAT
ACTACTTGGAACGAATAATAATTACCAATACTCTTATCTAATTTTGATTAGCAACAAAGA
GCTTATCATATAAGCTCAAGGTCTACTTTACAAATGTAGTGGAGAGAATACATAATTTCA
GAAATCTAAGATACTCTTAGAGATATTTACAGATTCTATCAAACTGAATCTAAGCTCTAC
TTTGGTTCAGATCTGTAGAGACTTCTCAAACGTATTGATTTAATGTTCAACACATTCATG
AGAGAAAATGTTGTTAAGGGAAATATAAATGATTATTGCAAATTTATTTAGAAATTCACA
ATTCCTGAATAAAACGATGAAAATATATGGCACATTAATAATTTCCCTCTGTTGATTTTG
AATTTGTAGCTTAATTAGAAGCCAAAGAAAAAAGGTAAAAAGCCTAATAAAGACAGAAAA
GAAGAAACTCCAGCTTCATAGTAAAAAGAAGAATATGAAGAAGAAGATATTATTTATTAT
GAACCTACTTACTAATAAATATGCTAGACTTTAATGAAGCCTTTTGATTGGATAGTTGAA
TCTGTTAATATGTTCTTTATGTTAGAAAAAGATCTAGTTCCTCTAATTGATTTACCCAAA
CTTCCCTCATTCTAAATCGATAATTAATTGTAATGGATAAAGGAAGGATAGGAAAAGGTC
CTTGAATACATCAAAGTTGGATATGAAGAGCCTAATGAAATTTTAGAGAGATTCAAAAAA
TATTAGTTCTTGATGGAAAAAAGTATAAGCAATGTCACAAAATAATTATTCGGAGAGGCC
AAAGAAAAACCTCTTATTTAAGACATAAATCCTCAAGATGTTGATCTAAAAATATAAGAG
TATTTTATTGCTAAAAAAGAGATAGAAAAATAATGTATTGATCAAAAAAATTGTCATTTC
TTCCAAGTCAGGACAAAATAAGCTAAGAATGATTTAGTCCATAAAGCTGATGAATTTGTT
TAAAGTATCTTATAAAAAGTTGATCTTCTCTGCTTTGATAATATCGAACGCATCTAAAAA
ACATATGAGGACATTTGTGATAAATTGAAAAAGACTCCTCAGAATGAAGAGGAATTAGTT
GCTTTAAAGGCCTAGATTAAAGAAAATGAAGTTAACTTAGCAAAAATTGCAAACGAAGTA
AATTGTGTAGGAGAATTTTTAAAGATTTTAGAAAAATATTGCTACAGCTAAAAAGAAGTC
AGCACCGAATAATTCTTCCTTTTAAAAGTTTAACCTGCTACTGTATTAGAAGCTGCTATG
GAGGGAAATAGAACTTATGAAATATATGAATCTAAATTTAGAAATAATTTAGAAATAGAA
AAAGATGGTTTCTAAAATACTATAGTTGATATTCAAAAGAGATTTTAGCACATTAAGCAA
TATAGATCTTATAATGCTTCACTTGATGTTAAAGAAAATTATACTGAAGTTGCTAATTTT
GGTGAATTAATTCAATAAGCTAGTGAAAAGGTTAAGTCATTTAACAGTAGAGAAGCACTT
TTTGGTGATGAAATCTCTATTTGGGATGAATTAGATAATGTTGCCAAAGAATTTGATCCT
TACCACAGACTTTGGGATATCCTCTTTAATTTTACTAATAATTATGAAGAATGGACTAAT
GGATCTTTCTTGAGTCAAAGTTATCATGAAATAGAAAAAACTGTTAACAGTAAATATTAC
TTAGAAGCAAAAGCCCTTCTGAAGAAATTTAGTGATGAAAACGATCCTTCAAGTGACGAG
AGACCTGCTTAGCTCTCAGAATAATTATTAAAAGATATTCAAGATTTCCGTCAAAAGTTG
TGGATTTTCGAATTATTGACAACCGAAGCTATGAGAAATTTGAAAAAACCTATGGTCTAA
TAGCATTGGGCTGAAATATTTGAGCGTTGCAATGTTTAAGGCAAACAAATGACAGAAGAT
ATGACTTTCATTCAATTATTGGCTGTATTGAATCCAATTAAGGAAGTTATTGAGGAGGTT
TCAAGAAAGGCAGAAAAGCAGTATCAAATAGAAAAGAAATTAAAGGAAATGGAAGAAACT
GTCAAAGTTATTAAATTAGACATTATGGAATACACAAAAAGTAAGAAACACACTTTTGTC
TTAAAAGGAGTTGATGAAATTTAACAAATTTTGGATGACCAGCTTAACATTCTCACTATG
ATGAAGGCTTCACCTTATATTAAAAATTTGAAGAGAATTGCTGAACCCTTAGAATAAAGA
TTAGTTTTTGTATAAGATACTTTAGAAGGATGGATTAAATGTTAAAGATCTTGGATGTAT
CTTGAGCCAATTTTCGCTTCTGAAGATATCAAAAAGAAAATGGAATTGTAGAAGTAGAAA
TTTGATACAGTTGATGATTTTTGGAGAACCACTATGGAGTCATTTGCTAAAGAACCTGGA
CTTTGGGAAGGCATTGAAAATGATAGACTTAAAAACGAATTTAATTAACACAATAAGACT
TTAGATGAAATCCAAAAGAAATTATCTGATTATTTAGAATCTAAAAGAAGAGATTTCCCT
AGATTCTTCTTCTTGTCTGATGAAGAATTACTAGAAATATTAGCTGACACTAAAGATCCT
CAAAAGGTGTAAAAACACATTAATAAATGCTTTGAAGCTATTAGTAAGCTTGATTTTTCA
TCGAAAGAAGATGTGAGTGGTATGATATCAGCTGAATAAGAAAATGTTAAATTCAATAGT
AAAATTAATGTTAACGAAGGTGACAAAAAGGGTAATGTTGAAAAATGGCTTGGTGAAATT
GAGCAGATGATGAGAAACACATTAAAACATATTACTAAAAACGCTATGATTGATGAAGCT
ACAGCTAGAAACGATTGGGTTCAGAAATGGGCTGGATAAGTAGTTTTGGCAGTAAATATG
GTCAGGTGGACAAGAGGAGCTGAAAATGCTATTTTAAATAGTAGAGGCGATGAAGTTGAT
GATGGTATTTATACTTATAGTAATCTATCAGATTATGTTGATTTTCTTGAGAATTAGTTA
AAAGATACAGTATAGCTTGTTAGAAAAGACCTAACTCCCTTAGCTAGATTAACTCTTGGT
GCTTTGGTTGTTTTAGATGTCCATGCAAAGGATGTTATCGTTGAATTAAAGAAAACTGGT
TGTACATCATCTTAAGATTTTAATTGGATCTCTCAACTACGTTATTATTGGGAAGAAAAG
CACAATAAGCCAGATCTAAAAGTACAAATGATTAGTGCAAACTTAAGTTATGATTTCGAA
TATCTTGGAAATTCAACACGTTTGGTCATTACCCCTCTTACTGATAGATGTTACAGAACT
CTTATGGGAGCTTTCTAATTATAGTATGGAGGAGCTCCTGAAGGTCCTGCAGGTACTGGT
AAGACTGAAACAGTAAAGGACTTGGCTAAGGCTTTGGCTGTACAATGCGTAGTATTTAAT
TGTTCTGATGGTTTGAACTATGTAGCTATGAGAAAATTCTTTAAAGGTTTAGCATCTTCT
GGAGCTTGGTGCTGTTTTGATGAATTCAATAGAATTGATTTAGAAGTTTTGTCAGTTATT
GCATCTTAGGTTCTAACAATTTAAATGGCAATCAGGAGCAATAAATCAAGACCAAAAGAA
ACTTTTGAGTTCGATGGTGAAGAAATTAAGTTGGTTGATACATGCGCCATTAATATAACT
ATGAATCCTGGTTACGCAGGTCGTTCTGAATTACCAGATAATTTGAAGAGTTTGTTCAGA
CCATGTGCGATGATGGTTCCTGATTATGCTATGATTTCAGAAATTTATTTGTATTCAGTT
GGTTTTGAAGAAGCCCGTAACTTAGCTAGAAAAATCGTTGCTTCTCTTCGTTTAAGTAGC
GAACAGCTTTCCAGCTAAGATCACTATGATTTTGGTATGAGAGCTTTAAAGGCTATTTTG
ACAGCAGCTGGTAACTTAAAGAGGGTTATGACTGATAGTGAAGATATTATTTGCTTAAGA
GCTCTAATGGATGTTAATTTACCTAAATTCACTATTAATGATATTCCTTTGTTCAAATCT
ATAACAAGCGATCTCTTCCCTGGAGTTGAACTACCTTTCATTGATTATGGCGATCTTCTA
GAATCTTTGAAAAATGCCTGTAAAGAAAGTCAACTTTAACCAAAATAAAACTTCTTAAAT
AAGTGCATTTAATTGTATGATACTATAAATGTCAGACATGGTTTGATGGTTGTTGGACAA
GCTTTTTCTGGTAAATCAAGTATAACACGTACTCTATAGAATGCTCTATCGGCTTTGAAA
GGTAAAGGAGATTTCTAAACAGTTCACACTCATAATCTTAATCCAAAATCCATAACAAGT
GACTAATTGTATGGTAAGCTTGATCCTGATACTAAAACTTGGGCTGATGGTGTTATTGCA
ATTATTATGCGTGTTTGCTCATAAGATACAAGTATGGACAAGCAATGGGTAGTATTCGAT
GGACCAGTTGATGCAGTTTGGATTGAAAATATGAATACAGTCTTGGATGATAATAAAAAA
CTTTGCTTAACAAGTGGTGAAATTATTAAGCTTACTAATTAAATGACTATGATGTTTGAA
GTAGAAGACCTTGCTTAAGCTTCTCCTGCCACTGTATCTAGATGCGGTATGGTCTTCCTC
GAAACTAAATAACTTGGCTGGGATCCTCTAATTAAGAGCTTTATTTAGCAACTACCATCA
AGTTTAGACAAAGTAGCTGATTAGTTTGAAAAAATATTAACATGGTTAATTGACTGTTCT
ATGAGTTGGGCTATGCGTCATGGTAAATTCTTAGTGCACAAATCAGAAATGACACTTGTT
GGAAGCTGTCTAAAGTATTTAAAAACGTATATTAAGGAGTATGGCGAAGAAAACGTAAAA
GTACAAAAAGATATTGAAGATATTTTAGCAAATGTCAGTCTTTTCTGTGTTATTTGGTCA
ATTGGTGCTTGCTTAGAAGAAACTACAAGAAAGCCTTTCCATCAATTCATAACAGAATTA
ATCCATGCTAGCAGTGAGATTCCTGATAAGTATTAAATAAAATATGATCTAATGTTCCCC
TTTGAACCACATTCGATTCGTGCCAATATTCCAGACAAGAGTTCTATCTTTGATCTTTGC
TATGATAAAAATAAAGGTATCTGGGTAAACTGGACATAGACAGAAAAGAAATTTGAAATT
CCCAAAGGTGGTGAATATCATAATATCTTTGTACCCACTATAGACTCTATAAGAAATAAT
TTCTTCTTACATAGATGTGTTTAAAATTAAATTCACCTTTTAGTATGTGGTCCTACTGGT
ACTGGTAAAACAGTGAACGTGATAAATGAATTAAATAAGCATTACCTAAACCCTGAATAT
TCAAATCTATAAACTGCTTTCTCTGGCTAAACAAACGTTAACTAAGTATAAAGATTAATT
GAATCTAAAGTATGCACAAGAAGAAGAAAAGGTCACTTTGGACCTGAAGAAGGCAAAAAA
TTCATAGTTATCTTCATAGATGACTTAAATATGCCAGCTAAGGAAAAGTATGGTGCATAA
CCTCCTATTGAATTATTAAGATAATGGATGGATAATGGTGGTTGGTATGACTTAGCTGAT
AAAACTTGGAAATATCTTTGTGATATTACTTTTATCACAGCCATGCTTCCTCCAACAGGT
GGACGTAATACAGTAACAATGAGATACATGAGACACTTTAACTTGCTTTATGTTGAATCA
TTTGAAGCAGAGTCTCTTCATAGAATTTTCTCTAATTTACTTGATTGGTACTTCTTAAAT
CAAAAATAGGGTGTTGGAAAAGCAATTGAAAATTTGAGAGACAGCATAGTCAATAGTACT
ATTGAACTTTACTAAGGAATTTAAAATTCTAAATAATTACTTCCAACTCCTGCAAAGTCA
CATTATATTTATAACTTGAGAGATATTTCCAAAGTCTTTTAGGGCATTTCAAAGGCAACT
TCTAGATCATACAAAGATGAAAACGATTTCTTAAAACTATGGGCTCATGAATGCATGCGT
GTGTTTTAAGATCGTATGATTAATAGCTCTGATTAGTAAGTCTTCGAAGAAATCTTAAAA
GAAATAATGCGTAAAAATTTCCGTAGAGAATGGAAGGATTTAGTTACTGTTGAACCTTTA
CTTTGGGCTTCGTTTGTTCCTACCCTTTACCCTGATGGCGATACAAGCAAAAGAAGATTG
GCAGATATTTATTGCGAACTTAGTGACAGAGAGGAGTTGAAAAGAGTTTGCTATGACTAA
TTAGCTTAATTCAATGACTCCTATCCTTAGAATAAGATGAATTTAGTTCTCTTTATGACA
GCCATATAGCACATCATAAAAATAGTTCGTGTTATTACTACGTCTTTCGGGCATTGCTTG
CTTGTTGGTGTTGGTGGTAGTGGCAGAAAGAGTTTGGCTACTTTATCAGCTTTTATTGCA
TTTACAAACGAAATTCAAACTATCGACCATAAAAGCGATATAAAAATTTGGATTGAAGAG
TTGCAAAAAGTCATGAAAGTTGCAGGTGTTGATAATAAACCCACAACACTTTTGTTCTCT
GACACCTAAATTTTCTCAGAATCTCTTCTCGAAGATATTTGTAACATTCTGAACAATGGT
GAAGTTCCAAATTTATTCCCTCCTGAAGAAAAAGCAAAAATTATGGATGAAATTAATGAT
CCCTCAGCATAAACTAATAATTAAAAATACTAAGTATTCTTGGATGCTTGCAAGAGAAAT
TTACATCTTGTGTTGGCATTCTCTCCTGTTGGTGAAGCATTTAGAAGAAGATTAAGAACA
TTCCCAACTTTAGTTAACTGTACTACAATTGATTGGTTCCTGCCATGGCCCGAAGAAGCA
CTGAGAAATACTGCTTCTTCTCACTTTATAAATGTAATGAAAATTGAATCTGAAAGCACA
AGAGATGGTTTGATAGAAATTGTAGTTGATATGCAAACTCGTATTTCTAACATGTCTATA
AGATATAGAGAAGAATTACGTAAGTATTATTATGTCACTCCAACAAGTTATTTAGAGCTT
CTTGCTACCTTTGAACGTATGCTCAAAGAAAGATAAACATCTATTTAAAATACTATTTCA
AGATACGAAACAGGTGTTCTAAAAATTGATACTACTGAAAAAGATGTAAATATTATGAAA
AAAAGATTAGAAGAATTGAAGCCATAGTTAGAAATAAAAACAGAAGAAAATTAAAAAATG
TTAATTAATTTGTAGAAGAAATAAAAAGAGGCTGATGCTAAGAGAGAAGTTTGTGAGTCT
GAAGAACGTGATTGTAAGATTTAAAAGGATAATGCCAACGCCCTGAAAGAAGATTGTTAA
AGAGAATTAGACAAAGTGCTTCCTATTTTGGCTGAAGCTGTTAAAATTTTATCTAAAATT
AGTAAAGATGATATTAACATTTTGAAATCCTTCTAAAATCCATCTCCTTCTGTTGTTCTT
GTTTTCGAAGGTCTTTGTTATGCATTTGATGAAGATCAATTCGTAAAGTCAGTACCTATT
GCACCAGGTGCAATCGAAAAGAAAAAAGATTTCTGGGATTACTCTAAAAAGAAGCTTTTA
AATGATAAATTGCTTTCTAGAGTTCGTGATTTCGATGATTCTAAAATTCGTGCAATTAAT
CCAGTTAAAATTGATTAATTAAAGCAATTTATAAGCAATCCATTATTTGATGAAGATAAG
ATCTAAAATGCATCTTCTGCTGCTGCAAATCTTTCAAAATGGATTAGAGCCGTTGTTTAA
ACATACGATGCCCTTTTAATTGTAGAACCTAAAAAGAAACAATTAGAGAAAGCAGAAAGC
GATCTCCGCTAAGCTGAGGAAATTCTTAATGTAAAGAAAGCTGCTTTATAGGAAGTTCTT
GATTTGCTTGCCAAACTTCAAAGTGAATATGATATAGCTAAACGCGAGAAAGAAGAATTG
CAAGCTGAAGTTACAAAATGTGAAATCTAATTAGATAGAGCAGAAAAATTAATTAATGGA
TTAGGTGGTGAAAAGAATTCTTGGAAATAAAAAGCTATTTCAAACAGAGAAGAAAGTACA
AGTGTAATCGGTGATTGCGTCTTATCTTCTGGTATCATTGCTTACTTAGGTGCATTCCCA
ATAGCCTACAGAGAAGAAGCCATTCATAATTGGAAAGAATTATTGCTTAAATATAAAATT
AAATTCTCTAATGACTACTCTCTATAAAAAATTTTATGTGATCCTATCACAATTGGTTAA
TGGACAGACAAATATCAACTTCCAAATGACTCATTCTCAATTGATAATGCTATCATTTTG
AATAACTCTTAGAGATGGCCCTTAATGATAGATCCTTAGATTTAAGCAAATAATTGGATA
AAGAAATTAGAAGGTGAAAGGTTGCTCATTTTCAATCCTAATTCTGATCCTAAAAACGTT
TTACTTAAACTAGAAAACTGCATACCACTAGGTACTCCTGTCTTGCTAGAAAATGTTAGT
GAAAACATAGATTCTTTATACGAATCTGTTTTATTGAAAAAGCTAACAAAGAAAGGTAGT
AGTTATACTATGAAATTTATGGAAAAGCAGATTGAATATCATGAAGGCTTCCGCTTTTAT
GTTACAACTAAATATCCTAGACCCCATTATCCTCCTGAGATTTGTGTAAAAGTAACTTTG
TTGAATTTCTAAGTCACTCCAGAAGGACTTGAAGATCAAATGCTTAACATCACAGTAAAG
CAAGAAGATCCCCACCGTGATTAAATTAGAGAAAAGAATATTGTTGAATTCTTCTAAAAC
AAAGAAAGATAAAAACACACTGAAGATATGATTCTTCAAATGTTGTTCGAATCAACTGGT
AATTTGTTAGATGATGAAAAGCTGATCGAACAATTGCAATAATCAAAGAAAGATAATATA
GAAATTTAAGATAAATTAAAACGTTAAGAAAATGACAGAGAATTATATAATTAAACAAGA
AACTCATTTAAGGAATTAGGTAAGAGAGTTGCAAACTTGTATTTTGTTGTTTTAGATTTG
GCTCTCATAGAACCTACATATCAATGGTCTTTAGAATTTTACATAGAACTATTCTTAAAA
GGTATTAAAACAGCTGCTCCAGCAAAGGACAATAAAGAGAATAGAAGCAAGAATATTATT
TAGTAATTCTAGATTTTGCTTTATGAAAGTATATGTAGAAGTCTTCTTGAGAAAGATAAA
TTGATTTTCTCTTTCTTGATGTGTATGAAAATTTTAGAAATTGAGAAAAAAATAAATTCC
TAAACTATTAGATTCCTAATGGTTGGAGGAACTTGGACTTCTTGTGATCACTAGATGCCA
TAAAAGGCTTAATCATGGCTCTCTAACAAAGCATGGTGTATCCTAAATGAGGCTGATTCG
GTTTTACCTCAGTTTAAAGGATTTGTAAAAGAGTTTGAGCACTATATTGATCATTATAAA
AAATTGAATGAGCATGAAACCCCTTATGAAGAAGAATTCCCAGGAGCAGTAGCTTAAAGT
TTACACTATTTCTCTAAGCTCATATTAATTCGTGCTTTATTCCCTGATAAATTCTCTAAG
GCAGTATAAAAATTGATTATTACTGAAATGTCTGAATAATATATTTAGCCTCCTCCTTTC
AATTTAGACTAGACATATTTAGACTCTCGCTTTGATAAACCATTAATATTTATTTTATCT
CCAGGAGCAGATCCTCGTATAGAAATTAACACTCTTGCTACAAAATTAGGAATATAAACT
GATAGATTCAAATAAATCTCTCTAGGTTAAGGTTAGGGAGAATTAGCTGAAAAATCAATC
AGAGCTGCTTACTAAGATGGTAGCTGGGTCTTATTATAAAACTGCCATCTTGCTCCTTCA
TTCATGCCTAGGCTTGAAAAAATTTTAGAAACATATCCAGAAGATGTTGATAGAGAATTT
AGAATTTGGTTGACATCTATGCCTTCAGATGTATTCCCTCCTTCTATTTTGATGAAAGGT
ATTAAAATGACTTATGAACCTCCAAGAGGACTCAAGAATAACTTATAGAGAACTTATGCC
TCATTTAAGAACCAAGATTTCGATACTAATTCTAAACCAGCTGAACTTAAAAAGCTTTGT
TTTGGCTTAGCTTTCTTCCATGCTCTTATATTAGAAAGGAGAAAATATGGACCTCTTGGT
TGGAATATTCCTTATGAGTTCACTGTTGCAGACTTTTAGATTTCTTAGTAATAGTTAAAG
GAATTCTTAAACAAGTACGATGAAATTCCATACGAGGCTCTAAATTACATGGTTGCAGAA
GCCAATTATGGTGGTAGAGTTACTGACCCTAAAGATAGAAGACTAATTAAAATTATTCTG
AGAGATTTCTACACACCTGAAATTTTAGATGAAGAATACAAATTCTCTGAAAGTGGTAAA
TATTTTGTTCCACCTGTTTCAGATGTTCCTTCATTCTAAGAATATATATAATCTATGGAC
AGAAATGATCCAACAGAAATATTTGGAATGCATCCAAATGCTGCTATCACTTCTGCAATT
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCTTACGAAGAGTCTATG
AATACAGTGTTGTAACAAGAACTAATCAGATTCAACAAACTTCTAAATACTGTCAAAGTT
AGCTTGGTTAATGTAGGAAAAGCAATTGATGGTTTATTAGTCATGTCTTCTGACTTAGAA
GAAGTATTTAACAGTGTTTTCGATAATAAAGTACCAGATATTTGGCATAAGGTTTCATAT
CCTTCACTCAAACCACTTGGTTCTTGGATTAACGATTTCTGTGATAGATTGAGAGAAATG
GATGAATGGATTTAAAAAGGTGCTCCTCCTAGTTTCTGGATTTCTGGATTTTTCTTTACA
CAATCCTTCTTAACTGGAACTCTTTAAAATTTTGCTAGAAAATATAAAATACCTATCGAT
ACTCTTTCTTTCGATTTCTTTGTAATAAAAGAAGATAGCAAAGAATATGATGTCACTGTA
GCCCCTCAAGATGGTTGTTATGTATATGGTCTTTTCTTTGAAGGAGCAAGGTGGAACAAT
GAAAAACAAGTATTAGATGAATCTCTACCAAAGGTTTTGAGCTCAAAGGCACCTTACATC
TGGCTATTACCTACCGAAGAGAGAAGAGATTATGAGAATGATAAAACTGTATATGAATGC
CCTGTTTACAAGACATCTCGTAGAGCTGGTACATTAAGTACTACTGGTCATTCTACAAAT
TTTGTAATGAGCATGTATTTACCTATAGCCCAAGAACATTAGCCAAAGCACTGGATTAAG
AGAGGTGTAGCGGCTCTAACTTAACTTGATGATTGA


>TTHERM_00252430(protein)
MSKRPSKKSLGPLYKINFPRFQFEEADQEEKFVDQAIIAYQQGKPVQRQTPTRPQKNQKL
PPLEQNDIFSPKFSVEQSNSIMSNGNKGQLRYNQSEHNLYQSLQIPLQQQQLQSQQDPFP
IVRTSGAGGSLSMTIDQTQMQKNLLNKPGRNLKVNQSQKISTPTQQIQNQQVSSKLLGLQ
QSQATPLRGADGYKQTDNSFSHNYSSLAGGNQPYSPQISKKALHTHGEEQNLEDTGKDFA
DKGLNTNKNLRNYDCWDEETTPLQWLEKFKKNPQGPHGKCPIYLNKQYVWTDVQVLDYDE
NTDKYLVRIIATDQLKHVVRLSLMFNEEDQTKFKERVDLSKSRQVNAEDALRFDKYVNKV
SDDLIQPMSAEWRKQIFNFVTKKPKHSQEEKVEEIYKSKYVQELFEDAERQYIFFIKKCY
VLKEMADPKNEQKWQKYRIRNRYEEKILPFYGTYVQLQYNYNENQDSLSKLHVSNKQLVV
KTLNMVTHRTFLYENHKLINTTWNEQQLPILLSNFDQQQRAYHISSRSTLQMQWREYIIS
EIQDTLRDIYRFYQTESKLYFGSDLQRLLKRIDLMFNTFMRENVVKGNINDYCKFIQKFT
IPEQNDENIWHINNFPLLILNLQLNQKPKKKGKKPNKDRKEETPASQQKEEYEEEDIIYY
EPTYQQICQTLMKPFDWIVESVNMFFMLEKDLVPLIDLPKLPSFQIDNQLQWIKEGQEKV
LEYIKVGYEEPNEILERFKKYQFLMEKSISNVTKQLFGEAKEKPLIQDINPQDVDLKIQE
YFIAKKEIEKQCIDQKNCHFFQVRTKQAKNDLVHKADEFVQSILQKVDLLCFDNIERIQK
TYEDICDKLKKTPQNEEELVALKAQIKENEVNLAKIANEVNCVGEFLKILEKYCYSQKEV
STEQFFLLKVQPATVLEAAMEGNRTYEIYESKFRNNLEIEKDGFQNTIVDIQKRFQHIKQ
YRSYNASLDVKENYTEVANFGELIQQASEKVKSFNSREALFGDEISIWDELDNVAKEFDP
YHRLWDILFNFTNNYEEWTNGSFLSQSYHEIEKTVNSKYYLEAKALLKKFSDENDPSSDE
RPAQLSEQLLKDIQDFRQKLWIFELLTTEAMRNLKKPMVQQHWAEIFERCNVQGKQMTED
MTFIQLLAVLNPIKEVIEEVSRKAEKQYQIEKKLKEMEETVKVIKLDIMEYTKSKKHTFV
LKGVDEIQQILDDQLNILTMMKASPYIKNLKRIAEPLEQRLVFVQDTLEGWIKCQRSWMY
LEPIFASEDIKKKMELQKQKFDTVDDFWRTTMESFAKEPGLWEGIENDRLKNEFNQHNKT
LDEIQKKLSDYLESKRRDFPRFFFLSDEELLEILADTKDPQKVQKHINKCFEAISKLDFS
SKEDVSGMISAEQENVKFNSKINVNEGDKKGNVEKWLGEIEQMMRNTLKHITKNAMIDEA
TARNDWVQKWAGQVVLAVNMVRWTRGAENAILNSRGDEVDDGIYTYSNLSDYVDFLENQL
KDTVQLVRKDLTPLARLTLGALVVLDVHAKDVIVELKKTGCTSSQDFNWISQLRYYWEEK
HNKPDLKVQMISANLSYDFEYLGNSTRLVITPLTDRCYRTLMGAFQLQYGGAPEGPAGTG
KTETVKDLAKALAVQCVVFNCSDGLNYVAMRKFFKGLASSGAWCCFDEFNRIDLEVLSVI
ASQVLTIQMAIRSNKSRPKETFEFDGEEIKLVDTCAINITMNPGYAGRSELPDNLKSLFR
PCAMMVPDYAMISEIYLYSVGFEEARNLARKIVASLRLSSEQLSSQDHYDFGMRALKAIL
TAAGNLKRVMTDSEDIICLRALMDVNLPKFTINDIPLFKSITSDLFPGVELPFIDYGDLL
ESLKNACKESQLQPKQNFLNKCIQLYDTINVRHGLMVVGQAFSGKSSITRTLQNALSALK
GKGDFQTVHTHNLNPKSITSDQLYGKLDPDTKTWADGVIAIIMRVCSQDTSMDKQWVVFD
GPVDAVWIENMNTVLDDNKKLCLTSGEIIKLTNQMTMMFEVEDLAQASPATVSRCGMVFL
ETKQLGWDPLIKSFIQQLPSSLDKVADQFEKILTWLIDCSMSWAMRHGKFLVHKSEMTLV
GSCLKYLKTYIKEYGEENVKVQKDIEDILANVSLFCVIWSIGACLEETTRKPFHQFITEL
IHASSEIPDKYQIKYDLMFPFEPHSIRANIPDKSSIFDLCYDKNKGIWVNWTQTEKKFEI
PKGGEYHNIFVPTIDSIRNNFFLHRCVQNQIHLLVCGPTGTGKTVNVINELNKHYLNPEY
SNLQTAFSGQTNVNQVQRLIESKVCTRRRKGHFGPEEGKKFIVIFIDDLNMPAKEKYGAQ
PPIELLRQWMDNGGWYDLADKTWKYLCDITFITAMLPPTGGRNTVTMRYMRHFNLLYVES
FEAESLHRIFSNLLDWYFLNQKQGVGKAIENLRDSIVNSTIELYQGIQNSKQLLPTPAKS
HYIYNLRDISKVFQGISKATSRSYKDENDFLKLWAHECMRVFQDRMINSSDQQVFEEILK
EIMRKNFRREWKDLVTVEPLLWASFVPTLYPDGDTSKRRLADIYCELSDREELKRVCYDQ
LAQFNDSYPQNKMNLVLFMTAIQHIIKIVRVITTSFGHCLLVGVGGSGRKSLATLSAFIA
FTNEIQTIDHKSDIKIWIEELQKVMKVAGVDNKPTTLLFSDTQIFSESLLEDICNILNNG
EVPNLFPPEEKAKIMDEINDPSAQTNNQKYQVFLDACKRNLHLVLAFSPVGEAFRRRLRT
FPTLVNCTTIDWFLPWPEEALRNTASSHFINVMKIESESTRDGLIEIVVDMQTRISNMSI
RYREELRKYYYVTPTSYLELLATFERMLKERQTSIQNTISRYETGVLKIDTTEKDVNIMK
KRLEELKPQLEIKTEENQKMLINLQKKQKEADAKREVCESEERDCKIQKDNANALKEDCQ
RELDKVLPILAEAVKILSKISKDDINILKSFQNPSPSVVLVFEGLCYAFDEDQFVKSVPI
APGAIEKKKDFWDYSKKKLLNDKLLSRVRDFDDSKIRAINPVKIDQLKQFISNPLFDEDK
IQNASSAAANLSKWIRAVVQTYDALLIVEPKKKQLEKAESDLRQAEEILNVKKAALQEVL
DLLAKLQSEYDIAKREKEELQAEVTKCEIQLDRAEKLINGLGGEKNSWKQKAISNREEST
SVIGDCVLSSGIIAYLGAFPIAYREEAIHNWKELLLKYKIKFSNDYSLQKILCDPITIGQ
WTDKYQLPNDSFSIDNAIILNNSQRWPLMIDPQIQANNWIKKLEGERLLIFNPNSDPKNV
LLKLENCIPLGTPVLLENVSENIDSLYESVLLKKLTKKGSSYTMKFMEKQIEYHEGFRFY
VTTKYPRPHYPPEICVKVTLLNFQVTPEGLEDQMLNITVKQEDPHRDQIREKNIVEFFQN
KERQKHTEDMILQMLFESTGNLLDDEKLIEQLQQSKKDNIEIQDKLKRQENDRELYNQTR
NSFKELGKRVANLYFVVLDLALIEPTYQWSLEFYIELFLKGIKTAAPAKDNKENRSKNII
QQFQILLYESICRSLLEKDKLIFSFLMCMKILEIEKKINSQTIRFLMVGGTWTSCDHQMP
QKAQSWLSNKAWCILNEADSVLPQFKGFVKEFEHYIDHYKKLNEHETPYEEEFPGAVAQS
LHYFSKLILIRALFPDKFSKAVQKLIITEMSEQYIQPPPFNLDQTYLDSRFDKPLIFILS
PGADPRIEINTLATKLGIQTDRFKQISLGQGQGELAEKSIRAAYQDGSWVLLQNCHLAPS
FMPRLEKILETYPEDVDREFRIWLTSMPSDVFPPSILMKGIKMTYEPPRGLKNNLQRTYA
SFKNQDFDTNSKPAELKKLCFGLAFFHALILERRKYGPLGWNIPYEFTVADFQISQQQLK
EFLNKYDEIPYEALNYMVAEANYGGRVTDPKDRRLIKIILRDFYTPEILDEEYKFSESGK
YFVPPVSDVPSFQEYIQSMDRNDPTEIFGMHPNAAITSAIXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSYEESMNTVLQQELIRFNKLLNTVKVSLVNVGKAIDGLLVMSSDLE
EVFNSVFDNKVPDIWHKVSYPSLKPLGSWINDFCDRLREMDEWIQKGAPPSFWISGFFFT
QSFLTGTLQNFARKYKIPIDTLSFDFFVIKEDSKEYDVTVAPQDGCYVYGLFFEGARWNN
EKQVLDESLPKVLSSKAPYIWLLPTEERRDYENDKTVYECPVYKTSRRAGTLSTTGHSTN
FVMSMYLPIAQEHQPKHWIKRGVAALTQLDD


>TTHERM_00252430(gene)
ATGAGTAAAAGACCTTCAAAGAAATCTCTTGGTAAGACTCATTTATATTAATAAAATAGA
TAAAAATAGCATCAATATAATAGGATTTAAAAGATTTTATTAAAGCTTAGGATGTTGACG
AGATTCTTCTAAGCAACATTTTATAAATTGAAAGACCATTTCAACAATATTTACTTTATT
TTTTAAATGTAGGACCTTTATACAAGATCAATTTTCCAAGATTTTAGTTCGAAGAAGCTG
ATTAAGAAGAAAAATTTGTAGATTAAGCAATAATAGCATATTAATAAGGAAAGCCTGTAT
AGAGACAAACTCCGTAAATAAACCATTTTATCAAAATTAGCACAATAAATATTTATTTTT
TTTTACAATGTGCTACCTGCTTTTCATTTATTTTTGATTTCAAGTAGTCATTCAATTTAC
AAGAAATACCTAATTATATAACTTAAATAATGAGGAATATTTTTAGTCCAACTTATTTAA
TCATTTTAAAGCATACTTTGCCAGTATAAAATGAGGATTACTCGTAAAAAGAATTAAATA
TTCTACCAAAGTGTATTTCAATTATTTAAAGTCTATTTTGATGATTAAATTTTACAAATT
TAAGAAAATATTTGAGCTATTTTTTATATTTTTATCAATATTATTAACAAATAGAACTAG
GCCATAGAAAAATTAAAAACTACCTCCTTTAGAATAAAATGATATCTTTAGTCCTAAATT
TAGTGTTGAGTAATCTAATAGCATTATGAGTAATGGTAATAAAGGTTAATTGAGATATAA
TTAATCAGAGCATAATCTTTATTAGAGTCTCTAAATACCACTTTAGCAGTAATAATTATA
ATCATAGTAAGACCCATTTCCAATAGTAAGAACCTCAGGAGCAGGTGGTTCATTAAGCAT
GACAATAGATCAAACATAAATGCAAAAGAATCTTTTAAATAAACCAGGACGTAATTTAAA
GGTCAACTAATCTTAAAAGATTTCTACACCAACTCAGTAGATTTAAAATCAATAAGTTAG
CTCTAAACTACTCGGATTATAGTAAAGCTAAGCAACTCCTCTAAGAGGGGCTGACGGTTA
CAAATAAACAGATAACAGCTTCTCTCATAATTACTCATCTCTCGCAGGTGGAAATTAGCC
TTACTCTCCATAAATATCAAAGAAGGCTCTCCATACGCATGGTGAAGAATAGAATTTAGA
GGATACAGGAAAAGATTTTGCAGATAAAGGACTAAATACTAATAAAAACCTTCGTAATTA
TGACTGTTGGGATGAAGAAACTACTCCCTTACAATGGCTTGAAAAATTCAAAAAGAATCC
CTAAGGCCCACATGGCAAATGCCCTATCTATTTAAATAAATAGTAATTAAAATACTTCTA
ATAATATTTTAAATTCTTTCTAATTCTATAAATAAATAAAAAAATATTCATTAGTATTCT
TTATTTAAATTGTTTTATATCTAATATTAATTTTAAATATAGGTATGTGTGGACTGATGT
ATAAGTTTTAGATTATGATGAAAATACCGATAAATATTTGGTAAGAATTATTGCTACAGA
TCAATTAAAGCATGTTGTAAGGTTATCTTTGATGTTCAATGAAGAAGATTAAACTAAATT
TAAGGAAAGAGTTGACCTCTCCAAGTCAAGATAAGTCAATGCAGAAGATGCCTTAAGGTA
TTTTTTAATTTAATAATTTTAATTAAATGAATGTTTAATAATAGATTTGACAAATATGTA
AATAAAGTGTCTGATGATCTCATTTAGCCTATGTCTGCTGAATGGAGAAAGCAAATTTTT
AATTTTGTTACAAAAAAACCAAAGCATAGTTAAGAGGAAAAAGTAGAAGAAATTTACAAA
AGCAAGTATGTTCAAGAGTTATTTGAAGTAAGATAATAAAACGATTGTTTGATTATATAT
AAAAAAATTTTATTAAAATAGGATGCTGAGAGACAATATATTTTTTTCATCAAAAAATGC
TATGTTTTGAAGGAAATGGCTGACCCTAAGAACGAACAAAAATGGCAAAAATATAGAATT
AGAAATAGATACGAAGAAAAAATTCTTCCATTCTATGGCACATATGTTTAGCTTTAATAT
AATTATAATGAAAATTAGGACAGCTTATCAAAATTACATGTCTCAAATAAATAACTAGTT
GTTAAGACTTTGAATATGGTCACTCATAGAACATTTTTATATGAAAACCACAAGGTAACT
AACAAACAAATAAATATACTATATTTTTTACAAAAGTATTTAATTTATTTTTAATATAAA
AAGCTTATAAATACTACTTGGAACGAATAATAATTACCAATACTCTTATCTAATTTTGAT
TAGCAACAAAGAGCTTATCATATAAGCTCAAGGTCTACTTTACAAATGTAGTGGAGAGAA
TACATAATTTCAGAAATCTAAGATACTCTTAGAGATATTTACAGATTCTATCAAACTGAA
TCTAAGCTCTACTTTGGTTCAGATCTGTAGAGACTTCTCAAACGTATTGATTTAATGTTC
AACACATTCATGAGAGAAAATGTTGTTAAGGGAAATATAAATGATTATTGCAAGTAATTT
TAAATACCTTTAATATTATTTCACAATAGTAATTCTTCATTTTTTAAAGATTTATTTAGA
AATTCACAATTCCTGAATAAAACGATGAAAATATATGGCACATTAATAATTTCCCTCTGT
TGATTTTGAATTTGTAGCTTAATTAGAAGCCAAAGAAAAAAGGTAAAAAGCCTAATAAAG
ACAGAAAAGAAGAAACTCCAGCTTCATAGTAAAAAGAAGAATATGAAGAAGAAGATATTA
TTTATTATGAACCTACTTACTAATAAATATGCTAGACTTTAATGAAGCCTTTTGATTGGA
TAGTTGAATCTGTTAATATGTTCTTTATGTTAGAAAAAGATCTAGTTCCTCTAATTGATT
TACCCAAACTTCCCTCATTCTAAATCGATAATTAATTGTAATGGATAAAGGAAGGATAGG
AAAAGGTCCTTGAATACATCAAAGTTGGATATGAAGAGCCTAATGAAATTTTAGAGAGAT
TCAAAAAGTAATATTAATTAATTACTCAAATTTTACTAAATAAAATTATATAGATATTAG
TTCTTGATGGAAAAAAGTATAAGCAATGTCACAAAATAATTATTCGGAGAGGCCAAAGAA
AAACCTCTTATTTAAGACATAAATCCTCAAGATGTTGATCTAAAAATATAAGAGTATTTT
ATTGCTAAAAAAGAGATAGAAAAATAATGTATTGATCAAAAAAATTGTCATTTCTTCCAA
GTCAGGACAAAATAAGCTAAGAATGATTTAGTCCATAAAGCTGATGAATTTGTTTAAAGT
ATCTTATAAAAAGTTGATCTTCTCTGCTTTGATAATATCGAAGTAAGCTTTTGTTGTTAA
ATTTTACTATTAAAATATTTTTGATTATTATTATAAAACTTAAAAATTTTATTTTTGTTT
TTAAAATCAATAGCGCATCTAAAAAACATATGAGGACATTTGTGATAAATTGAAAAAGAC
TCCTCAGAATGAAGAGGAATTAGTTGCTTTAAAGGCCTAGATTAAAGAAAATGAAGTTAA
CTTAGCAAAAATTGCAAACGAAGTAAATTGTGTAGGAGAATTTTTAAAGATTTTAGAAAA
ATATTGCTACAGCTAAAAAGAAGTCAGCACCGAATAATTCTTCCTTTTAAAAGTTTAACC
TGCTACTGTATTAGAAGCTGCTATGGAGGGAAATAGAACTTATGAAATATATGAATCTAA
ATTTAGAAATAATTTAGAAATAGAAAAAGATGGTTTCTAAAATACTATAGTTGATATTCA
AAAGAGATTTTAGCACATTAAGCAATATAGATCTTATAATGCTTCACTTGATGTTAAAGA
AAATTATACTGAAGTTGCTAATTTTGGTGAATTAATTCAATAAGCTAGTGAAAAGGTTAA
GTCATTTAACAGTAGAGAAGCACTTTTTGGTGATGAAATCTCTATTTGGGATGAATTAGA
TAATGTTGCCAAAGAATTTGATCCTTACCACAGACTTTGGGATATCCTCTTTAATTTTAC
TAATAATTATGAAGAATGGACTAAGTATATTATTTTCTAAAAAATTTCATTAATCTAATT
AAAAATTAAATAACAGTGGATCTTTCTTGAGTCAAAGTTATCATGAAATAGAAAAAACTG
TTAACAGTAAATATTACTTAGAAGCAAAAGCCCTTCTGAAGAAATTTAGTGATGAAAACG
ATCCTTCAAGTGACGAGAGACCTGCTTAGCTCTCAGAATAATTATTAAAAGATATTCAAG
ATTTCCGTCAAAAGTTGTGGATTTTCGAATTATTGACAACCGAAGCTATGAGAAATTTGA
AAAAACCTATGGTCTAATAGCATTGGGCTGAAATATTTGAGCGTTGCAATGTTTAAGGCA
AACAAATGACAGAAGATATGACTTTCATTCAATTATTGGCTGTATTGAATCCAATTAAGG
AAGTTATTGAGGAGGTTTCAAGAAAGGCAGAAAAGCAGTATCAAATAGAAAAGAAATTAA
AGGAAATGGAAGAAACTGTCAAAGTTATTAAATTAGACATTATGGAATACACAAAAAGTA
AGAAACACACTTTTGTCTTAAAAGGAGTTGATGAAATTTAACAAATTTTGGATGACCAGC
TTAACATTCTCACTATGATGAAGGTAAAATTATAATAAAAAACATTACTAAGCTAAATAA
ATTTGAAAAATTAATGATAAAAGGCTTCACCTTATATTAAAAATTTGAAGAGAATTGCTG
AACCCTTAGAATAAAGATTAGTTTTTGTATAAGATACTTTAGAAGGATGGATTAAATGTT
AAAGATCTTGGATGTATCTTGAGCCAATTTTCGCTTCTGAAGATATCAAAAAGAAAATGG
AATTGTAGAAGTAGAAATTTGATACAGTTGATGATTTTTGGAGGTAAATAAATGTTTTTT
TTTTGAATTTAAAATTATATCCAATTTACTTTAAATAATTAAGAACCACTATGGAGTCAT
TTGCTAAAGAACCTGGACTTTGGGAAGGCATTGAAAATGATAGACTTAAAAACGAATTTA
ATTAACACAATAAGACTTTAGATGAAATCCAAAAGAAATTATCTGATTATTTAGAATCTA
AAAGAAGAGATTTCCCTAGATTCTTCTTCTTGTCTGATGAAGAATTACTAGAAATATTAG
CTGACACTAAAGATCCTCAAAAGGTGTAAAAACACATTAATAAATGCTTTGAAGCTATTA
GTAAGCTTGATTTTTCATCGAAAGAAGATGTAATTAACTAATCAAATATTTATATTCATA
TTCAATCATTACTTTATTCTAATAGGTGAGTGGTATGATATCAGCTGAATAAGAAAATGT
TAAATTCAATAGTAAAATTAATGTTAACGAAGGTGACAAAAAGGGTAATGTTGAAAAATG
GCTTGGTGAAATTGAGCAGATGATGAGAAACACATTAAAACATATTACTAAAAACGCTAT
GATTGATGAAGCTACAGCTAGAAACGATTGGGTTCAGAAATGGTAATTAAAAATTTACTT
ATTTTTAACCTAAAATTTTTCATATTAAAGGGCTGGATAAGTAGTTTTGGCAGTAAATAT
GGTCAGGTGGACAAGAGGAGCTGAAAATGCTATTTTAAATAGTAGAGGCGATGAAGTTGA
TGATGGTATTTATACTTATAGTAATCTATCAGATTATGTTGATTTTCTTGAGAATTAGTT
AAAAGATACAGTATAGCTTGTTAGAAAAGACCTAACTCCCTTAGCTAGATTAACTCTTGG
TGCTTTGGTTGTTTTAGATGTCCATGCAAAGGATGTTATCGTTGAATTAAAGAAAACTGG
TTGTACATCATCTTAAGATTTTAATTGGATCTCTCAACTACGTTATTATTGGGAAGAAAA
GCACAATAAGCCAGATCTAAAAGTACAAATGATTAGTGCAAACTTAAGTTATGAGTAAAA
AACATTTTTATTTATTATTTTATATATGATCTTTATTTATATATTTCGATCAGTTTCGAA
TATCTTGGAAATTCAACACGTTTGGTCATTACCCCTCTTACTGATAGATGTTACAGAACT
CTTATGGGAGCTTTCTAATTATAGTATGGAGGAGCTCCTGAAGGTCCTGCAGGTATTATA
ATTTTTTACTAACAATTGAAGATTTAACAATAAAAACAAACTTATTAATTATTTCCTTCT
TAAATCTTGATTTTTTTAAAAAAGGTACTGGTAAGACTGAAACAGTAAAGGACTTGGCTA
AGGCTTTGGCTGTACAATGCGTAGTATTTAATTGTTCTGATGGTTTGAACTATGTAGCTA
TGAGAAAATTCTTTAAAGGTTTAGCATCTTCTGGAGCTTGGTGCTGTTTTGATGAATTCA
ATAGAATTGATTTAGAAGTTTTGTCAGTTATTGCATCTTAGGTTCTAACAATTTAAATGG
CAATCAGGAGCAATAAATCAAGACCAAAAGAAACTTTTGAGTTCGATGGTGAAGAAATTA
AGTTGGTTGATACATGCGCCATTAATATAACTATGAATCCTGGTTACGCAGGTCGTTCTG
AATTACCAGATAATTTGAAGAGTTTGTTCAGACCATGTGCGATGATGGTTCCTGATTATG
CTATGATTTCAGAAATTTATTTGTATTCAGTTGGTTTTGAAGAAGCCCGTAACTTAGCTA
GAAAAATCGTTGCTTCTCTTCGTTTAAGTAGCGAACAGCTTTCCAGCTAAGATCACTATG
ATTTTGGTATGAGAGCTTTAAAGGCTATTTTGACAGCAGCTGGTAACTTAAAGAGGGTTA
TGACTGATAGTGAAGATATTATTTGCTTAAGAGCTCTAATGGATGTTAATTTACCTAAAT
TCACTATTAATGATATTCCTTTGTTCAAATCTATAACAAGCGATCTCTTCCCTGGAGTTG
AACTACCTTTCATTGATTATGGCGATCTTCTAGAATCTTTGAAAAATGCCTGTAAAGAAA
GTCAACTTTAACCAAAATAAAACTTCTTAAATAAGTGCATTTAATTGTATGATACTATAA
ATGTCAGACATGGTTTGATGGTTGTTGGACAAGCTTTTTCTGGTAAATCAAGTATAACAC
GTACTCTATAGAATGCTCTATCGGCTTTGAAAGGTAAAGGAGATTTCTAAACAGTTCACA
CTCATAATCTTAATCCAAAATCCATAACAAGTGACTAATTGTATGGTAAGCTTGATCCTG
ATACTAAAACTTGGGCTGATGGTGTTATTGCAATTATTATGCGTGTTTGCTCATAAGATA
CAAGTATGGACAAGCAATGGGTAGTATTCGATGGACCAGTTGATGCAGTTTGGATTGAAA
ATATGAATACAGTCTTGGATGATAATAAAAAACTTTGCTTAACAAGTGGTGAAATTATTA
AGCTTACTAATTAAATGACTATGATGTTTGAAGTAGAAGACCTTGCTTAAGCTTCTCCTG
CCACTGTATCTAGATGCGGTATGGTCTTCCTCGAAACTAAATAACTTGGCTGGGATCCTC
TAGTAATTTAAACAAATATAAATATATTTACTTAATATGTATTAAAATTATAATTTAGAT
TAAGAGCTTTATTTAGCAACTACCATCAAGTTTAGACAAAGTAGCTGATTAGTTTGAAAA
AATATTAACATGGTTAATTGACTGTTCTATGAGTTGGGCTATGCGTCATGGTAAATTCTT
AGTGCACAAATCAGAAATGACACTTGTTGGAAGCTGTCTAAAGTATTTAAAAACGTATAT
TAAGGAGTATGGCGAAGAAAACGTAAAAGTACAAAAAGATATTGAAGATATTTTAGCAAA
TGTCAGTCTTTTCTGTGTTATTTGGTCAATTGGTGCTTGCTTAGAAGAAACTACAAGAAA
GCCTTTCCATCAATTCATAACAGAATTAATCCATGCTAGCAGTGAGATTCCTGATAAGTA
TTAAATAAAATATGATCTAATGTTCCCCTTTGAACCACATTCGATTCGTGCCAATATTCC
AGACAAGAGTTCTATCTTTGATCTTTGCTATGATAAAAATAAAGGTATCTGGGTAAACTG
GACATAGACAGAAAAGAAATTTGAAATTCCCAAAGGTGGTGAATATCATAATATCTTTGT
ACCCACTATAGACTCTATAAGAAATAATTTCTTCTTACATAGATGTGTTTAAAATTAAAT
TCACCTTTTAGTATGTGGTCCTACTGGTACTGGTAAAACAGTGAACGTGATAAATGAATT
AAATAAGCATTACCTAAACCCTGAATATTCAAATCTATAAACTGCTTTCTCTGGCTAAAC
AAACGTTAACTAAGTAATAATTTTGTTTTAATCAAGATTTTATTTCAAACTAAATAACTT
ATTTTAATAGGTATAAAGATTAATTGAATCTAAAGTATGCACAAGAAGAAGAAAAGGTCA
CTTTGGACCTGAAGAAGGCAAAAAATTCATAGTTATCTTCATAGATGACTTAAATATGCC
AGCTAAGGAAAAGTATGGTGCATAACCTCCTATTGAATTATTAAGATAATGGATGGATAA
TGGTGGTTGGTATGACTTAGCTGATAAAACTTGGAAATATCTTTGTGATATTACTTTTAT
CACAGCCATGCTTCCTCCAACAGGTGGACGTAATACAGTAACAATGAGGTAAAAAATATT
AATTTTATCAATATTTATTTAAATGTTTTTAAACAAAAAAAAAAAGTTATATATTTCTTT
TAAATATTTATTTTATTTAATTTTTTAAATAAAAAGATACATGAGACACTTTAACTTGCT
TTATGTTGAATCATTTGAAGCAGAGTCTCTTCATAGAATTTTCTCTAATTTACTTGATTG
GTACTTCTTAAATCAAAAATAGGGTGTTGGAAAAGCAATTGAAAATTTGAGAGACAGCAT
AGTCAATAGTACTATTGAACTTTACTAAGGAATTTAAAATTCTAAATAATTACTTCCAAC
TCCTGCAAAGTCACATTATATTTATAACTTGAGAGATATTTCCAAAGTCTTTTAGGGCAT
TTCAAAGGCAACTTCTAGATCATACAAAGATGAAAACGATTTCTTAAAACTATGGGCTCA
TGAATGCATGCGTGTGTTTTAAGATCGTATGATTAATAGCTCTGATTAGTAAGTCTTCGA
AGAAATCTTAAAAGAAATAATGCGTAAAAATTTCCGTAGAGAATGGAAGGATTTAGTTAC
TGTTGAACCTTTACTTTGGGCTTCGTTTGTTCCTACCCTTTACCCTGATGGCGATACAAG
CAAAAGAAGATTGGCAGATATTTATTGCGAACTTAGTGACAGGTAAATTTTTAAGAAAAA
TAGTGAAATAAATTAATAAATTATTTTTTTAAACTTAAAAGAGAGGAGTTGAAAAGAGTT
TGCTATGACTAATTAGCTTAATTCAATGACTCCTATCCTTAGAATAAGATGAATTTAGTT
CTCTTTATGACAGCCATATAGCACATCATAAAAATAGTTCGTGTTATTACTACGTCTTTC
GGGCATTGCTTGCTTGTTGGTGTTGGTGGTAGTGGCAGAAAGAGTTTGGCTACTTTATCA
GCTTTTATTGCATTTACAAACGAAATTCAAACTATCGACCATAAAAGCGATATAAAAATT
TGGATTGAAGAGTTGCAAAAAGTCATGAAAGTTGCAGGTGTTGATAATAAACCCACAACA
CTTTTGTTCTCTGACACCTAAATTTTCTCAGAATCTCTTCTCGAAGATATTTGTAACATT
CTGAACAATGGTGAAGTTCCAAATTTATTCCCTCCTGAAGAAAAAGCAAAAATTATGGAT
GAAATTAATGATCCCTCAGCATAAACTAATAATTAAAAATACTAAGTAATTAATTAGAAA
GTTTTCAAAATGATAAATAAATATTTTAAATATTTAATAATTTTTTAATAAAAATTAGGT
ATTCTTGGATGCTTGCAAGAGAAATTTACATCTTGTGTTGGCATTCTCTCCTGTTGGTGA
AGCATTTAGAAGAAGATTAAGAACATTCCCAACTTTAGTTAACTGTACTACAATTGATTG
GTTCCTGCCATGGCCCGAAGAAGCACTGAGAAATACTGCTTCTTCTCACTTTATAAATGT
AATGAAAATTGAATCTGAAAGCACAAGAGATGGTTTGATAGAAATTGTAGTTGATATGCA
AACTCGTATTTCTAACATGTCTATAAGATATAGAGAAGAATTACGTAAGTATTATTATGT
CACTCCAACAAGTTATTTAGAGCTTCTTGCTACCTTTGAACGTATGCTCAAAGAAAGATA
AACATCTATTTAAAATACTATTTCAAGATACGAAACAGGTAATTTTCCTTTAATTTTTTG
CATTTCAAAATAATTATTTAATAAATTTTGTAAAATTTTAAAAAATAAAAATATTACATT
ACTATGAAAATATTTTTTTTTAAATAATTGTCTTATAAGTCACTCATTTATAATCGTAAA
ATAAAAGGTGTTCTAAAAATTGATACTACTGAAAAAGATGTAAATATTATGAAAAAAAGA
TTAGAAGAATTGAAGCCATAGTTAGAAATAAAAACAGAAGAAAATTAAAAAATGTTAATT
AATTTGTAGAAGAAATAAAAAGAGGCTGATGCTAAGAGAGAAGTTTGTGAGTCTGAAGAA
CGTGATTGTAAGATTTAAAAGGATAATGCCAACGCCCTGAAAGAAGATTGTTAAAGAGAA
TTAGACAAAGTGCTTCCTATTTTGGCTGAAGCTGTTAAAATTTTATCTAAAATTAGTAAA
GATGATATTAACATTTTGAAATCCTTCTAAAATCCATCTCCTTCTGTTGTTCTTGTTTTC
GAAGGTCTTTGTTATGCATTTGATGAAGATCAATTCGTAAAGTCAGTACCTATTGCACCA
GGTGCAATCGAAAAGAAAAAAGATTTCTGGGATTACTCTAAAAAGAAGCTTTTAAATGAT
AAATTGCTTTCTAGAGTTCGTGATTTCGATGATTCTAAAATTCGTGCAATTAATCCAGTT
AAAATTGATTAATTAAAGCAATTTATAAGCAATCCATTATTTGATGAAGATAAGATCTAA
AATGCATCTTCTGCTGCTGCAAATCTTTCAAAATGGATTAGAGCCGTTGTTTAAACATAC
GATGCCCTTTTAATTGTAGAACCTAAAAAGAAACAATTAGAGAAAGCAGAAAGCGATCTC
CGCTAAGCTGAGGAAATTCTTAATGTAAAGAAAGCTGCTTTATAGGAAGTTCTTGATTTG
CTTGCCAAACTTCAAAGTGAATATGATATAGCTAAACGCGAGAAAGAAGAATTGCAAGCT
GAAGTAATTATTTATGAATAAGACAAATTTATTTTATCTAATAATTTAAACAATAACTTT
TGCTAAAAATATGTTTAATTAATAATTTTTAGGTTACAAAATGTGAAATCTAATTAGATA
GAGCAGAAAAATTAATTAATGGATTAGGTGGTGAAAAGAATTCTTGGAAATAAAAAGCTA
TTTCAAACAGAGAAGAAAGTACAAGTGTAATCGGTGATTGCGTCTTATCTTCTGGTATCA
TTGCTTACTTAGGTGCATTCCCAATAGCCTACAGAGAAGAAGCCATTCATAATTGGAAAG
AATTATTGCTTAAATATAAAATTAAATTCTCTAATGACTACTCTCTATAAAAAATTTTAT
GTGATCCTATCACAATTGGTTAATGGACAGACAAATATCAAGTAAATTTAATCTTTTTTT
TAAATTAAGTTTTAAATAAATACGAAAATAAAAAAGCTTCCAAATGACTCATTCTCAATT
GATAATGCTATCATTTTGAATAACTCTTAGAGATGGCCCTTAATGATAGATCCTTAGATT
TAAGCAAATAATTGGATAAAGAAATTAGAAGGTGAAAGGTTGCTCATTTTCAATCCTAAT
TCTGATCCTAAAAACGTTTTACTTAAACTAGAAAACTGCATACCACTAGGTACTCCTGTC
TTGCTAGAAAATGTTAGTGAAAACATAGATTCTTTATACGAATCTGTTTTATTGAAAAAG
CTAACAAAGAAAGGTAGTAGTTATACTATGAAATTTATGGAAAAGCAGATTGAATATCAT
GAAGGCTTCCGCTTTTATGTTACAACTAAATATCCTAGACCCCATTATCCTCCTGAGATT
TGTGTAAAAGTAACTTTGTTGAATTTCTAAGTCACTCCAGAAGGACTTGAAGATCAAATG
CTTAACATCACAGTAAAGCAAGAAGATCCCCACCGTGATTAAATTAGAGAAAAGAATATT
GTTGAATTCTTCTAAAACAAAGAAAGATAAAAACACACTGAAGATATGGTAAAAAATTTA
TTTATTTATTTTATTTAAAAATCCATTTATTATTAGTTTATAAAATTTAACAAAACATTT
TTGTAAATTAAATCTAAAAGTATTTTAAAATTATTTGATTTGTTTTAATTGAAACTAATT
TAAAAACTAAATGAAGATGAAAGAAAATATTTTTTTTAAACTATTAAAAAATTATTTAAA
ATTAAATAGATTCTTCAAATGTTGTTCGAATCAACTGGTAATTTGTTAGATGATGAAAAG
CTGATCGAACAATTGCAATAATCAAAGAAAGATAATATAGAAATTTAAGATAAATTAAAA
CGTTAAGAAAATGACAGAGAATTATATAATTAAACAAGAAACTCATTTAAGGAATTAGGT
AAGAGAGTTGCAAACTTGTATTTTGTTGTTTTAGATTTGGCTCTCATAGAACCTACATAT
CAATGGTCTTTAGAATTTTACATAGAACTATTCTTAAAAGGTATTAAAACAGCTGCTCCA
GCAAAGGACAATAAAGAGAATAGAAGCAAGAATATTATTTAGTAATTCTAGATTTTGCTT
TATGAAAGTATATGTAGAAGTCTTCTTGAGAAAGATAAATTGATTTTCTCTTTCTTGATG
TGTATGAAAATTTTAGAAATTGAGAAAAAAATAAATTCCTAAACTATTAGATTCCTAATG
GTTGGAGGAACTTGGACTTCTTGTGATCACTAGATGCCATAAAAGGCTTAATCATGGCTC
TCTAACAAAGCATGGTGTATCCTAAATGAGGCTGATTCGGTTTTACCTCAGTTTAAAGGA
TTTGTAAAAGAGTTTGAGCACTATATTGATCATTATAAAAAATTGAATGAGCATGAAACC
CCTTATGAAGAAGAATTCCCAGGAGCAGTAGCTTAAAGTTTACACTATTTCTCTAAGGTA
TAATTTGAAATTATTTTTTATTTTTTAAGTAAGAATTATTTTTTAATTAATTTAGCTCAT
ATTAATTCGTGCTTTATTCCCTGATAAATTCTCTAAGGCAGTATAAAAATTGATTATTAC
TGAAATGTCTGAATAATATATTTAGGTAACATTTTAATTTCTTTTATTTCACTACTCTTC
AACTTTTTTTATGTAAAGCCTCCTCCTTTCAATTTAGACTAGACATATTTAGACTCTCGC
TTTGATAAACCATTAATATTTATTTTATCTCCAGGAGCAGATCCTCGTATAGAAATTAAC
ACTCTTGCTACAAAATTAGGAATATAAACTGATAGATTCAAATAAATCTCTCTAGGTTAA
GGTTAGGGAGAATTAGCTGAAAAATCAATCAGAGCTGCTTACTAAGATGGTAGCTGGGTC
TTATTATAAAACTGCCATCTTGCTCCTTCATTCATGCCTAGGCTTGAAAAAATTTTAGAA
ACATATCCAGAAGATGTTGATAGAGTAAAATATATTACAATTCAAAAACTTAGTTTTATA
AAAACTTTTATATCATAAAAAAGTGTGTTTAAAAAATAATTAAATTAATTTTTGTTTAAG
GAACGTTTATAATTAAAAATAATGTTTAATCAACAAATTTAATAAAAATTTTTATAATTA
TAGGAATTTAGAATTTGGTTGACATCTATGCCTTCAGATGTATTCCCTCCTTCTATTTTG
ATGAAAGGTATTAAAATGACTTATGAACCTCCAAGAGGACTCAAGAATAACTTATAGAGA
ACTTATGCCTCATTTAAGAACCAAGATTTCGATACTAATTCTAAACCAGCTGAACTTAAA
AAGCTTTGTTTTGGCTTAGCTTTCTTCCATGCTCTTATATTAGAAAGGTAAATAATTCAT
AATATTTGAACATAAATAATTTATTTCAAAATTTTAAATAGGAGAAAATATGGACCTCTT
GGTTGGAATATTCCTTATGAGTTCACTGTTGCAGACTTTTAGATTTCTTAGTAATAGTTA
AAGGAATTCTTAAACAAGTACGATGAAATTCCATACGAGGCTCTAAATTACATGGTTGCA
GAAGCCAATTATGGTGGTAGAGTTACTGACCCTAAAGATAGAAGACTAATTAAAATTATT
CTGAGAGATTTCTACACACCTGAAATTTTAGATGAAGAATACAAAGTAAAAAAAGTTTTA
TGACAATTTATTAGCATTTTTTAAGAATAATTTTTAAATATTTTAGGAGTAGAATTATAT
AATTTTATTAAATACAAATACATAATAATTATTTTAAATTTAAATATAAAAGTTCTCTGA
AAGTGGTAAATATTTTGTTCCACCTGTTTCAGATGTTCCTTCATTCTAAGAATATATATA
ATCTATGGACAGAAATGATCCAACAGAAATATTTGGAATGCATCCAAATGCTGCTATCAC
TTCTGCAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCTTACGA
AGAGTCTATGAATACAGTGTTGTAACAAGAACTAATCAGGTTTAATATATTTAAAACTAA
AAATTTTATATTAATATATTTTTGTACTCAAAACTAGATTCAACAAACTTCTAAATACTG
TCAAAGTTAGCTTGGTTAATGTAGGAAAAGCAATTGATGGTTTATTAGTCATGTCTTCTG
ACTTAGAAGAAGTATTTAACAGTGTTTTCGATAATAAAGTACCAGATATTTGGCATAAGG
TAATTTTAAATTCAATACTTATAAAACTTATAAAATAATGTGATATAAATACAAAGATTT
TTAAATAAACTTGATAAATAAAATGTTTTTGATACATTTAGAAAATAAAAATAAAAATTT
CCAAAATATCTGAAATTTTAATGGATAAATTATTCAAAATCTTAAAAAAATAAGCAATTA
GTAGTAAAAATTGTATTTTTTTCACAAATAATGTAAGAAATTAAAATCTTAATATGAAGT
GTGTAAAGTTAAACTGGAAAAAATCTAAATTAATTTATTTTATATCCATCCATAAAATTT
AGTTGTACTGAAGCAAAATAAAAGCATTTCATCATCAAATATAAGCTAGATCGAATTTAA
TTTAACTAGCAAAGATAGATATAAAAAAATTTTAGTGTAATAAAAAAAGTCCAGTAAAAT
AAATTAAATTAACTATTAATTAATGAATTGAATGATTGATAAGCTAGTTCTAAAAACTTT
TTTACAACTGAGATATATTAAAATAAAATTTGAAAATAAATTTTGAATTTACCCCATAAA
CATAATTTAGTATACAGTAAATACATACCAAAATTTTATTTTTTACAATTAATTATAGAT
TTATATTACTTTTGTAAGCAAGTAACTAAATTTTATTAGGACAATTTATTATTTTACCTC
ATGTTATAAATATGTAATGTTGGATTAAAAAATTCAATCACTTAATTCGCATAAATTTAT
TACTTGTACCTCAATATTTTAATGTGAATTCAGTAAATAATGCTCAAAACGTTGATATAT
TATAATAATTCTACCAATATTTAATTAACTATAATTTTAAAAACTTTTTTTAGGTTTCAT
ATCCTTCACTCAAACCACTTGGTTCTTGGATTAACGATTTCTGTGATAGATTGAGAGAAA
TGGATGAATGGATTTAAAAAGGTGCTCCTCCTAGTTTCTGGATTTCTGGATTTTTCTTTA
CACAATCCTTCTTAACTGGAACTCTTTAAAATTTTGCTAGAAAAGTAATATTTAGTTTTT
AAAAAATATTTAAACTAGAAACAATTTATATTCCCTAACAATAGTATAAAATACCTATCG
ATACTCTTTCTTTCGATTTCTTTGTAATAAAAGAAGATAGCAAAGAATATGATGTCACTG
TAGCCCCTCAAGATGGTTGTTATGTATATGGTCTTTTCTTTGAAGGAGCAAGGTGGAACA
ATGAAAAACAAGTAATTTATTATTTAATAACTAATTTATTTAATAACAAGTTTAAATTGT
TTTAAAATGAAAATTTTTTTCTCAACCTAACATAAAATTGATTTATTTAAAATTAAAAAA
CTAAAAAACATTTTTCCACTTATTTTCTGAATGATTATTATTTTATTTATTTAAATTTAA
AACAGTTAATTTTTAATAAATTACACATCAATTATGTAAAGTGGAATTATAAAGTTTTAT
ATTCCAATTAATTCTGTTTACTAAGTAAGATTTAATTTTTAAAAAAAGGTATTAGATGAA
TCTCTACCAAAGGTTTTGAGCTCAAAGGCACCTTACATCTGGCTATTACCTACCGAAGAG
AGAAGAGATTATGAGAATGATAAAACTGTAATCTAATTTATTAATTAAATATTTTTATAT
GAATTTTATTAATGCTAAAAACTTATTTTAAAAAGGTATATGAATGCCCTGTTTACAAGA
CATCTCGTAGAGCTGGTACATTAAGTACTACTGGTCATTCTACAAATTTTGTAATGAGCA
TGTATTTACCTATAGCCCAAGAACATTAGCCAAAGCACTGGATTAAGAGAGGTGTAGCGG
CTCTAACTTAACTTGATGATTGA