Identifiers and Description

Gene Model Identifier

TTHERM_00420340

Standard Name

DYH10 (DYnein Heavy chain )

Aliases

PreTt07159 | 46.m00214 | 3679.m00064

Description

Heavy chain subunit of ciliary single-headed inner arm dynein (IAD)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF03028 ) Dynein heavy chain
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR02640 ) gas vesicle protein GvpN
  • ( PF00038 ) Intermediate filament protein
  • ( TIGR00137 ) tRNA:m(5)U-54 methyltransferase
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF03413 ) Peptidase propeptide and YPEB domain
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( PF07728 ) ATPase family associated with various
  • ( PF02878 ) Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
  • ( TIGR00327 ) protein translocase SEC61 complex gamma

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00420340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_189660
WormBaseWBGene000004859.997093137033517e-262locus:che-3 Cytoplasmic dyne
in 2 heavy chain 1 status:Pa
rtially_confirmed UniProt:Q1
9542 protein_id:CAA99830.2
Tetrahymena borealisEI9_11037.19.997093137033517e-262dynein heavy chain family prot
ein (4363 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig145.0.g209.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C2.000277046697593e-115DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  2. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  3. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  4. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_00420340(coding)
ATGCTTGCATCAAAAAGAGAATCATCATTATAACCACCATTTACAGCAATAGGAGTATCG
AAAATTTTTGAATCATGTGTTCAAAAAAATTTTTCATTAAATGATAGTCCTTTTAAATAA
GCTTTATTAAACGTAAGTTCGTATGGTAAAACTTGGAATGCTCTTGTGAAATGGGTGAAG
ACTTAGATTGAATCAGATAAAAATGTGTTAATACCACAATTCGGTTAAATTAAAGGAAAG
TTAATAGAAGGAGCTGATTAAAAATCAGTGGTATTCTCACTGAATGATAGCTTTTTAATT
TAAAATAACTTGAAATATAAAAATGAATATGATGATTTAACCTTCCCATAAGTTAATATC
TAGTATAGCCAAATAGCTAAATTTGTAGAAATGGATAAGACTGTTGTTCAATATATTATT
AACTCTATCTTCACAGAAATAATGAGTATTTTAGTTAATCAGAAGAAAATCAGTCTTAAC
TTAGGGTTGCTTGGTATTTTTAAGGTAGATTAATCAAAAAATGTAGTATTTATGCCACAA
TCTCAAGCTTAGGACTCTGTTATTATAAAGAGATAAGCTATAAGAAGTTTACATTAAATA
ACTTCTGCTAAACCCTAACGTTTACCTAAATTATTTAAGGACGATGATAGAAGTGAACTT
CTTAATTAATCTATAAGGGACCAAACTGATCTAAATGATTCTTTCCTCAACAAGACAATG
TTAACTTACAAGAAAGCTCAAAGCTAAGATTTTAGTCAAATGAATCTTTCTTTTAATTAA
TCTTCACTAAATAATATAAATAACAATATGACTTTTAATGCTTTGAATCAAACAGGATAC
TCACCTTCTAATCCAAAAATTCATAGACCAGCTCCATTATAAAATAGAAGAAATTTTCGT
TTTATGTAAAAAAGCGTCCTTCCAGATGATATAAATAGCGGAATGTCTTTTCATTAACAA
AAAATATAAAGCTAAATGAAACATATTTTAAGAGAGCTTACTCCAAAAAAAGAATTAAAG
ACTGTAGATGAAACAGAATCCCCAACAAGGAGATACATAAAACCTGATATTTCATTAATA
AATTAAGATTTGCTTGGGGCAGGCACAGATCCTTTGGCAAGAGAAAGTGACTTTTCAGCT
TTAGCATAAAATGCCTCATCTTTAATTAATGCCCACTTTGTAAAGCCATAGGTTGCTAGA
ATAAGATTTCCACCTGTTTTGGACAGATCATCTAGAACTATCGCTGCTCCAGTCTCAGCT
ACTATGCTTAATCTTAGTCCTTCATAAAGAATAGGAACAAACTATACATACACAGCAAGA
TTTTTATATTTAGACTAGGATGATAAATGTGTTAAAACATTAAGGAACAGTAATAATAGT
ATTTAATTTTAAGCTAACAAAGAATACTTATAACCCACAGCTTCTTTAGAAGAAGAGTTA
CTCCATTATGTAGATAGAGTTCAACATCCAGAATTAGAAGCTAAGATACGCTCAAAAAAA
ACTTGTTACGAAAGATACTAACTATATATTCAAGAATAAATCTCAAAAGATCAAGTAGCA
CCAATGAGATAGTATTGGGTTGATGCTATATTCGAACTTATTCCTGGTTAATTTGACCTT
TTGGATAAAGAGTATATTGGAAAGCTAATTGATAGAATGTTAATAGAAATTAGCTTAGAT
TATTATAATGCAATTAGAAAATCTATTTTAGATTATGTTTTAATCAACGAAGAAGAAAGA
TAAAGAGTTGGAATAATGTAAACTTTCTTCCCTATAGTGATATATGGCGATGGATATTAT
CAAGGAATAGAACCTGATGATGATTGGAAAAATAATTTAATGGCAGCAAAAGATGAATTA
CTTGATAAAATGGTTATATATAATAGAGCTACTCTACAAATTAGCTTTGAATGGAATACA
GAATTTAAGCCTAAAATGAAACTACTTCATATTAGAGAAAAAAACGAGGAATTAGAAACA
ATAAATAACTTTAGAAGCTAAATGAAGTATTTGAGGGATTAGGCTTTCTAAATTATTAAA
AAAGATTGGAATGAATCATTAGTTAGTATTTATAGAAGTATATTACTTGAAATTGAAGAT
AATGATGAAGAGTCTGAGAAATTTTTTGATTCTACTGCTATTTTACTTAGCAACCTAATT
AGATAACACATTACTGAGTAGGTTGATAATTATTGCAATTTTTTCAAAAGATTTGATGTT
TATCCTCGTTCACCATAAGAAATTTTAGCTGATGATAAAAGAGATTTTATTCATTCCACT
CATTATGATGTTTTTTTGAAAATAATACTTGTTGCTGATGATAATTAAAACGAGATCAAA
TTCGAAAATGAAATTGCTCAAATAGAAAAAGATCTTATTGATATATTAGAAGATATGATT
AGACTTTCTCATAACATCGCAAGGCCAGAGCATTCCTTAGTTAGAAGCGAAAAACATTAT
CTTTTTAAAATTTAAATTGATGATAGCTCAGATGAAACCTCGAATGATTATCATCTTAAA
AGCAATAAAAGAAGTAATTCTAATAATTCCACCGATGAGCTCTATATAAACTCAAAGAGA
ATGATTGAAAGAATTATTTCAAAAAATCTAGACAAAGTTGAAGAAGTTTTACCTATTTAC
AATGAGTTTAGCTTCTTGTTAGATCCTATAGACAAATTTATAAATGAATTTTTAGACTCT
ACACCAACAAGAGAAGACTACATTAAAAAATTTAAGGAATTTTAATAAATACAACTTAAT
ATTGAATAAAACCTTCCTCCTTTTATCAGAATGAATATGATTCTCGTAGATGGGTGCTAA
GTAAAGAGAGAATATGTTAAAATTTGCTCATAAATAATGGAAAAGCTTGCTGATAGTATT
GGAGAAACAATAAAATAAAAAAGCTTGCAAATGGATGCAGACATTACCAAGCTGCTTTAA
AACATATCAAAGAACGTAGATAGTACTTAAACTTTGGTTCATTTAGAATAAGAAATAGAA
AGGATTAGAATGAAAGAAGAAAGAAGAATCACATTAGAATATAAAGATTTGTGTGAATGG
ATGTCATTTTAAATAGGAAAACCTCGTAGAATTGACTAATCTGAATTTTTGAAGTTGTAT
GGTACTTCTCAAAATGTTTATTAGATGATGGATTAAGTTGACAAAGAAGAAGAAAGAATT
AAAGAACAAAGAGAACAAATAGAAGAAAACTTAAGAGTTTAGAAAAATAATTTCTAAAAA
AAAATAGAAGAATTTCAAATTAAAATATAAAAACTTAGAGAATATAGCTCACCAATAATG
TCAGAAGATGTTAATAGATTAATTTCCGAATATAATACTACATTAAATTAGATGATTGAA
GAAAAAGCTTAAATTAATCAAGATGAAGAGCTTTTAGGATAAACTTAAACTGAGTTTCCA
CAATTAGAAGAAGCTTTATAAAACTTAAAACCTTATGATGACCTTTGGTCCTTAGTTGCA
AATTTAAATAATAATCTCAATTCATGGTCTAAAGAAGGATCCATTTTCAGATTAGATCCT
GAAACTATAGAAAGAGAAACAAAAATGATGTTTTAGACTTCTATGAAATTAAATTTCTTA
TTTAACCCTCACCTTGCAACTGGATCTGCACCTCCTAAGAATTAGACTGGACCTGGCAAA
CTTATTAGCTAGTTAGTTGAATAAATTAAAGAATTTTAAACCCAAGTACCAATTGTAAGA
GCTTTATGCAATCCTGGTTTTAAATAAAGACATTGGGAAGAAATTACAAATGTGGTTGGT
TTTGTGATTTCAATTGAAAAAGAATACACTTTAAAAAGATTAGTAGATTTAGAAATTATT
GATCACCTTCCTAAATTAGAGGAAATATCTGAAGCAGCTAGCAAAGAATTTGCTATTGAA
AAGATACTTATTAAAATGAGAGAAGACTGGGATTAAGTTTAAGTTGAGCTTAAGGGCTGG
AAAGATACAGGGACTTATATTGTTTCTGGTAGCTCGATAGATGAAATGTAATAAATTTTG
GATGATTAAATTGTTAAAACATAAACTATGAAGAGTTCCCCCTACGCTAAGATTTTTGAA
AAGAAAATTAATGATTGGGAAAGTTGGTTAACATTTACATTTGATTTTTCTGAGTATTGG
GTAAAGGTTCAATCAGTTTGGATTTATTTAGAGCCTATCTTTTCTTCACCAGATATTTTA
AAAAGACTACCTTATGAAGGTTCTATTTTTAGAGAAGTAGATTAAAATTGGAGAGTTATT
ATGAAAGATATTCATGATAAATTAAAAGTATTAGAATTCACTAGGAATAGACATTTACTT
GAAATTTTAAAAGAATGCAATAATAAATTAGAAATTGTTTAAAAAGGTTTAAATGCTTAT
CTTGAAGGAAAGAGAGCTTCATTCCCTCGTTTTTATTTCTTATCAAATGATGAATTGCTT
GAAATTCTCTCAGAAACTAAAGATCCTTTACGTGTTTAGCCACATCTTAAAAAATGCTTT
GAAGGCATATAAAAATTAAATTTCGACTTGAACAAAAAAGTACACGGTATGTACTCTTCC
GAAGAGGAATATGTTGAATTCTTAACCTAAGTTGACACAGCCAGTGCTTAAGGTAACGTT
GATGAATGGCTTTTGTAAGTTGAAGGTAGTATGATAGAAGCAGTTAAGTATGCAATAGAA
AAATCTTTTGAAGATTACTAGAAAATAAAAAGATCTTAATGGGTTTAGGACAGATGTGGA
TAAAGTGTCTTAAATATGAGTATGACTTACTGGACATACGAAACAGAAAAAGCAATTGGA
TTAGGACCAAAGGGTATTCAGAAACATCTTGATTATTTAACCTAATCAATTGAAGACATT
GTATCTTTAGTTAGATAGAATATATCAAAGCTTAATAGATGTACTATTGAAGCTTTAATT
GTCCTCGATGTGCATAATTAGGATGTAGTTAGTGCATTAGTTAAGGAAGGAATATCTAAA
AAAGAAGAATTCGCTTGGTAATCGTAATTGAGATATTATTGGGAAGAAGCCAATACTGTA
GTTAAGATCATAAATGCAGTTGTTGAATATAATTATGAATATTTAGGTAACTCCCCAAGA
TTAGTTATCACGCCTTTGACAGATAGATGTTACAGAACATTGTGTGGTGCTATACATCTT
AATTACGGAGGAGCTCCAGAAGGTCCTGCAGGTACTGGTAAAACTGAAACAGTCAAAGAT
TTAGCAAAGGCTCTCGCCCGTTAATGTGTAGTATTTAATTGTTCTGATGGTTTGGATTAC
AAAGCAATGGGTAAATTCTTTAAAGGTTTAGCAAGTAGTGGTGCATGGAGTTGCTTTGAT
GAGTTTAATCGTATAGACCTTGAAGTGCTTTCTGTCGTTGCTCAATAAATATTAACTATT
CAACTAGCCAGAGGTAAAGGTGTTGATAAATTTGTTTTCGAAGACACTTTGATTCCTTTG
AAACCTACTTGTAATGTATTTATTACTATGAATCCTGGTTACGCAGGTCGTTCTGAACTC
CCAGACAACTTAAAGGCTCTTTTCAGAGCAGTAGCGATGATGGTTCCTGATTATGCCTTA
ATTGCTGAAATAGTACTTTATTCCTTTGGTTTTTCTGATGCAAGAAACTTGGCAAGAAAG
ATCGTTACAACTTATAAATTATGTTCAGAGTAATTATCATCTTAAGATCACTACGATTAT
GGTATGAGAGCAGTCAAATCAGTCTTAACTGCAGCTGGTAACTTAAAAAGAAAATATGTA
AATGAAAACGAAAGTGTATTGATGCTTAGAGCTATTAGTGATGTCAACCTAGCAAAATTC
TTAGCTTTCGATCTTCCTCTTTTCAAAGGTATAACAAAAGATCTCTTCCCTGGTGTTGAA
CTTCCAGAAATTGATTACTCAAATATGTTTGAGTGCATAGATGAATCTCTGAGAGAAGAG
AATTTGTAAAAGGTTCCATATTTTGTTGAAAAAATTATTTAATTATATGAAATGATTCTT
GTAAGACACGGTTTGATGGTTGTTGGACTTCCTTTTTCAGGTAAAACATCTGCTATTAAA
ATACTATAGAAGGCTTTAACAAAATTAAACGAAAGAAAATAAATGGATGAGAACAAGGTA
TAAATTACAGTTATTAATCCTAAGTCTATCCCAATGAAATTTTTGTATGGTTTTAATGAT
GAAATTTCTCATGAATGGACTGATGGTATTCTTGCAGTAAAATACAGAGCATTTGCTAAA
GCTGAGGATGATGATCGTAAATGGCTCATTTTTGATGGACCAGTTGATGCAGTTTGGATT
GAAAATATGAATACAGTACTTGATGATAACAAAAAACTATGTTTAAATAGTGGTGAAATT
ATCGCAATGTCTAAATCTATGAATTTAATTTTTGAACCTATGGATTTGTAGGCTGCTTCT
CCTGCTACTGTATCTCGTTGTGGTATGATTTATATGGAACCATCAAGTATGGGATGGTAG
CCACTCTATTAAAGTTGGAAGAAGCACTTACCTAAAACATTTAAATAAGAGGACTTTGAT
GAGCTTGATTTACTGTTTGGATTTATGGTAGATGCAGGTTTGAATTGGATTAGACACAAA
GGTGTAGAAGTTTCATCAACTTTAGATTAAAATCTAGTTCTTACTTTAATGAGATTACTA
AAGAATTTACTAAAAGATTTTGAAGATGAAAAATTCTATAGTGGTTTTTCAGACTCTAAA
ATAAAAATGCAAACTATTGACAATAAATTTATGTTTGCTTTTGTTTGGGGTATAGGTGGT
TCTCTGACTACTGAATATAGAAAATAGTTTGATGTCTTTGTAAAGAGATTAGCTAATGGA
GATATTCCACTTGATAATGATAAAATACCGAGAAAGAAAATGTCACTTCCTGAGCGTGCA
AATCTTTATGAGTACTGCTTAGTTAATAAGGAATCAGTAGGAGGTGGTGGTAAGAAATAA
GTTGTAAGTGAATGGGTATTGTGGGTTGATGAAATAAAGAAAGAAGAAATATCAAATAAA
ATTTAGCCTTAAGAAATATTAATTTAAACAACAGACACTTCTAGATATTCTTATATGATA
AATGTAGCAATTCAAGATGAATTCCCTGTTCTTCTTTGCGGTCCTACTGGTACAGGAAAA
TCTACTTACATAAAGAATATTCTTAATAATCACTTAGATGCTGTTAAATATATAACAATT
GAAATTGGTTTTAGTGCTTAGACATCTTGCACATAAACACAAGAAATTATTGATTCTAAG
TTGGACAGAATTTCAAAAGGAGTTTATGGGCCAAGAAATAAGAGATTAGTAGTTTTTATT
GATGATTTAAATATGCCTGCTAAAGAGTAATGGGGAGCACAACCTCCTATTGAAATTCTT
AGATAAAAATTAGATTAAGGTGGTTGGTATGACAATAAAGATAAAGAGAAATAGTTCAAA
TAAATCATAGATACGTAACTTATTAGTGCTATGGGTCCACCTGGAGGAGGCAGAACTTTC
ATAACTCCTCGTATTTTAAGACATTTTAGTTTAATTAGTTTAGCTAATTTCGATGATGAA
AACCTACACAGAATTTTTGGAACTATTTTAGAATGGTATTTGAAAAAGGGATAATTTGCT
GTAGAAGTTTAGAAATTTGCTTCTAAAATAATAACTGGTACTCTTGATATATATAAACAG
GCTATTTCTGAATTACTCCCAACACCTGCAAAATCACATTATTTGTTTAATTTAAGAGAT
TTCGCAAAGGTAATTTTTGGTATTTGTATGAGTGATAAAGATAAAGTACAAAATCCTGAA
CACATAACGAGGTTGTTTGTCCATGAAATATGGAGAGTGTTTGGTGATCGTTTGATTAAT
GATGATGATAGATTATATCTTCTTGAAGAAATTAGAAAAGTTGTTGCTAGATTCAGTATG
AATTTTGATAATATATTTGCTCATTTAGATAAGCCTGATTTAAAGAATAGAGGCTAAAAA
GATGGTAAAGTTAATACTGTAGAAGAAATGAGAGGTCTTATATGGACAGATGTTATGAAT
CCTATGGGTGCACAAAAAAGATATTATGAGGAAGTATTAGATTACGATAGATTATAAAAT
GCAGTTGAGTAGGGATTATCTAACTATAATATGATGACAGATAAGCCAATGGATTTAGTC
TTATTTAATTTTGCTATTGAGCATCTTTTAATCATCTCACGTATCTTGAAAAGTCCTGGA
GGAAATGCCTTATTAGTTGGTGTAGGTGGTTCAGGTAGATAAAGTTTAACAAGGCTTGCT
GCTTCAATTAGTGACTATAATGTTTGCTAAATAGAAATCTCTAAGCAATACGGAAAAGTT
GAATTCCATGAAGATCTTAAAGTAATTATGAGGAGTGCAGGTTCACTTGGAAAACCTACT
GTTTTCTTATTTACAGATTCTTAAATTAAGCAAGAATCATTCGTTGAAGATATTAATAGT
TTACTTAATACCTTTGAAGTACCAAACTTGTTTGCTCCTGATGAAAAAGCAGATGCCCTC
GAAAAAATGAGAGTTGCCACAAAATAAGAAGGAAAATAAAAAGAAGGAACTCCAACATAA
ATGTATGCATACTTTATAGAAAGAGTAAAGAAAAATCTCCATATCGTACTTTGTTTCTCA
CCTATTGGTGATGCATTTAGAACTCGTGTTAGAATGTTCCCTTCTCTAGTAAATTGTTGC
ACTATTGATTGGTTTTAAGAGTGGCCTTAAGATGCCCTGTTGAGTGTTGCTAACAAATTT
ACTTAAAATATTCCTATGGATAAAAATATTAAAAAAAGTTGCATAGAATTGCTCTAATAT
TTCCACTAATCAACAATCAACTGGTCAAAAACATTCTTTTCTAAACTGAGAAGAAAATAT
TATGTTACTCCTACTTCATATATTGAAATGATCTAAAGCTTTAATAGTCTCCTAGAAGAA
AAAAGAAAAAAACTACAGGCTGACTAATTCAAGTATGAAAATGGTTATGAGTAGATTATT
TAAACTGAAAAAAATATTGGTAAAATGTAAGAAGATTTAGAAGCTTTGCAGCCTTAGCTC
AAGCAAGCAGCTATAGACACTGAAAAAAAAGAATTAGAAGTTACTGAATAGGCTAAAGAA
GCCGATAAATTAAAGAAAGTCATTTCAGAAGAAGAAGCAGTAGTTTAAGTTGCTGTTAAT
GAAGCAAATGAAATTAAAGCAGAATGTGAAAAAGATTTAAAAGAGGCTTTACCAGCTTTG
TAAGCAGCAGAAGATGCCTTGAGAGTTTTAGATAGAAAAGATATCGATCAGTTAAAGGCA
ATGAAAAATCCTCCCCTGCCTGTAAAAACAGTTATGTAAGCTCTGTGCCTTATTTTATAT
CCTAATCCTTCAGAAAAAAAGAAAAACAATGAAACATTAAGAATCGAAATTGACTGGTGG
GCTGCTTCTTTAAAGCTGCTAAACAACACTGGTTTACTTTAAACACTTGTGCAATTTGAT
AGAGATAATGTTGAAGAAGGAATTATAGTTAATCTTGGAAAATTCTTGAAAGACCCAGCA
AATGAAAGAAACCTCGATATAAGTGTAGTCTAAAATGCTTCTACTGCTTGTAAGTGTATT
ATTATGTGGATCAATGGTATTTATAGCTATTATTTTGTTTACAAGAAAGTTAAACCAAAA
AAAATTGCTTTGAGATAAGCTGAAGAAAAGGTAGGTGGTTTAAATGCTACTCTTTCTAAA
AAGTAAAAAGAACTAAAAGAAGCAAATGATAAAGTTCAAAGACTTAATGATGAATTGACC
TTTACTCAAAATAATAAAATAAGACTTTAGTAGAGGTATCAGGAGTGCTAGTTACAATTA
GAACGTGCTACCTAGCTAATTGAATCATTAGGTGGTGAGAAGGGAAGATGGAAAGAATTA
GCTGAATAATTAAAATCTGAATATGATAAGCTTACTGGTGATGTTCTTATTTCATCAGGT
GTAATAGCATATTTAGGAGCCTTCACTTCTGCATTCAGGTAAGAAATTATTACTGAATGG
ACTAAGCTTTCAAAAGAGAGAAATATACCCTCAAGTGAAAATTTCAGCTTAAGCCATGTG
CTAGGTGATCCTGTTAAGATAAGATCGTGGAATTTAGATGGTTTACCAAGCGATAACTTC
TCTATAGATAATGGTATAGTTATTTTTAAGGCAAGAAGATGGCCATTGTGTATTGATCCT
TAAAATCAAGCAAACAAATGGATTAAGAAGATGGAACAACAAAAAGGCCTTTACATTATA
AAACTAAGTGACAGTGATTACTTGAGAACCTTAGAAAATGCTATATAATTTGGAAAACCT
GTCTTACTTGAAAATGTAGGTGAGGATCTAGATCCTTCACTATCTCCTATCCTTCTAAAA
TAAACTTTTGTTAAAGGTAACTCTGTTTTCTTAAAACTTGGTGATCAAACTCTTGAATAT
TCTAAGGATTTCCGCTTTTATATCACTACCAAATTGAGAAACCCTCATTATCTGCCTGAA
ATTTCAACTAAAGTTACTTTGATTAACTTCATGATTACTTATGAAGGTCTTAATGATTAA
TTACTTGGTATTTTGGTCAAGAAGGAGCGTCCTGACTTAGAAGAGGAAAAAGAAAGACTT
ATTATTGAAGGTGCTTAAAATAAAGCTCAATTATTTGAAATTGAAGAAAAAATTTTATAG
GTTCTTTCCAGTGATAAAAATATCCTAACAGATGAAGAAGCTATTAAGGTTTTGACAGCT
TCAAAAGAAAAATCCAACGAAATCAATGAAAAATAAGCAAATGCTGAAATTACTGAAAAA
AGTATTGATGCTGCTCGTCAGGAGTATCAAGAAGTTTCTTAAGAAGCCTCCCATTTGTTC
TTTGCCATCTCAGATCTAGTGAGCATAGATCCTATGTATTAGTATTCTTTGGTTTACTAT
ATTGACTTGTTCTCTCAATCAATTCTGAAGTCAGAAAAATCAGCTAATGTAGCTGTAAGA
CTTGACAATTTAAAAACATATTTCTTATATTCGCTATATTCAAACATTTGCCGTTCACTA
TTCGAAAAAGATAAATTGCTACTTTCATTCGTATTATGCGAGCGTTTATTAGAATTTAAA
GGCTAAATATTAAATGATCATTTTAGATTCTTGTTGACAGGAGGTCTAGCTGTAAGCGAA
AAACTTCCTGATTTACCCATTGACTGCTAGTGGTTGTCTAACAAAAGCTGGGGTGAAATA
AATAGATTGAGTGCTCTACCAAATTTTGAAGAATTTTACATGACATTCTATGACTACAGC
AAATAATGGAAAGATATATATGACTCTCCTGAACCACATAAAAAGCCATTACCTAAGGAT
ATTGCTAGTAAGTTTGACTCATTCCATAGACTTCTTATACTAAGAACTTTAAGACCAGAT
AAAATGATACCTGCTATTATGGATTTCATTACAGAGAGACTAGGTAAAAAGTTTATAGAA
CCTCCTCCATTTGATCTAGCTGCCACTTATTTAGATTCAACATGCTTTACTCCACTTATT
TTTATTTTATCTCCTGGTTCTGATCCTTTTGCATCTTTAAATAGTTTTTCAGAGCAAAAG
AAGAAAAATATAACAGCTATTTCTTTAGGTTAAGGATAAGGGCCTGCTGCACAAAAAATG
ATCTAAGATGGTCAAAAGTCAGGTAATTGGGTTGTTCTGTAGAATTGTCACTTAGCTGTC
AGCTGGATGCCTACTTTAGAAAAAATTATTGAAGAATTCAACACAGGCAATACTGATCCT
GATTTTAGATTATGGTTGACTTCTTATCCCTCTGAGAAATTCCCAACTGCTATACTTTAA
GGTGGTGTTAAAATGACTACTGAAGCTCCTAAGGGTCTCAAATCTAATCTTTTGGGTAGT
TATTTAACGGATCCTATTTCAAGAGAAGATTTCTTTAACAGTTGCTAAAATTCAAGAGCA
TTTAAAAATTTACTATTTGGGCTTTGCTTCTTCCATGCGGTAATTCAAGAAAGAAGAAAA
TATGGTCCTCTTGGTTGGAATATTCCTTATGAATTCAATGAATCTGATTTACGTATCAGT
GTGAGATAGCTATAAATGTTCTTATTAGAATGTCCAAATAACAGTTCTATTCCTTTTGCA
GCACTTAAGTATTTAACTTCTGAATGCAATTATGGTGGTAGAGTTACTGATGATAAAGAC
AGAAGATTAATTACGACACTATTAGGTGATTATTACAATTTGAAAGTGATTGAAGATCCA
TTATATAAATTTGCTCCCGATCCAAACTATAGAATTCCAGATAATGATTCTTATGAAGGA
GCCTTACAGTTTATAAAAGATCTTCCTATATATACAAAACCCGAAGTTTTTGGCTTCCAC
TCTAATGCAGATATTACCAAAGATATAAATGAAACAACTCTATTCTTAGATTCTCTTTTG
TTATGCTCTAGTGAAGGAGGATCATCTGAAGGTAGTTCTCATGATGATACTTTGAAGAAG
CTGATAGAATCAATTATGGGTGATTTCCCAAAAGAATTTGATGTGGAATAAGCAATTATA
AAATATCCTGTAAACTACAACGAATCCATGAACACAGTGCTTACTCAAGAATTAAATCGT
TTCAATAAGCTAATTTCAATTATTCGTTCTTCACTTAAAGATATTAATTTAGCATTATAA
GGTAAAATTCTCTTAAGTCAAAGCTTAGAAAGGGCATGTAAATAAATTATTGATGGCAAA
GTACCTCAGCTCTGGATGGAAAAATCGTATCCATCCTTAAAACCATTAGGTGCTTATGTT
AATGATTTGAGAATGAGATTAAAATTCTTTTAGGATTGGATAGATAATGGAGCACCAGTA
AACTTTTGGATTTCTGGATTTTACTTCACTCAATCTTTCCTTACAGGTGTTCTTTAAAAT
TTCGCAAGAAAGTATGTAATTCCTATCGATGAGATTGAGTTTGACTTTAAAGTTATGCAT
AAGTCAGAAGAAGTTAAGCCAGAAGATGGTGCTTATGTATTTGGTCTTTTCATAGAAGGT
TCAAAGTGGAATCCTATACAAATGGAGTTGGATGAATCTGATCCAAAAGTTTTATTTGTT
TAATGTCCTACTCTCCTTCTTAAGCCATCCCAATCAAAAAAATTAAGCAATTTCCCTCAT
TATAACTCTCCTGTATATAAAACATCAGCAAGAAGAGGAACTCTTTCTACAACGGGTCAC
TCAACAAATTTCGTAATGTGGATTAGACTACCAAGCTCTAGACCTGAAAAGCATTGGATT
AAGAGAGGTGTAGCATTATTGACACAATTGGATGATTGA


>TTHERM_00420340(protein)
MLASKRESSLQPPFTAIGVSKIFESCVQKNFSLNDSPFKQALLNVSSYGKTWNALVKWVK
TQIESDKNVLIPQFGQIKGKLIEGADQKSVVFSLNDSFLIQNNLKYKNEYDDLTFPQVNI
QYSQIAKFVEMDKTVVQYIINSIFTEIMSILVNQKKISLNLGLLGIFKVDQSKNVVFMPQ
SQAQDSVIIKRQAIRSLHQITSAKPQRLPKLFKDDDRSELLNQSIRDQTDLNDSFLNKTM
LTYKKAQSQDFSQMNLSFNQSSLNNINNNMTFNALNQTGYSPSNPKIHRPAPLQNRRNFR
FMQKSVLPDDINSGMSFHQQKIQSQMKHILRELTPKKELKTVDETESPTRRYIKPDISLI
NQDLLGAGTDPLARESDFSALAQNASSLINAHFVKPQVARIRFPPVLDRSSRTIAAPVSA
TMLNLSPSQRIGTNYTYTARFLYLDQDDKCVKTLRNSNNSIQFQANKEYLQPTASLEEEL
LHYVDRVQHPELEAKIRSKKTCYERYQLYIQEQISKDQVAPMRQYWVDAIFELIPGQFDL
LDKEYIGKLIDRMLIEISLDYYNAIRKSILDYVLINEEERQRVGIMQTFFPIVIYGDGYY
QGIEPDDDWKNNLMAAKDELLDKMVIYNRATLQISFEWNTEFKPKMKLLHIREKNEELET
INNFRSQMKYLRDQAFQIIKKDWNESLVSIYRSILLEIEDNDEESEKFFDSTAILLSNLI
RQHITEQVDNYCNFFKRFDVYPRSPQEILADDKRDFIHSTHYDVFLKIILVADDNQNEIK
FENEIAQIEKDLIDILEDMIRLSHNIARPEHSLVRSEKHYLFKIQIDDSSDETSNDYHLK
SNKRSNSNNSTDELYINSKRMIERIISKNLDKVEEVLPIYNEFSFLLDPIDKFINEFLDS
TPTREDYIKKFKEFQQIQLNIEQNLPPFIRMNMILVDGCQVKREYVKICSQIMEKLADSI
GETIKQKSLQMDADITKLLQNISKNVDSTQTLVHLEQEIERIRMKEERRITLEYKDLCEW
MSFQIGKPRRIDQSEFLKLYGTSQNVYQMMDQVDKEEERIKEQREQIEENLRVQKNNFQK
KIEEFQIKIQKLREYSSPIMSEDVNRLISEYNTTLNQMIEEKAQINQDEELLGQTQTEFP
QLEEALQNLKPYDDLWSLVANLNNNLNSWSKEGSIFRLDPETIERETKMMFQTSMKLNFL
FNPHLATGSAPPKNQTGPGKLISQLVEQIKEFQTQVPIVRALCNPGFKQRHWEEITNVVG
FVISIEKEYTLKRLVDLEIIDHLPKLEEISEAASKEFAIEKILIKMREDWDQVQVELKGW
KDTGTYIVSGSSIDEMQQILDDQIVKTQTMKSSPYAKIFEKKINDWESWLTFTFDFSEYW
VKVQSVWIYLEPIFSSPDILKRLPYEGSIFREVDQNWRVIMKDIHDKLKVLEFTRNRHLL
EILKECNNKLEIVQKGLNAYLEGKRASFPRFYFLSNDELLEILSETKDPLRVQPHLKKCF
EGIQKLNFDLNKKVHGMYSSEEEYVEFLTQVDTASAQGNVDEWLLQVEGSMIEAVKYAIE
KSFEDYQKIKRSQWVQDRCGQSVLNMSMTYWTYETEKAIGLGPKGIQKHLDYLTQSIEDI
VSLVRQNISKLNRCTIEALIVLDVHNQDVVSALVKEGISKKEEFAWQSQLRYYWEEANTV
VKIINAVVEYNYEYLGNSPRLVITPLTDRCYRTLCGAIHLNYGGAPEGPAGTGKTETVKD
LAKALARQCVVFNCSDGLDYKAMGKFFKGLASSGAWSCFDEFNRIDLEVLSVVAQQILTI
QLARGKGVDKFVFEDTLIPLKPTCNVFITMNPGYAGRSELPDNLKALFRAVAMMVPDYAL
IAEIVLYSFGFSDARNLARKIVTTYKLCSEQLSSQDHYDYGMRAVKSVLTAAGNLKRKYV
NENESVLMLRAISDVNLAKFLAFDLPLFKGITKDLFPGVELPEIDYSNMFECIDESLREE
NLQKVPYFVEKIIQLYEMILVRHGLMVVGLPFSGKTSAIKILQKALTKLNERKQMDENKV
QITVINPKSIPMKFLYGFNDEISHEWTDGILAVKYRAFAKAEDDDRKWLIFDGPVDAVWI
ENMNTVLDDNKKLCLNSGEIIAMSKSMNLIFEPMDLQAASPATVSRCGMIYMEPSSMGWQ
PLYQSWKKHLPKTFKQEDFDELDLLFGFMVDAGLNWIRHKGVEVSSTLDQNLVLTLMRLL
KNLLKDFEDEKFYSGFSDSKIKMQTIDNKFMFAFVWGIGGSLTTEYRKQFDVFVKRLANG
DIPLDNDKIPRKKMSLPERANLYEYCLVNKESVGGGGKKQVVSEWVLWVDEIKKEEISNK
IQPQEILIQTTDTSRYSYMINVAIQDEFPVLLCGPTGTGKSTYIKNILNNHLDAVKYITI
EIGFSAQTSCTQTQEIIDSKLDRISKGVYGPRNKRLVVFIDDLNMPAKEQWGAQPPIEIL
RQKLDQGGWYDNKDKEKQFKQIIDTQLISAMGPPGGGRTFITPRILRHFSLISLANFDDE
NLHRIFGTILEWYLKKGQFAVEVQKFASKIITGTLDIYKQAISELLPTPAKSHYLFNLRD
FAKVIFGICMSDKDKVQNPEHITRLFVHEIWRVFGDRLINDDDRLYLLEEIRKVVARFSM
NFDNIFAHLDKPDLKNRGQKDGKVNTVEEMRGLIWTDVMNPMGAQKRYYEEVLDYDRLQN
AVEQGLSNYNMMTDKPMDLVLFNFAIEHLLIISRILKSPGGNALLVGVGGSGRQSLTRLA
ASISDYNVCQIEISKQYGKVEFHEDLKVIMRSAGSLGKPTVFLFTDSQIKQESFVEDINS
LLNTFEVPNLFAPDEKADALEKMRVATKQEGKQKEGTPTQMYAYFIERVKKNLHIVLCFS
PIGDAFRTRVRMFPSLVNCCTIDWFQEWPQDALLSVANKFTQNIPMDKNIKKSCIELLQY
FHQSTINWSKTFFSKLRRKYYVTPTSYIEMIQSFNSLLEEKRKKLQADQFKYENGYEQII
QTEKNIGKMQEDLEALQPQLKQAAIDTEKKELEVTEQAKEADKLKKVISEEEAVVQVAVN
EANEIKAECEKDLKEALPALQAAEDALRVLDRKDIDQLKAMKNPPLPVKTVMQALCLILY
PNPSEKKKNNETLRIEIDWWAASLKLLNNTGLLQTLVQFDRDNVEEGIIVNLGKFLKDPA
NERNLDISVVQNASTACKCIIMWINGIYSYYFVYKKVKPKKIALRQAEEKVGGLNATLSK
KQKELKEANDKVQRLNDELTFTQNNKIRLQQRYQECQLQLERATQLIESLGGEKGRWKEL
AEQLKSEYDKLTGDVLISSGVIAYLGAFTSAFRQEIITEWTKLSKERNIPSSENFSLSHV
LGDPVKIRSWNLDGLPSDNFSIDNGIVIFKARRWPLCIDPQNQANKWIKKMEQQKGLYII
KLSDSDYLRTLENAIQFGKPVLLENVGEDLDPSLSPILLKQTFVKGNSVFLKLGDQTLEY
SKDFRFYITTKLRNPHYLPEISTKVTLINFMITYEGLNDQLLGILVKKERPDLEEEKERL
IIEGAQNKAQLFEIEEKILQVLSSDKNILTDEEAIKVLTASKEKSNEINEKQANAEITEK
SIDAARQEYQEVSQEASHLFFAISDLVSIDPMYQYSLVYYIDLFSQSILKSEKSANVAVR
LDNLKTYFLYSLYSNICRSLFEKDKLLLSFVLCERLLEFKGQILNDHFRFLLTGGLAVSE
KLPDLPIDCQWLSNKSWGEINRLSALPNFEEFYMTFYDYSKQWKDIYDSPEPHKKPLPKD
IASKFDSFHRLLILRTLRPDKMIPAIMDFITERLGKKFIEPPPFDLAATYLDSTCFTPLI
FILSPGSDPFASLNSFSEQKKKNITAISLGQGQGPAAQKMIQDGQKSGNWVVLQNCHLAV
SWMPTLEKIIEEFNTGNTDPDFRLWLTSYPSEKFPTAILQGGVKMTTEAPKGLKSNLLGS
YLTDPISREDFFNSCQNSRAFKNLLFGLCFFHAVIQERRKYGPLGWNIPYEFNESDLRIS
VRQLQMFLLECPNNSSIPFAALKYLTSECNYGGRVTDDKDRRLITTLLGDYYNLKVIEDP
LYKFAPDPNYRIPDNDSYEGALQFIKDLPIYTKPEVFGFHSNADITKDINETTLFLDSLL
LCSSEGGSSEGSSHDDTLKKLIESIMGDFPKEFDVEQAIIKYPVNYNESMNTVLTQELNR
FNKLISIIRSSLKDINLALQGKILLSQSLERACKQIIDGKVPQLWMEKSYPSLKPLGAYV
NDLRMRLKFFQDWIDNGAPVNFWISGFYFTQSFLTGVLQNFARKYVIPIDEIEFDFKVMH
KSEEVKPEDGAYVFGLFIEGSKWNPIQMELDESDPKVLFVQCPTLLLKPSQSKKLSNFPH
YNSPVYKTSARRGTLSTTGHSTNFVMWIRLPSSRPEKHWIKRGVALLTQLDD


>TTHERM_00420340(gene)
ATGCTTGCATCAAAAAGAGAATCATCATTATAACCACCATTTACAGCAATAGGAGTATCG
AAAATTTTTGAATCATGTGTTCAAAAGTAAGTTATTTAAATAAAAGTATCATTTAAGCAA
ATATTTATTGTTATTGAAATAGAAATTTTTCATTAAATGATAGTCCTTTTAAATAAGCTT
TATTAAACGTAAGTTCGTATGGTAAAACTTGGAATGCTCTTGTGAAGTAATTATTTTTAT
TGATCTAACATAATTATTGTTGATTTTTAATTGAATTTAAATGTTTTATTGAGCAATCAA
TGATTTTATTCATGGTAAAATAAAGATGGGTGAAGACTTAGATTGAATCAGATAAAAATG
TGTTAATACCACAATTCGGTATGAACTTTATTTAGAAAAATTAGAAAAAGTTAGATATCT
TTAATAAATAATAGGTTAAATTAAAGGAAAGTTAATAGAAGGAGCTGATTAAAAATCAGT
GGTATTCTCACTGAATGATAGCTTTTTAATTTAAAATAACTTGAAATATAAAGTAATTAT
TTTAAAAAATTAATTTGTAAGTAACTCAGTGGTAATATGATAAAAAATTAGAATGAATAT
GATGATTTAACCTTCCCATAAGTTAATATCTAGTATAGCCAAATAGCTAAATTTGTAGAA
ATGGATAAGACTGTTGTTCAATATATTATTAACTCTATCTTCACAGAAATAATGAGTGTA
AAAGCAATTATTATTAAACAGATAAATCTAAATATTTATTTTATTATATTTAGATTTTAG
TTAATCAGAAGAAAATCAGTCTTAACTTAGGGTTGCTTGGTATTTTTAAGGTAGATTAAT
CAAAAAATGTAGTATTTATGCCACAATCTCAAGCTTAGGACTCTGTTATTATAAAGAGAT
AAGCTATAAGAAGTTTACATTAAATAACTTCTGCTAAACCCTAACGTTTACCTAAATTAT
TTAAGGACGATGATAGAAGTGAACTTCTTAATTAATCTATAAGGGACCAAGTAATTAATT
ATTCAACTTGTAAAAATTTTAATGTTTAAAATATTTTTTTTTATCTCATACATAGACTGA
TCTAAATGATTCTTTCCTCAACAAGACAATGTTAACTTACAAGAAAGCTCAAAGCTAAGA
TTTTAGTCAAATGAATCTTTCTTTTAATTAATCTTCACTAAATAATATAAATAACAATAT
GACTTTTAATGTATGACTTCTAAAAAATTTTGAATTAATATTTTAATCAACTTTTATTAA
AAAAGGCTTTGAATCAAACAGGATACTCACCTTCTAATCCAAAAATTCATAGACCAGCTC
CATTATAAAATAGAAGAAATTTTCGTTTTATGTAAAAAAGCGTCCTTCCAGATGATATAA
ATAGCGGAATGTCTTTTCATTAACAAAAAATATAAAGCTAAATGAAACATATTTTAAGAG
AGCTTACTCCAAAAAAAGAATTAAGTAATTTATTTAGTAAACTAATCATAAAAGTTAATG
CTATTTATTATTTAAATTATATAGAGACTGTAGATGAAACAGAATCCCCAACAAGGAGAT
ACATAAAACCTGATATTTCATTAATAAATTAAGATTTGCTTGGGGCAGGCACAGATCCTT
TGGCAAGAGAAAGTGACTTTTCAGCTTTAGCATAAAATGCCTCATCTTTAATTAATGCCC
ACTTTGTAAAGCCATAGGTTGCTAGAATAAGATTTCCACCTGTTTTGGACAGATCATCTA
GAACTATCGCTGCTCCAGTCTCAGCTACTATGCTTAATCTTAGTCCTTCATAAAGAATAG
GAACAAACTATACATACACAGCAAGATTTTTATATTTAGACTAGGATGATAAATGTGTTA
AAACATTAAGGAACAGTAATAATAGTATTTAATTTTAAGCTAACAAAGAATACTTATAAC
CCACAGCTTCTTTAGAAGAAGAGTTACTCCATTATGTAGATAGAGTTCAACATCCAGAAT
TAGAAGCTAAGATACGCTCAAAAAAAACTTGTTACGAAAGATACTAACTATATATTCAAG
AATAAATCTCAAAAGATCAAGTAGCACCAATGAGGTAATTGAGAAAAGCAAAAAACTAAA
GTATAATTTTTTTAAAAAATAAATAGATAGTATTGGGTTGATGCTATATTCGAACTTATT
CCTGGTTAATTTGACCTTTTGGATAAAGAGTATATTGGAAAGCTAATTGATAGAATGTTA
ATAGAAATTAGCTTAGATTATTATAATGCAATTAGAAAATCTATTTTAGATTATGTTTTA
ATCAACGAAGAAGAAAGATAAAGAGTTGGAATAATGTAAACTTTCTTCCCTATAGTGATA
TATGGCGATGGATATTATCAAGGTATTTTCTTTTAGAAATTATAATATTTAAATATTTAC
TAGAAATATCTAACAAAAATTATTAGGAATAGAACCTGATGATGATTGGAAAAATAATTT
AATGGCAGCAAAAGATGAATTACTTGATAAAATGGTTATATATAATAGAGCTACTCTACA
AATTAGCTTTGAATGGAATACAGAATTTAAGCCTAAAATGAAACTACTTCATATTAGAGA
AAAAAACGAGGGTAAATTATAAAATTAATAATTATTTCTAATTTATTTATTTTTTGTAAA
TAGAATTAGAAACAATAAATAACTTTAGAAGCTAAATGAAGTATTTGAGGGATTAGGCTT
TCTAAATTATTAAAAAAGATTGGAATGAATCATTAGTTAGTATTTATAGAAGTATATTAC
TTGAAATTGAAGATAATGATGAAGAGTCTGAGAAATTTTTTGATTCTACTGCTATTTTAC
TTAGCAACCTAATTAGATAACACATTACTGAGTAGGTTGATAATTATTGCAATTTTTTCA
AAAGATTTGATGTTTATCCTCGTTCACCATAAGAAATTTTAGCTGATGATAAAAGAGATT
TTATTCATTCCACTCATTATGATGTTTTTTTGAAAATAATACTTGTTGCTGATGATAATT
AAAACGAGATCAAATTCGAAAATGAAATTGCTCAAATAGAAAAAGATCTTATTGATATAT
TAGAAGATATGATTAGACTTTCTCATAACATCGCAAGGCCAGAGCATTCCTTAGTTAGAA
GCGAAAAACATTATCTTTTTAAAATTTAAATTGATGATAGCTCAGATGAAACCTCGAATG
ATTATCATCTTAAAAGCAATAAAAGAAGTAATTCTAATAATTCCACCGATGAGCTCTATA
TAAACTCAAAGAGAATGATTGAAAGAATTATTTCAAAAAATCTAGACAAAGTTGAAGAAG
TTTTACCTATTTACAATGAGTTTAGCTTCTTGTTAGATCCTATAGACAAATTTGTAATTA
AAAAATAAAAAAAATAAAATAATTTTAACATTTTTATCTTTTTATATAAATAGATAAATG
AATTTTTAGACTCTACACCAACAAGAGAAGACTACATTAAAAAATTTAAGGAATTTTAAT
AAATACAACTTAATATTGAATAAAACCTTCCTCCTTTTATCAGAATGAATATGATTCTCG
TAGATGGGTGCTAAGTAAAGAGAGAATATGTTAAAATTTGCTCATAAATAATGTAAGAAT
TTTTTTTTTTTAAATTATTTTATTAATAAAATTTTAAATTTAGGGAAAAGCTTGCTGATA
GTATTGGAGAAACAATAAAATAAAAAAGCTTGCAAATGGATGCAGACATTACCAAGCTGC
TTTAAAACATATCAAAGAACGTAGATAGTACTTAAACTTTGGTTCATTTAGAATAAGAAA
TAGAAAGGATTAGAATGAAAGAAGAAAGAAGAATCACATTAGAATATAAAGATTTGTGTG
AATGGATGTCATTTTAAATAGGAAAACCTCGTAGAATTGACTAATCTGAATTTTTGAAGT
TGTATGGTACTTCTCAAAATGTTTATTAGATGATGGATTAAGTAAATTGCCTTATGAATT
TCAAATTTTAAAACTATAATTCCCCTAAATAAAGGTTGACAAAGAAGAAGAAAGAATTAA
AGAACAAAGAGAACAAATAGAAGAAAACTTAAGAGTTTAGAAAAATAATTTCTAAAAAAA
AATAGAAGAATTTCAAATTAAAATATAAAAACTTAGAGAATATAGCTCACCAATAATGTC
AGAAGATGTTAATAGATTAATTTCCGAATATAATACTACATTAAATTAGATGATTGAAGA
AAAAGCTTAAATTAATCAAGATGAAGAGCTTTTAGGTATTATTATTATTTATATTTCATA
ATTAATTTCAAAATTTTATAATCAGGATAAACTTAAACTGAGTTTCCACAATTAGAAGAA
GCTTTATAAAACTTAAAACCTTATGATGACCTTTGGTCCTTAGTTGCAAATTTAAATAAT
AATCTCAATTCATGGTCTAAAGAAGGATCCATTTTCAGATTAGATCCTGAAACTATAGAA
AGAGAAACAAAAATGATGTTTTAGACTTCTATGAAATTAAATTTCTTATTTAACCCTCAC
CTTGCAGTAATTCTTTTAAATTATATATTTGTCCTCTTTTTAAAAATTATTCATATTATA
AAGACTGGATCTGCACCTCCTAAGAATTAGACTGGACCTGGCAAACTTATTAGCTAGTTA
GTTGAATAAATTAAAGAATTTTAAACCCAAGTACCAATTGTAAGAGCTTTATGCAATCCT
GGTTTTAAATAAAGACATTGGGAAGAAATTACAAATGTGGTTGGTTTTGTGATTTCAATT
GAAAAAGAATACACTTTAAAAAGATTAGTAGATTTAGAAATTATTGATCACCTTCCTAAA
TTAGAGGAAATATCTGAAGCAGCTAGCAAAGAATTTGCTATTGAAAAGATACTTATTAAA
ATGAGAGAAGACTGGGATTAAGTTTAAGTTGAGCTTAAGGGCTGGAAAGATACAGGGACT
TATATTGTTTCTGGTAAAAACCTATAAAAATAAAGATATTTTTTTATAAAGAAATAATCA
TTTTTAAAAATATTTGATTAATTTACTTTATTTTTATTTTTTGAAATGATGTCTTCTTTG
CAATAAAAATATTGACTTTATTCAAATTGATATTTAGGTAGCTCGATAGATGAAATGTAA
TAAATTTTGGATGATTAAATTGTTAAAACATAAACTATGAAGAGTTCCCCCTACGCTAAG
ATTTTTGAAAAGAAAATTAATGATTGGGAAAGTTGGTTAACATTTACATTTGATTTTTCT
GAGTATTGGGTAAAGGTTCAATCAGTTTGGATTTATTTAGAGCCTATCTTTTCTTCACCA
GATATTTTAAAAAGACTACCTTATGAAGGTAATTAATTAATTTACTATATTTTCTAAATT
TTTGAGATTTATAAGTTGATGGTTTATATTTATAAAAGGTTCTATTTTTAGAGAAGTAGA
TTAAAATTGGAGAGTTATTATGAAAGATATTCATGATAAATTAAAAGTATTAGAATTCAC
TAGGAATAGACATTTACTTGAAATTTTAAAAGAATGCAATAATAAATTAGAAATTGTTTA
AAAAGGTTTAAATGCTTATCTTGAAGGAAAGAGAGCTTCATTCCCTCGTTTTTATTTCTT
ATCAAATGATGAATTGCTTGAAATTCTCTCAGAAACTAAAGATCCTTTACGTGTTTAGCC
ACATCTTAAAAAATGCTTTGAAGGCATATAAAAATTAAATTTCGACTTGAACAAAAAAGT
ACACGGTATGTACTCTTCCGAAGAGGAATATGTTGAATTCTTAACCTAAGTTGACACAGC
CAGTGCTTAAGGTAACGTTGATGAATGGCTTTTGTAAGTTGAAGGTAGTATGATAGAAGC
AGTTAAGTATGCAATAGAAAAATCTTTTGAAGATTACTAGAAAATAAAAAGATCTTAATG
GGTTTAGGACAGATGTGGATAAAGTGTCTTAAATATGAGTATGACTTACTGGACATACGA
AACAGAAAAAGCAATTGGATTAGGACCAAAGGGTATTCAGAAACATCTTGATTATTTAAC
CTAATCAGTAATGAGAATTTGCGATACTAAAAAATTAAAAATTTTTTATTTATTTAATAG
ATTGAAGACATTGTATCTTTAGTTAGATAGAATATATCAAAGCTTAATAGATGTACTATT
GAAGCTTTAATTGTCCTCGATGTGCATAATTAGGATGTAGTTAGTGCATTAGTTAAGGAA
GGAATATCTAAAAAAGAAGAATTCGCTTGGTAATCGTAATTGAGATATTATTGGGAAGAA
GCCAATACTGTAGTTAAGATCATAAATGCAGTTGTTGAATATAATTATGAATATTTAGGT
AACTCCCCAAGATTAGTTATCACGCCTTTGACAGATAGATGTTACAGAACATTGTGTGGT
GCTATACATCTTAATTACGGAGGAGCTCCAGAAGGTCCTGCAGGTAACAAAAAAAAAAAA
ACAATTATATTTTTTATTGAAAAAATTTAATTTTATAATAGGTACTGGTAAAACTGAAAC
AGTCAAAGATTTAGCAAAGGCTCTCGCCCGTTAATGTGTAGTATTTAATTGTTCTGATGG
TTTGGATTACAAAGCAATGGGTAAATTCTTTAAAGGTTTAGCAAGTAGTGGTGCATGGAG
TTGCTTTGATGAGTTTAATCGTATAGACCTTGAAGTGCTTTCTGTCGTTGCTCAATAAAT
ATTAACTATTCAACTAGCCAGAGGTAAAGGTGTTGATAAATTTGTTTTCGAAGACACTTT
GATTCCTTTGAAACCTACTTGTAATGTATTTATTACTATGAATCCTGGTTACGCAGGTCG
TTCTGAACTCCCAGACAACTTAAAGGCTCTTTTCAGAGCAGTAGCGATGATGGTTCCTGA
TTATGCCTTAATTGCTGAAATAGTACTTTATTCCTTTGGTTTTTCTGATGCAAGAAACTT
GGCAAGAAAGATCGTTACAACTTATAAATTATGTTCAGAGTAATTATCATCTTAAGATCA
CTACGATTATGGTATGAGAGCAGTCAAATCAGTCTTAACTGCAGCTGGTAACTTAAAAAG
AAAATATGTAAATGAAAACGAAAGTGTATTGATGCTTAGAGCTATTAGTGATGTCAACCT
AGCAAAATTCTTAGCTTTCGATCTTCCTCTTTTCAAAGGTATAACAAAAGATCTCTTCCC
TGGTGTTGAACTTCCAGAAATTGATTACTCAAATATGTTTGAGTGCATAGATGAATCTCT
GAGAGAAGAGAATTTGTAAAAGGTTCCATATTTTGTTGAAAAAATTATTTAATTATATGA
AATGATTCTTGTAAGACACGGTTTGATGGTTGTTGGACTTCCTTTTTCAGGTAATTAGCG
TTTTGAATTTATGTTTAAAATAAATTTCTACTTAAAAATAGGTAAAACATCTGCTATTAA
AATACTATAGAAGGCTTTAACAAAATTAAACGAAAGAAAATAAATGGATGAGAACAAGGT
ATAAATTACAGTTATTAATCCTAAGTCTATCCCAATGAAATTTTTGTATGGTTTTAATGA
TGAAATTTCTCATGAATGGACTGATGGTATTCTTGCAGTAAAATACAGAGCATTTGCTAA
AGCTGAGGATGATGATCGTAAATGGCTCATTTTTGATGGACCAGTTGATGCAGTTTGGAT
TGAAAATATGAATACAGTACTTGATGATAACAAAAAACTATGTTTAAATAGTGGTGAAAT
TATCGCAATGTCTAAATCTATGAATTTAATTTTTGAACCTATGGATTTGTAGGCTGCTTC
TCCTGCTACTGTAAACTTTAATTTATTTTTCAATAATTATATAAATTAAATGTCTGAACT
TTTTTCTTTTAATTTAAAAGGTATCTCGTTGTGGTATGATTTATATGGAACCATCAAGTA
TGGGATGGTAGCCACTCTATTAAAGTTGGAAGAAGCACTTACCTAAAACATTTAAATAAG
AGGACTTTGATGAGCTTGATTTACTGTTTGGATTTATGGTAGATGCAGGTTTGAATTGGA
TTAGACACAAAGGTGTAGAAGTTTCATCAACTTTAGATTAAAATCTAGTTCTTACTTTAA
TGAGATTACTAAAGAATTTACTAAAAGATTTTGAAGATGAAAAATTCTATAGTGGTTTTT
CAGACTCTAAAATAAAAATGCAAACTATTGACAATAAATTTATGTTTGCTTTTGTTTGGG
GTATAGGTGGTTCTCTGACTACTGAATATAGAAAATAGTTTGATGTCTTTGTAAAGAGAT
TAGCTAATGGAGATATTCCACTTGATAATGATAAAATACCGAGAAAGAAAATGTCACTTC
CTGAGCGTGCAAATCTTTATGAGTACTGCTTAGTTAATAAGGTATTAATTAATAATAAAT
CTAATTTTTCTTTTTAATTATTGAATTTTGAATTTAGGAATCAGTAGGAGGTGGTGGTAA
GAAATAAGTTGTAAGTGAATGGGTATTGTGGGTTGATGAAATAAAGAAAGAAGAAATATC
AAATAAAATTTAGCCTTAAGAAATATTAATTTAAACAACAGACACTTCTAGATATTCTTA
TATGATAAATGTAGCAATTCAAGATGAATTCCCTGTTCTTCTTTGCGGTCCTACTGGTAC
AGGAAAATCTACTTACATAAAGAATATTCTTAATAATCACTTAGATGCTGTTAAATATAT
AACAATTGAAATTGGTTTTAGTGCTTAGACATCTTGCACATAAACACAAGAAATTATTGA
TTCTAAGTTGGACAGAATTTCAAAAGGAGTTTATGGGCCAAGAAATAAGAGATTAGTAGT
TTTTATTGATGATTTAAATATGCCTGCTAAAGAGTAATGGGGAGCACAACCTCCTATTGA
AATTCTTAGATAAAAATTAGATTAAGGTGGTTGGTATGACAATAAAGATAAAGAGAAATA
GTTCAAATAAATCATAGATACGTAACTTATTAGTGCTATGGGTCCACCTGGAGGAGGCAG
AACTTTCATAACTCCTCGTATTTTAAGACATTTTAGTTTAATTAGTTTAGCTAATTTCGA
TGATGAAAACCTACACAGAATTTTTGGAACTATTTTAGAATGGTATTTGAAAAAGGGATA
ATTTGCTGTAGAAGTTTAGAAATTTGCTTCTAAAATAATAACTGGTAAGTTTATAAAAAA
CATAAATACTCGCAATTTTTTATGCAAACAAAAACAACTAATATTGATTTGTTCATTTTA
AAATATAGGTACTCTTGATATATATAAACAGGCTATTTCTGAATTACTCCCAACACCTGC
AAAATCACATTATTTGTTTAATTTAAGAGATTTCGCAAAGGTAATTTTTGGTATTTGTAT
GAGTGATAAAGATAAAGTACAAAATCCTGAACACATAACGAGGTTGTTTGTCCATGAAAT
ATGGAGAGTGTTTGGTGATCGTTTGATTAATGATGGTAATATATTTGTATAATCTAAACA
TCTTAATTATTAATTTTTTGTATTATTAGATGATAGATTATATCTTCTTGAAGAAATTAG
AAAAGTTGTTGCTAGATTCAGTATGAATTTTGATAATATATTTGCTCATTTAGATAAGCC
TGATTTAAAGAATAGAGGCTAAAAAGATGGTAAAGTTAATACTGTAGAAGAAATGAGAGG
TCTTATATGGACAGATGTTATGAATCCTATGGGTGCACAAAAAAGATATTATGAGGAAGT
ATTAGATTACGATAGATTATAAAATGCAGTTGAGTAGGGATTATCTAACTATAATATGAT
GACAGATAAGCCAATGGATTTAGTCTTATTTAATTTTGCTATTGAGCATCTTTTAATCAT
CTCACGTATCTTGAAAAGTCCTGGAGGAAATGCCTTATTAGTTGGTGTAGGTGGTTCAGG
TAGATAAAGTTTAACAAGGCTTGCTGCTTCAATTAGTGACTATAATGTTTGCTAAATAGA
AATCTCTAAGCAATACGGAAAAGTTGAATTCCATGAAGATCTTAAAGTAATTATGAGGAG
TGCAGGTTCACTTGGAAAACCTACTGTTTTCTTATTTACAGATTCTTAAATTAAGCAAGT
AAAAAAATTTATTTAAGTAATTTCAACAAAAAATTCATTCTTTTTTTTTTATACCAGGAA
TCATTCGTTGAAGATATTAATAGTTTACTTAATACCTTTGAAGTACCAAACTTGTTTGCT
CCTGATGAAAAAGCAGATGCCCTCGAAAAAATGAGAGTTGCCACAAAATAAGAAGGAAAA
TAAAAAGAAGGAACTCCAACATAAATGTATGCATACTTTATAGAAAGAGTAAAGAAAAAT
CTCCATATCGTACTTTGTTTCTCACCTATTGGTGATGCATTTAGAACTCGTGTTAGAATG
TTCCCTTCTCTAGTAAATTGTTGCACTATTGATTGGTTTTAAGAGTGGCCTTAAGATGCC
CTGTTGAGTGTTGCTAACAAATTTACTTAAAATATTCCTATGGATAAAAATATTAAAAAA
AGTTGCATAGAATTGCTCTAATATTTCCACTAATCAACAATCAACTGGTCAAAAACATTC
TTTTCTAAACTGAGAAGGTATTTACTTATTCAACAATAATAAATTTTATTAATTTTAAAT
GATACTTAATAAAAAGAAAATATTATGTTACTCCTACTTCATATATTGAAATGATCTAAA
GCTTTAATAGTCTCCTAGAAGAAAAAAGAAAAAAACTACAGGCTGACTAATTCAAGTATG
AAAATGGTTATGAGTAGATTATTTAAACTGAAAAAAATATTGGTAAAATGTAAGAAGATT
TAGAAGCTTTGCAGCCTTAGCTCAAGCAAGCAGCTATAGACACTGAAAAAAAAGAATTAG
AAGTTACTGAATAGGCTAAAGAAGCCGATAAATTAAAGAAAGTCATTTCAGAAGAAGAAG
CAGTAGTTTAAGTTGCTGTTAATGAAGCAAATGAAATTAAAGCAGAATGTGAAAAAGATT
TAAAAGAGGCTTTACCAGCTTTGTAAGCAGCAGAAGATGCCTTGAGAGTTTTAGATAGAA
AAGATATCGATCAGTTAAAGGCAATGAAAAATCCTCCCCTGCCTGTAAAAACAGTTATGT
AAGCTCTGTGCCTTATTTTATATCCTAATCCTTCAGAAAAAAAGAAAAACAATGAAACAT
TAAGAATCGAAATTGACTGGTGGGCTGCTTCTTTAAAGCTGCTAAACAACACTGGTTTAC
TTTAAACACTTGTGCAATTTGATAGAGATAATGTTGAAGAAGGAATTATAGTTAATCTTG
GAAAATTCTTGAAAGACCCAGCAAATGAAAGAAACCTCGATATAAGTGTAGTCTAAAATG
CTTCTACTGCTTGTAAGTGTATTATTATGTGGATCAATGGTATTTATAGCTATTATTTTG
TTTACAAGAAAGGTAAATAATTAGTTTAAGATTACAAGTATTTTATTAATTTACATTTTA
AATAAAATATAAAGTTAAACCAAAAAAAATTGCTTTGAGATAAGCTGAAGAAAAGGTAGG
TGGTTTAAATGCTACTCTTTCTAAAAAGTAAAAAGAACTAAAAGAAGCAAATGATAAAGT
TCAAAGACTTAATGATGAATTGACCTTTACTCAAAATAATAAAATAAGACTTTAGTAGAG
GTATCAGGAGTGCTAGTTACAATTAGAACGTGCTACCTAGCTAATTGAATCATTAGGTGG
TGAGAAGGGAAGATGGAAAGAATTAGGTAATTAAATAAAACATATAGATTATTAATTAAA
TAAAAATATTATAAAATATAGCTGAATAATTAAAATCTGAATATGATAAGCTTACTGGTG
ATGTTCTTATTTCATCAGGTGTAATAGCATATTTAGGAGCCTTCACTTCTGCATTCAGGT
AAGAAATTATTACTGAATGGACTAAGCTTTCAAAAGAGAGAAATATACCCTCAAGTGAAA
ATTTCAGCTTAAGCCATGTGCTAGGTGATCCTGTTAAGATAAGATCGTGGAATTTAGATG
GTTTACCAAGCGATAACTTCTCTATAGATAATGGTATAGTTATTTTTAAGGCAAGAAGAT
GGCCATTGTGTATTGATCCTTAAAATCAAGCAAACAAATGGATTAAGAAGATGGAACAAC
AAAAAGGCCTTTACATTATAAAACTAAGTGACAGTGATTACTTGAGAACCTTAGAAAATG
CTATATAATTTGGAAAACCTGTCTTACTTGAAAATGTAGGTGAGGATCTAGATCCTTCAC
TATCTCCTATCCTTCTAAAATAAACTTTTGTTAAAGGTAACTCTGTTTTCTTAAAACTTG
GTGATCAAACTCTTGAATATTCTAAGGATTTCCGCTTTTATATCACTACCAAATTGAGAA
ACCCTCATTATCTGCCTGAAATTTCAACTAAAGTTACTTTGATTAACTTCATGATTACTT
ATGAAGGTCTTAATGATTAATTACTTGGTATTTTGGTCAAGAAGGAGCGTCCTGACTTAG
AAGAGGAAAAAGAAAGACTTATTATTGAAGGTGCTTAAAATAAAGCTCAATTATTTGAAA
TTGAAGAAAAAATTTTATAGGTTCTTTCCAGTGATAAAAATATCCTAACAGATGAAGAAG
CTATTAAGGTTTTGACAGCTTCAAAAGAAAAATCCAACGAAATCAATGAAAAATAAGCAA
ATGCTGAAATTACTGAAAAAAGTATTGATGCTGCTCGTCAGGAGTATCAAGAAGTTTCTT
AAGAAGGTAAAAACTACATTAATTTATTAATTTTTTAATATTTAAATCTTTATTTTTTTT
AATTAAAGCCTCCCATTTGTTCTTTGCCATCTCAGATCTAGTGAGCATAGATCCTATGTA
TTAGTATTCTTTGGTTTACTATATTGACTTGTTCTCTCAATCAATTCTGAAGTCAGAAAA
ATCAGCTAATGTAGCTGTAAGACTTGACAATTTAAAAACATATTTCTTATATTCGCTATA
TTCAAACATTTGCCGTTCACTATTCGAAAAAGATAAATTGCTACTTTCATTCGTATTATG
CGAGCGTTTATTAGAATTTAAAGGCTAAATATTAAATGATCATTTTAGATTCTTGTTGAC
AGGAGGTCTAGCTGTAAGCGAAAAACTTCCTGATTTACCCATTGACTGCTAGTGGTTGTC
TAACAAAAGCTGGGGTGAAATAAATAGGTAAATTAATATTCTCAAAACCACTTAAAAAAT
TTTTAATATAATAAAAATATTAGATTGAGTGCTCTACCAAATTTTGAAGAATTTTACATG
ACATTCTATGACTACAGCAAATAATGGAAAGATATATATGACTCTCCTGAACCACATAAA
AAGCCATTACCTAAGGATATTGCTAGTAAGTTTGACTCATTCCATAGACTTCTTATACTA
AGAACTTTAAGACCAGATAAAATGATACCTGCTATTATGGATTTCATTACAGAGAGACTA
GGTAAAAAGTTTATAGAACCTCCTCCATTTGATCTAGCTGCCACTTATTTAGATTCAACA
TGCTTTACTCCACTTATTTTTATTTTATCTCCTGGTTCTGATCCTTTTGCATCTTTAAAT
AGTTTTTCAGAGCAAAAGAAGAAAAATATAACAGCTATTTCTTTAGGTTAAGGATAAGGT
AAATTTTAGATTTTTACTTATATTATTTAAATTAAAATTTAATTAAAGGGCCTGCTGCAC
AAAAAATGATCTAAGATGGTCAAAAGTCAGGTAATTGGGTTGTTCTGTAGAATTGTCACT
TAGCTGTCAGCTGGATGCCTACTTTAGAAAAAATTATTGAAGAATTCAACACAGGCAATA
CTGATCCTGATTTTAGATTATGGTTGACTTCTTATCCCTCTGAGAAATTCCCAACTGCTA
TACTTTAAGGTGGTGTTAAAATGACTACTGAAGCTCCTAAGGGTCTCAAATCTAATCTTT
TGGGTAGTTATTTAACGGATCCTATTTCAAGAGAAGATTTCTTTAACAGTTGCTAAAATT
CAAGAGCATTTAAAAATTTACTATTTGGGCTTTGCTTCTTCCATGCGGTAATTCAAGAAA
GAAGAAAATATGGTCCTCTTGGTTGGAATATTCCTTATGAATTCAATGAATCTGATTTAC
GTATCAGTGTGAGATAGCTATAAATGTTCTTATTAGAATGTCCAAGTAAATATAAATAAT
AAATTAAATTATTCTTTTATATAAAATTAATAAATTTTATTTATCATAGATAACAGTTCT
ATTCCTTTTGCAGCACTTAAGTATTTAACTTCTGAATGCAATTATGGTGGTAGAGTTACT
GATGATAAAGACAGAAGATTAATTACGACACTATTAGGTGATTATTACAATTTGAAAGTG
ATTGAAGATCCATTATATAAAGTAATTATTTATCTATTATTTTAATTGGCATTAAAAATC
AAATAAAATTAAAGTTTGCTCCCGATCCAAACTATAGAATTCCAGATAATGATTCTTATG
AAGGAGCCTTACAGTTTATAAAAGATCTTCCTATATATACAAAACCCGAAGTTTTTGGCT
TCCACTCTAATGCAGATATTACCAAAGATATAAATGAAACAACTCTATTCTTAGATTCTC
TTTTGTTATGCTCTAGTGAAGGAGGATCATCTGAAGGTAGTTCTCATGATGATACTTTGA
AGAAGCTGATAGAATCAATTATGGGTGATTTCCCAAAAGAATTTGATGTGGAATAAGCAA
TTATAAAATATCCTGTAAACTACAACGAATCCATGAACACAGTGCTTACTCAAGAATTAA
ATCGTTTCAATAAGCTAATTTCAATTATTCGTTCTTCACTTAAAGATATTAATTTAGCAT
TATAAGGTACTTGTTATTCATTTAAATATATTTACATAATTTTAATAATTTTTTAATTAG
GTAAAATTCTCTTAAGTCAAAGCTTAGAAAGGGCATGTAAATAAATTATTGATGGCAAAG
TACCTCAGCTCTGGATGGAAAAATCGTATCCATCCTTAAAACCATTAGGTGCTTATGTTA
ATGATTTGAGAATGAGATTAAAATTCTTTTAGGATTGGATAGATAATGGAGCACCAGTAA
ACTTTTGGATTTCTGGATTTTACTTCACTCAATCTTTCCTTACAGGTGTTCTTTAAAATT
TCGCAAGAAAGTATGTAATTCCTATCGATGAGATTGAGTTTGACTTTAAAGTAAATTTTA
ACTTAACTAGAATATGAATTTAATTCAGCTTACATATTTTTACATTAATATAGGTTATGC
ATAAGTCAGAAGAAGTTAAGCCAGAAGATGGTGCTTATGTATTTGGTCTTTTCATAGAAG
GTTCAAAGTGGAATCCTATACAAATGGAGTTGGATGAATCTGATCCAAAAGTAAATCATA
CATTTTTAATTATCATTATTAATTTTCTTATTAAATAGGTTTTATTTGTTTAATGTCCTA
CTCTCCTTCTTAAGCCATCCCAATCAAAAAAATTAAGCAATTTCCCTCATTATAACTCTC
CTGTATATAAAACATCAGCAAGAAGAGGAACTCTTTCTACAACGGGTCACTCAACAAATT
TCGTAATGTGGATTAGACTACCAAGCTCTAGACCTGAAAAGCATTGGATTAAGAGAGGTG
TAGCATTATTGACACAATTGGATGATTGA