Identifiers and Description

Gene Model Identifier

TTHERM_00046310

Standard Name

DYH1 (DYnein Heavy chain )

Aliases

PreTt11110 | 3.m01901 | 3824.m02871 | AF346733

Description

Dynein heavy chain family protein; Heavy chain subunit of non-axonemal dynein complex 1; molecular motor protein functioning in intracellular trafficking; required for phagocytosis and chromosome distribution

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00046310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_340920
WormBaseWBGene000009629.997093137033517e-262locus:dhc-1 Dynein heavy cha
in, cytoplasmic status:Parti
ally_confirmed UniProt:Q1902
0 protein_id:CCD64267.1
Tetrahymena borealisEI9_01820.19.997093137033517e-262dynein heavy chain family prot
ein (4549 aa)
DictyBaseDDB_G02763559.997093137033517e-262dhcA on chromosome: 2 position
6681538 to 6695830
OxytrichaContig20041.0.g289.997093137033517e-262Dynein heavy chain and region
D6 of dynein motor
SGDYKR054C9.997093137033517e-262DYN1 Cytoplasmic heavy chain d
ynein, microtubule motor prote
in, required for anaphase spin
dle elongation; involved in sp
indle assembly, chromosome mov
ement, and spindle orientation
during cell division, targete
d to microtubule tips by Pac1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18300275: Wilkes DE, Watson HE, Mitchell DR, Asai DJ (2008) Twenty-five dyneins in Tetrahymena: A re-examination of the multidynein hypothesis. Cell motility and the cytoskeleton 65(4):342-51
  2. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  3. Ref:15068262: Asai DJ, Wilkes DE (2004) The dynein heavy chain family. The Journal of eukaryotic microbiology 51(1):23-9
  4. Ref:12378538: Hennessey TM, Kim DY, Oberski DJ, Hard R, Rankin SA, Pennock DG (2002) Inner arm dynein 1 is essential for Ca++-dependent ciliary reversals in Tetrahymena thermophila. Cell motility and the cytoskeleton 53(4):281-8
  5. Ref:11499791: Angus SP, Edelmann RE, Pennock DG (2001) Targeted gene knockout of inner arm 1 in Tetrahymena thermophila. European journal of cell biology 80(7):486-97
  6. Ref:10069817: Lee S, Wisniewski JC, Dentler WL, Asai DJ (1999) Gene knockouts reveal separate functions for two cytoplasmic dyneins in Tetrahymena thermophila. Molecular biology of the cell 10(3):771-84

Sequences

>TTHERM_00046310(coding)
ATGGATTAGGACAAAACCTCAGCAAAAGAGGTTTCTTCTTCTGTCTAGATATCTCTTGAT
GAACTAGAGCCTCTTAATATGTACTTATCATCAGTATGTATTACACTTCTCAGCGTCAGC
TAAGACAGCTTCCACTAGATTATTCACTCAGAATAAAATTAACAAGTTATATCAAAATTC
GCATCATCATCTTCGTAAAAGATTTTAATAGTGTCAAAACTTAATCAAAATAAAAGTAAT
GGAAATGATGATAATGTAGCAATAGAGTTTTCAAATGAAATAGAATCCACCAAAATGACT
GCCCACTCTATAGCTTTTATCAAGCGTCACTAGTTTAGCATCTTTGAATAAGTTAGTGCC
TACTCAGGAGTAATTTAAGTTATTAATTTAGGTTACTACGCTCATGACTCTTCCCCAATT
TCTGTCAATCATCTTTATGTTTAAAACTGCTTCTTGCCAATATTCAATGCTTATCGCTAA
TAATTCGAAAATAAAGCTCCAAATAATAAGCAAGCATATTAATCACTACTCAAAAAGCTT
AGTGAATTTAATTTAGCATTAATCTAATGTTAGCAAAATGTTGAAGTACCTGAAATTCAG
CTTTTTTATGATCCTGTCTTAAAGGAAAGAGTACAAAAGCTCAAGGCAGAAGGAAAAAAT
GTTACAGTAGATGATTTTGAAGACCTCCTTGATAAAAATGAATTTATAGATAGCTTAGCT
AACTGTGTAACCAAATGGACTAAAGATATAAGAGCTATTATTAACATGGATTACGAGGTT
AGCAGTGGATCTACACTTCAAGAAATCAACTATTGGCTTAGTTATGAAAGAAGTTTAAAT
TTAATTGACTAGCAAATAAGTTAAATTGAAACAACTATTACTATTGAGTTATTGAAAAAG
AAATTTAAGCATAATGTCATAGTACCATTTGAATATGATTTAAAGTTCAAACACACACTC
TAAGAGTGCACAAAATGCAATTAGTTTATGAAAGAATTCCCACTTAACGACTTACTCTCT
GCAAGCAGCTTGTAAGAAATCAGAACTTCACTATCTGGAATCTTTAATCATATGAAAAAT
ATTAAGAGTCTTAGCTATACTCCTTAAAGAGCCTATTAGCTTCTTGAAGCCTTATCTCGT
GACTTGAACTCCTAAATAGTTAAAATTTTAAGCTAATATAAGTTAATGACTATGAATTAT
GATCATTTCACTTAACTTATTGCTGATAGTCAGGAGATATTTAAAAAGTGGGACAAAGAA
TTTAATGCTTTCAAGTAATCTTTGAAGGGACACACCTCAAACTGCTTCTTCTTACACGTT
GCTTTCATTCAAACCCGTCTTGAAATTATTATGGAAATTCGTAAATTGCACTAAACTTTG
AATGAAGTTATTTAGAACATTCTTAGTAAAGATCGCTCTTCAGATAAATTAGGTGATACT
AATTTCCTTTCCACTACCGAAATTAATGAAGCTTTCAGCATTTTCGATGATATTGATGTT
CTTAATTCTTCTGAAGAAGGAGAATAAGCTTTAAAGTTAGCTAAGAATAAATATGAGCAA
AGAATTGATTAGATTGAAATCCAAATCACTTTAAAACTTCGTGATAAACTTGGATAAGCA
AAGGAAAATCCCAACGAAATGTTTAGAATTTTCAGTAAATTCAACAAACTTTTTGTCCGT
CCTCATATTAGAGGTGCTATTGTTGAATATTAATCTGACTTGCTTGAAAAAGTATAAAAA
AAAATTAGTTAGTTGCGTGAGAAGTTTGTTAAGAAATATGTAAATACTGAAACCTCAGTT
CTCTGCAAGGTCAGAGATATTCCCAACATTGCTGGTAGTGTCATTTGGACAAACTAAATG
ATTAAAAAATTAAATAAATATATGGATTAAATGGCTGATGTCTTAGGTGAAAAGTGGGTT
GAGCATCCATTGGGATAAAAATGTAAAGAAACTTGCGAAGCCTTCAAGAACCACTTAAAT
CCTTAACAATTTGTAGACATGTGGTCTAATGAAATTTTAGATCTTAATCAAAAAAAGAGT
GAAAGTGAAAAAATATTTAAAATAGTTTAGAAGCGTAAACTTGAATTAGATGTAAATTAT
GATGAGCGTTAAGTTAATCTCTTTAAGGAAACTCGTATTTTGAGTTCTTAAAAGGTTCGT
TTCCTATCCTCCTTGTCATACACAGCTTAATAAGCTAAGAATATTTATCCTTTTGCAATG
TCTATTTAAGAATCTATTCGTTCATATAACTAAATTTCAAACCACGTTGATGATAAAATG
AAAAAGCTTGTTGCTTCTTTCCGTAGAGGTGTTCACAAATAAATTAGAAACGGTATGCAA
ATCAACTGGAATGGTGTTATCTATTTGAGCACATTTACTAAAAATTTAGCAGAATAAGTT
TAAAAATTTGAAGAAGCTGTTAACCTTTTGAAAGATTATAGTGAATAGATTGAATCTATT
TTAGCATTTTTGAAGACTTGCCATCCTTCCCATGAAACTTTCAAAGAAAAATTAGAAGAA
ATCCAAAAGTTGATTGATGATATTAACTTTTAAAAAGATTATTCTAACTTGCATATTTGG
GTACCTGAGGTCGATGCCAAGATAGAAGATATTCTTGTTGAGCGTTTGGTCTAAATTATA
AGGAAATTTGTTGTTGAATTCGAGACTTATCGTTTAATGGAAAAAAGAGAATTTATTGAG
CAACACACAAGACATGAGCTCAAGATGAAGGATTAAGTAATTAGTATTGAACCTTCTACT
GAATTTGCCCGTTACTATTGGTTCTAACAGTTCCACAAGGCTATTGGTATCATATGTTCT
CTTCCAAGACTAGAAGCCACTAGATATTCTACTTCAATTTCAAGTAAAACAGCAGAAAAT
ATTAAAAACTCTGATTATAGCTCTATATTGCTTAAGATTCCTAAGGACGTTTTGATTGGA
TCTTACAATAGAATAGATTAAATTCTTAGAGATAATGAAAGATACGTTAATACATGGTTG
AGCTATCAGTCTCTTTGGGCTATTGATTAGAAGAAAGTTTATGAACTCTTAGGAGATGAC
ATTAATAAGTGGTAACAACTTTTATCTGAAATAAAATAAGGAAGAAGTACATTCGATAAT
TCTGATACAGACATATTCTTCGGTCCTGTATAAATAGACTATCGTTTAGTTCAAGTTAAA
ATTAACAATAAATATGATTAATGGCATAGAGAAATTTTAGATCACTTTGGTCTAACATTT
GGCGATAAGCTAAGAGATTTCAACACTAAGATTTATAATGCACGTTTAAAATTAGAAAAG
ATTAGCTTTAACAATCCTTCTGTTGATGTAACTATTGCTATTACTGAAGTAAAGGAAATG
ATGGAAAAATATTCTGTATGGAACAATGATATTGAAATTTTCAGAACTGGTTAAAAGCTC
TTGGAAAGATAAAAATATTAATATCCAAATGATTGGCTCTGGTTAGATTAAGTTGAAGGT
GAGTGGTCAAATTTTAGACAACTAGTAAATAGAAAAAATTAATAACTTGAAAAGGAAATT
CCTACACTTCAAGAGAAAATCCTTTAAGATGAATAAATCTTAAATGAAAAAATTAGAGAT
GTTGAAGAAAGTTGGTCCTCTAAGAAACCTTCAAGTGGTGAGTAATCTCCAATTGAGGCC
TTAGATGTTTTGAATATAATTTCTGGCCAATTAGGAAGAGTAAAAGACAATTATTCAAAC
TGCTGCAAGGCAAAACTTCTTCTCAATCTCGAACCTGGTAATATGTAAAAATTAGAAGAT
CTTGAAGAAGATATTAACTCTCTCAAGGAAGTTTGGTAAGAATTAAACAAAGTCTGGTAG
AACATCGAAGCATTAAATGACACTCTTATCAATGCCATATAACCTAAAAAAATTAAGGAA
GCTATGGATAATGCTAATCGCCTTATGACAGAAGTTCCAAATAAAATTCGTACATACGAA
CCATATGAAAAAATGAGACAAAGATTGAAAGACTATGGAAAAATGAACCGTATTATTGAT
AATTTAAAAACAGAAGCTATGAAGCCTCGTCATTGGTCAAACATCCTCAAAAAAATGAAA
CTTAAACCTTCATTAAATGAATTAACTCTTGGTCATTTGTGGTCTAATGAATTAGTTTTG
AAGTATGAAAGAGCTATTGAAGATGTTTTAAGTGTGGCTTAAGGTGAATTTGTACTTGAG
TGCATGATGAAGAATGTTAAGGAATACTGGAATGAATTTGAATTAGATATGGTTAATTAT
TAAAATAAATGTAAACTTATTAAAGGCTGGGATGATCTTTTCGCTAAACTTGACGAAGAT
TTGGGAACTTTGGCCTCCACTAAAATGTCTCCTTATTACAAGCAATTTGAAGAAGAAATT
ACTCCTTGGGATGAAAAGCTTCAAAGAATAAGAATTTTGTTAGACAGCTGGATTGACGTG
CAAAGAAAATGGGTTTATTTAGAAGGTATCTTTTTCGGTGCTTCTGACATAAAGACTCAA
CTTTAAAATGAATATAATCGTTTTAAGGGTATTGACAGTGAATTTACTTCTCATATGAAG
AAAGTAGCCAAAAAGCCTCTTCTTTTAGATGTCATTTCCATTCCTGGATTACAAAAAACA
TTGGAAAGACTTGCTGATATGCTTGCTAAAATTTAAAAAGCTCTTGGTGAGTATCTTGAA
ACATAACGTTCAGCATTTGCTCGTTTCTATTTCATTGGTGACGAAGATCTTTTGGAAATT
ATCGGTAACAGTAAAGATGTTACTAATGTTCAACGTCACTTCCCTAAAATGTATGCTGGT
ATAACTACTCTTACTAGTGAAAAGAATGAAAAGAATGATGACATAGTCAAGGGAATGAAT
TCTAAAGAAGGTGAATCCGTAGCTTTTGACACTGATATCAATGTAGGTGAAGATCCTAAG
ATTAATGTCTGGTTAGGAAAGGTAGATGACTAAATGAGACTATCTCTTGCTTCTAATTTA
TAAAAATCAATGCAAAAAATAGCAGCTATCGAGCAAGGAGATGACCAATCTTTATTAGAA
ATTATTGCATAATAACCTGCTTAATCAGGATTACTCTCATTACAAGTATTCTGGTGCAGC
AGAGTAGAAAAAGCTTTCGAAACAAAAGAATTAGAAAGTGTAGTATAATATATTATCCGC
TTTTTGGAAGTATTAGCCACTAATGTAGTTAAGGATTTGAAAAAAGATTTACGTCAAAAA
TATGAGCAAATTATCACTGATTTTGTTCATCAGAGAGATGTAACTAGACAGTTGATTATA
AAGAACGTTGATAATCACAAAGACTTTGCTTGGTAATACCATATGCGTTTCACTTGGTTC
ACTAAAGAGCAAGACCCATTGAAGAAACTCTTGATAAATATGGCTAACGCTTCATTCCAT
TATGGTTTTGAATATCTTGGTGTAGGAGAAAAGCTTGTTCAAACTCCATTGACTGATAAA
TGTTATTTAACATTAACTTAAGCTTTACACTTAAGAATGGGTGGTTCACCTTTTGGACCT
GCAGGTACAGGTAAAACTGAATCAGTTAAAGCTCTTGGTTCTTAATTAGGTAGATTTGTT
CTCGTTTTTAACTGTGATGAAACATTCGATTTCCATGCTATGGGACGTATCTTTGTTGGT
TTGTGTTAGGTAGGTGCTTGGGGTTGCTTTGATGAATTCAATAGATTAGAAGAAAGAATG
CTTTCTGCATGCTCACAACAAATTCTTATTATTCAGAGTGGTTTGAGAGAAAGAGCAACT
AAAATTGAATTGATGAATAGAGACGTTAAGCTTAATCCTAAGATGGGTGTTTTCGTTACT
ATGAATCCTGGCTATGCTGGTCGTTCAAATCTCCCTGAAAACTTGAAATAACTTTTCAGA
CAAATGGCCATGGTTAAACCTGATAGAGATTTAATTGCTTAAGTTATGCTTTATTCTTAA
GGTTTTAGAACTGCTGAAAAGCTCTCTGGTAAAATTGTTTCACTCTTCGAATTATGTAAT
GACTAATTGTCCTCTCAACCTCACTACGATTTTGGTCTTCGTGCCTTAAAATCTGTCTTA
GTTAGCGCTGGTAATATGAAGAGAGTTGAAATAAGCAAAGTAGAAAACTTATCTAATTTC
ACAGATGCTTAAATTCAAGAATTTGAACAAAAGATTTTGCTTAGAAGTGTATGTGAAACT
ATTGTTCCTAAGCTAGTGTCTGATGATGTCCCTCTTCTTTCTAACTTATTATCTGGTGTC
TTCCCAGGAAGCTCCATTCCCGAAATCAAGGAAGATGAGTTGCGCAAAGAAATTGAAAAA
GTTTGTGCTAAGAGAAATTTACTTCCCACAGACTTGTTTATGCAAAAAATATTACAACTT
TACCAAATTTAAAGATTACATCACGGTGTTATGATGGTCGGACCTTCTGGTTGTGGTAAA
AGTGTTGCTTGGAGAGTCCTCCTTGAAGCTATGTACAGAGTAGAAAAGATTAAAGGAGAA
TCTTATATTGTAGACCCTAAGGCCATTCATAAGGATGAATTATATGGCAAGCTTGATAAT
ACAACTCTTGAATGGACTGATGGTGTTTTCACTGGTATTCTAAGAAAGATTACTGAAAAC
GTTCGTGGTGAATCCTCTAAGAGACATTGGATTATTTTTGATGGTGATGTTGATCCAGAA
TGGGCTGAAAATTTAAATTCCGTTTTAGATGATAATAAGTTGCTCACTTTACCTAATGGT
GAAAGAATTAGCATTCCTCCTAATGTAAGAATTATGTTTGAAGTCGAAACTTTGAAATAC
GCTACACTTGCTACCGTTTCTAGATGCGGTATGGTTTGGTTCTCTGATGAAATCGTATCA
TACAATATGATTTTCTATAACTATGTAAACAGACTAAAGTAAGAAAACTATGATGAAATT
CCTAAAGAAGAAGATGATGAAAAAGAAAAAAGGAAGGAAACTCCTGAAGCCATTACACGT
AAATAGTGTGTAGAAGCTATTCAAAATCTTTTCTTAGAAGGAGAACCTAGCTTTGGTGAA
TAAATTGTAGAAATAGCTTTGTCTTATCCTCATGTTATGGAATTCACTCGTATTCGTGTG
CTTGAAGCATCATTTGCCTTAATAAGAAAGGGTATTTCAAATGTTCTCGAATATAATGAA
TCTCACCCTGATTATAATCTCGACCCCGAAGTACTCAAGAAATATATGCAAAAGTGGACT
CTTTTCTCTTTAATGTGGGGTATTGCAGGTTCAATGACTCTTTATTAAAGACAAAAATTC
GGTGAAAATATAGCTAAATTCAGTCCTGTTGATCTACCTCCTGTTGGAGCTGGATAAGAA
AGTATTATTGACTTTGAAGTAAGAATTGAAGATGGTGAGTGGTACGCTTGGAAGAAGAAA
GTTCCTCAAGTAGAAGTTGATCCTATGAAAGTAACTGATGCTGATTTAATTATTACAACT
GTTGATACATTAAGACACTAGGAAGTTTTGTGCTCCTGGTTGAGTGAACATAGACCTTTC
TTGCTTTGTGGTCCTCCTGGTTCTGGTAAAACTATGACTTTAATGAGCACTTTGAAAGCA
TTGACAGACTTTGAAATGATTTTCGTTAACTTCTCTAGCTCTACAACTCCTTCTCTCATT
CTTAAGCAATTCGATCACTATTGCGAATATGTAAAAACAACTTAGGGTTTGATTTTACGT
CCTAAATAACCAAATAAATGGTTAGTTGTATTTTGTGATGAAATCAATTTGCCAGATATG
GATAAATATGGTACAATGACTATTATTACTTTCTTAAGAGAATTGACTGAACAAAAGGGT
TTCTGGAGACCAACTGATAAATAATGGATTAGCTTAGAGCGTATTCAATTTGTAGGTGCA
TGTAATCCTCCTACAGATACTGGAAGAAAACCTCTTTCTGCTAGATTCCTTCGTCATACT
CCTTTAATTTTAGTTGATTTCCCTGGTCCTGAATCTCTCAAATAAATTTATGGTACCTTT
AATCGTGCTATGCTCAAAAAGGTTCCTCATCTTCGTAATTTAGCTGAGCCATTAACTAAT
GCTATGGTTGAATTCTATACTCGCTCTCAACTTCACTTTACTGCTGATATTTAACCTCAC
TATATATACTCTCCTCGTGAACTCACTCGTTGGAAATATGCAATCAACGAAGCATTAGAA
CCATTAGAAAGTCCCGAAGATCTTGTAAGACTATGGACTCATGAAGCTATGAGACTGTTC
TAAGACAGACTTGTTAAGGATGATGAAAAAGAGTGGTGTGAAAAGTTAGTAGACGAAGTT
GCTCAAAATAATTTCCCTTCTGTCAAGCAAACTGCATTAGAAAGACCAATCCTATTCTCA
AATTACATAAATAAAGATTATCGTTCAGTTGAAAGAGAAGAATTAAGAAAATACGTTGTT
GCTCGTTTGAAAATATTTAATGAAGAGTAATTGGATGTCCCAATTGTTGTATTTGATTCT
GTCCTTGATCATATTTTACGTATTGATAGAGTACTCAGACAGCCTTTGGGTCATCTTTTA
CTTGTAGGTGCCTCTGGTGTCGGTAAGACTACTCTCACTAGATTTGTTTCTTGGATGAAT
AATTTGGTTGTCTATCAAATCAAAGCAGGAAGAAAATACAATGTCCACGATTTTGATAAT
GATCTTAGAGATGTTATGAAACGCGCTGGTGTTAAATAAGAAAAAATCTGCTTTATCTTT
GATGAAAGTAATGTCTTAGGACCTGCATTCTTAGAAAAAATGAACGCCTTGCTCGCCTCT
GGTGAAATTCCAGGTCTCTTTGAAGGTGAAGAATATATGGCTCTTATGAGTTAATGCAGA
GAAGCTTAAATGAAAGAAAATAAAATGATGGATACTGATGATTAAGTTTACAGAAACTTC
ATAAAGAATGTCCAAAGAAATTTGCACGTAGTTTTTACTATGAATCCTGCTAATCCTGAC
TTCTCCAATAGAACTGCAAGCTCTCCAGCTCTTTTCAATAGATGTGTTATTGATTGGTTT
GGTGACTGGTCTTAAGAAGCATTGTGGTAAGTTGGTAAAGAATTCACTTAACACGTAAAT
TCAGATGAAGCTTCATTCACTAAGAGCTCTGTTGCTGAAAATGTTGAAACTAGATAATTA
TAGCTTGTCAACACTATAGTCCACATCCATAATACTGTTGTTAGTCTTAACAGAAACCTC
GCTAAGAGTGCTAAGAAATATAATTATATAACACCAAGAGATTATTTAGATTTCATTAAA
CACTTTATGGAATTACTCCACTCTAAGAGATCTTCTCTTGAAGACTAGCAATTGCACTTA
AATAAGGGTCTTGAAAAGCTTAAAGACACAGAAGAACAAGTAGCAACCATGGAATCCACA
CTTAAGAAAAAGAAAACTGAATTAGAATAAAAGGAAAAAGAAGCTAATGAGAAATTAAAA
TTGATGGTTTCAGAATAAAATAAAGCTGAATAAAGTAAAGATGAATCAATAAAGCTCACT
GAATAAGTAGATAAATAAAAGGCAATTATTAATGAAAGAGAATAAATTGCTCGCCAAGAA
TTAGCTGAAGCTGAACCTGCTCTTATCAAAGCTAAAGAAAGTGTTAATTCTATAAATAGA
GCTCAGCTTGATTAAATCAGATCTTATGCTGCTCCTCCTAAATTGGTATAAATTACAATG
GAAGCAGTCATCTTTGTTATTACAAACACTTATACAGCTAATCCTGCTTGGGCTGATATC
AAAAAGTAGATTGCAAATAAAGATTTTATCAAAAATGTTCTTGATTTCTCAACTGATAAC
CTCCAACCTGCAATTAAGAATAAATTAATTTAGAATTATTTAAAGAAAGAAGAATGGAAT
GTTGAAAGAATTTACAACTCTTCTTAAGCAGCTGGTCCTCTTGCTCTTTGGGTAGAATCA
TAAATCAGATATGCTGATATTCTATTAAAGGTAGATCCTCTTAAGAAAGAAGTAGATGAT
CTTAAGAAACAAGGTAGCATTTTAGAAGATAAAAAGAAACAACTTGATTAATAAGTCGAA
CTATTACAAGAAAAGATTTCTCAACTTAAGAGTGATTATGCTATTTTGATTGCTGATAAA
GAAAATATAAAGAATGAAATGATTAAGGTAAAAGAAAAGGTCGAACGTTCTCAATAACTT
TTATAAAATTTATCATCAGAAAGATTCCGTTGGGATGCCTCATCTCAAAACTTCAAGCAA
TAAATGGCCACAATCATTGGTGATGTCCTTTTATCTGGTGCATTCTGTAGTTATATTGGT
TTCTTCGATCATTTCTACCGTCGTGTTTTAATGAAATCATTCCGCGATTATCTTGAAAAT
TCTGCTTACATCCGTTTCCGCAAGGACCTTAGCTTAATTGAATTCTTGTCAAAACCTTCA
GATCGTCTCAATTGGTAATCTCATCGTCTTCCTAATGATGATTTGTGTACTGAAAATGCC
ATTATCCTCTCTCGTTTCCATAGATATCCTCTCATCATTGATCCTGCTGGATAGGCATAA
GAATTTGTACTCTCTTTCTATAAAGATAAAAAAATAGCTAGAACTTCATTTGCTGATGAT
GCATTTATGAAGACCCTAGAAACCTCTCTTTGTTTTGGTTGCCCTCTATTAGTTCAAGAT
GTAGAACGTATTGATCCCATCCTCAATTCAGTTCTGAATAAAGAAGTTTACAAGGCTGGT
GGTCGTGTTTTAATTCGTGTTGGTGATTAAGAAATTGATTTCTCATCTTCATTCTAAATG
TTTATGATTACACGTGATTCTAATGCTCGTTTCACTCCTGATCTTTGCTCTCGTGTTACT
TTTGTAAACTTTACTGTCACACCAAGTTCTTTGCAAAATCAATGTTTAAACATTTATCTT
AAGAGTGAAACTCCTGAAACAGAAGAAAAGCGTATTAAACTTATGAAATTATAGGGTGAA
TATATTGTCCGTCTTCGTGAGCTTGAAGATTCTTTGCTTGATTCTCTTTCTAATGTAACT
GGTTCTATTTTAGATAATGAATCAGTTATAGGTACTTTGGAAAAACTTAAGAGTGAAGCT
ACTAACGTATAACGTGAAATGGAACAAAGTGATAAGGTTATGTAAGAAGTTTAAAAAGTA
ACTTCTGACTATATTCCATTAGCAGAAGCCTGCTCAAAAGTATTCTTTGCTCTTGTTTCA
ATGAAATAATTACATTATCTTTATGATTTCTCATTAAACTTCTTTATGGAAATTTTCAAT
GAGTTACTTCATAAAAATGAAATACTTGCTGCAACTGCTAAGACTGATTTACCTGCTCGT
CGTAGAGTCATTTATGATGAGCTCTTTATCAGAGTATTCTAAAAAGTAACAAACTCACTT
CTTGACTAGGATCGTATTATTTTTGCTTTACGTCTTACATAAATAAAGCTTGGTAAGACA
TACGAAAATGCTTTTATGAATCTTGCTAAAGCTCCTAAATTAATTGAAACAACCTTATCT
GAATAACTTCTTGAATCAAAGCTTACAAAATAATAGCTCAAGCTACTTGAAGATATTTCT
ACTAATACTACTGAATTTTCAGCTCTTTTACCTGATGTAAATCGCAACGAAAGCTCTTGG
GTTGATTTCATCCTTTCTGAAACTCCAGAGGATTAAGTTCCTTCTGATTGGGCTCCTCAA
CAAAATCCAAGTATGTCTGAATTTGATTTAACAGTAAATAATCTTCTTCGTGATTTAACA
GTTATTAAAATTTTCCGTCCAGATAGATTCCTTGTTGTTGCTAAGAGACTTGTGTCAAAG
GTTATGGGAAGCAAATTCCTTGAAGATATTTAAATTGATATGAAATAGGTAGTAGAAAAA
GATTCAAATTGCAAATCTCCTATTCTCATGTGCAGTGCTCCAGGTTTTGATCCATCTTAC
AAGGTTGATGCCCTTGCTAAAGAAATGGGTGTTAGACATATATCAGTAGCTATAGGTTCC
TAAGAAGGATTTGATCTAGCTGATAAAGCAATTCAATAAGCTGCTAAATCTGGTATTTGG
GTTTTACTTAAGAACGTTCACTTGGCACCTTCTTGGCTTTCTGAAGTAGAGAAGAGTATT
CATAGATTAACTCCTCACAATAACTTTAGATTATTCTTAACCATGGAATTCAATCCTAAG
GTACCTTCAACTCTTATTCGTTAATCTTACAAACTTGTATTTGAACCTCCTAGCGGTATT
AAAGCTTCTTTACAACGTTCATTTGCTTCTCTTCTCACTCCTGCTCGTACTGATCGTCTA
CCAAGAGAAAGATCAAGATTACATTTCCTTCTTGCCTGGTTGCATGCTATTTTATTAGAG
AGACTTAGATACACACCTATTGGTTATACTAAGGTTTATGAATTTAATGAAGCAGATCAA
AGATGCTCACTTGACTTAATTGATGAATTCGTAGATTCTCTAGGTGACCGCTCAAATATA
GATCCTGATAAACTTCCTTGGGAAGCTATCAGAACTATTTTATGCTAGAATTTATATGGT
GGTAAAATTGACAATGAATATGATGGTAAGATCCTTGAATCATTAGTTGAGCACTTATTC
AATCCTAACGCTTTTAACGCAAATTATGACATGTTCTCTACATCAGAAAAAAATATTTAA
CTCATCAAGATGCCAGAAGCAATTCGTCAATCTTAATATGTTGAGTGGATAGAAAAATTG
CCAAATGTAGAATCTCCTGCTTGGAGTGGTTTACCTGTAAATGCAGAAAAAATCCTTAAA
GAATAAAATACAGAACGTGCATTAAATTTATTATGGACTTTGTAGGATGTAAATGATGAA
GAAATCGAAGAAATAGATATGGGAGTTAAGCCAAAGACTGGAGGCTAAGGTTAGTAATCC
CAACAAGTATAATGGTTGCGTACTGTTTAAGAGAGATCTGAATCATTCCTCAAGGTTCTT
CCTCAACAAATTGAAAAGTTAAATCGTACTGCTACTTCAATGAATGATCCTCTCTTCCGT
TTCTTGGAAAGAGAAATTACTGTAGGTACTAAGCTACTCAATGAAATTAAGTCTAACCTA
AAGGATGTTATTTAAATGGCTGCTGGTAATATTGCTGGTACTAATGTAACAAAATAACTT
GCTAAGGATGTCTATTCTGACGTAGTTCCTAAGGCATGGGTTAAATTTAATAGTTATTGC
ACAAGTCTCAATGAATGGATTTTTGATTTCAAGCAACGTATTGATTAATTCAATAAGCTT
GCAATCATACCAAATTACCAAAAATCAGGTGTTTGGATTGGACAATTATTATATCCTGAA
GCTTATATGACTGCCACTAGATAGTTTGTAGCTTAAAATAATGCTTGGTCATTAGAAGAA
CTGGAACTCTAAGCTTCAGTTTATAGTGAAGGTGACTAACTAGGAGATGATTGCTTCTTA
GTTAAAGGTATGTCTATTGAAGGAGCTGACTGGAAAGGAACTCAACTTTTACTTAGTAAC
GAAATAAGAATTATGTTACCTCCTATTATCTTCAAGTGGGCAAGATCATCAACAAAGGGA
GTTCAAGATGGACAAATTATGGTTCCTGTCTATCTCAATAAAGCAAGAAAAAATCTAATT
TTCAGTTTAAAGATGAATTGTGGTCACATTCCTCGTGCTCAACTCTACTAGAAAGCAATT
ACATTGATTGCTTGGAATAATTCTTGA


>TTHERM_00046310(protein)
MDQDKTSAKEVSSSVQISLDELEPLNMYLSSVCITLLSVSQDSFHQIIHSEQNQQVISKF
ASSSSQKILIVSKLNQNKSNGNDDNVAIEFSNEIESTKMTAHSIAFIKRHQFSIFEQVSA
YSGVIQVINLGYYAHDSSPISVNHLYVQNCFLPIFNAYRQQFENKAPNNKQAYQSLLKKL
SEFNLALIQCQQNVEVPEIQLFYDPVLKERVQKLKAEGKNVTVDDFEDLLDKNEFIDSLA
NCVTKWTKDIRAIINMDYEVSSGSTLQEINYWLSYERSLNLIDQQISQIETTITIELLKK
KFKHNVIVPFEYDLKFKHTLQECTKCNQFMKEFPLNDLLSASSLQEIRTSLSGIFNHMKN
IKSLSYTPQRAYQLLEALSRDLNSQIVKILSQYKLMTMNYDHFTQLIADSQEIFKKWDKE
FNAFKQSLKGHTSNCFFLHVAFIQTRLEIIMEIRKLHQTLNEVIQNILSKDRSSDKLGDT
NFLSTTEINEAFSIFDDIDVLNSSEEGEQALKLAKNKYEQRIDQIEIQITLKLRDKLGQA
KENPNEMFRIFSKFNKLFVRPHIRGAIVEYQSDLLEKVQKKISQLREKFVKKYVNTETSV
LCKVRDIPNIAGSVIWTNQMIKKLNKYMDQMADVLGEKWVEHPLGQKCKETCEAFKNHLN
PQQFVDMWSNEILDLNQKKSESEKIFKIVQKRKLELDVNYDERQVNLFKETRILSSQKVR
FLSSLSYTAQQAKNIYPFAMSIQESIRSYNQISNHVDDKMKKLVASFRRGVHKQIRNGMQ
INWNGVIYLSTFTKNLAEQVQKFEEAVNLLKDYSEQIESILAFLKTCHPSHETFKEKLEE
IQKLIDDINFQKDYSNLHIWVPEVDAKIEDILVERLVQIIRKFVVEFETYRLMEKREFIE
QHTRHELKMKDQVISIEPSTEFARYYWFQQFHKAIGIICSLPRLEATRYSTSISSKTAEN
IKNSDYSSILLKIPKDVLIGSYNRIDQILRDNERYVNTWLSYQSLWAIDQKKVYELLGDD
INKWQQLLSEIKQGRSTFDNSDTDIFFGPVQIDYRLVQVKINNKYDQWHREILDHFGLTF
GDKLRDFNTKIYNARLKLEKISFNNPSVDVTIAITEVKEMMEKYSVWNNDIEIFRTGQKL
LERQKYQYPNDWLWLDQVEGEWSNFRQLVNRKNQQLEKEIPTLQEKILQDEQILNEKIRD
VEESWSSKKPSSGEQSPIEALDVLNIISGQLGRVKDNYSNCCKAKLLLNLEPGNMQKLED
LEEDINSLKEVWQELNKVWQNIEALNDTLINAIQPKKIKEAMDNANRLMTEVPNKIRTYE
PYEKMRQRLKDYGKMNRIIDNLKTEAMKPRHWSNILKKMKLKPSLNELTLGHLWSNELVL
KYERAIEDVLSVAQGEFVLECMMKNVKEYWNEFELDMVNYQNKCKLIKGWDDLFAKLDED
LGTLASTKMSPYYKQFEEEITPWDEKLQRIRILLDSWIDVQRKWVYLEGIFFGASDIKTQ
LQNEYNRFKGIDSEFTSHMKKVAKKPLLLDVISIPGLQKTLERLADMLAKIQKALGEYLE
TQRSAFARFYFIGDEDLLEIIGNSKDVTNVQRHFPKMYAGITTLTSEKNEKNDDIVKGMN
SKEGESVAFDTDINVGEDPKINVWLGKVDDQMRLSLASNLQKSMQKIAAIEQGDDQSLLE
IIAQQPAQSGLLSLQVFWCSRVEKAFETKELESVVQYIIRFLEVLATNVVKDLKKDLRQK
YEQIITDFVHQRDVTRQLIIKNVDNHKDFAWQYHMRFTWFTKEQDPLKKLLINMANASFH
YGFEYLGVGEKLVQTPLTDKCYLTLTQALHLRMGGSPFGPAGTGKTESVKALGSQLGRFV
LVFNCDETFDFHAMGRIFVGLCQVGAWGCFDEFNRLEERMLSACSQQILIIQSGLRERAT
KIELMNRDVKLNPKMGVFVTMNPGYAGRSNLPENLKQLFRQMAMVKPDRDLIAQVMLYSQ
GFRTAEKLSGKIVSLFELCNDQLSSQPHYDFGLRALKSVLVSAGNMKRVEISKVENLSNF
TDAQIQEFEQKILLRSVCETIVPKLVSDDVPLLSNLLSGVFPGSSIPEIKEDELRKEIEK
VCAKRNLLPTDLFMQKILQLYQIQRLHHGVMMVGPSGCGKSVAWRVLLEAMYRVEKIKGE
SYIVDPKAIHKDELYGKLDNTTLEWTDGVFTGILRKITENVRGESSKRHWIIFDGDVDPE
WAENLNSVLDDNKLLTLPNGERISIPPNVRIMFEVETLKYATLATVSRCGMVWFSDEIVS
YNMIFYNYVNRLKQENYDEIPKEEDDEKEKRKETPEAITRKQCVEAIQNLFLEGEPSFGE
QIVEIALSYPHVMEFTRIRVLEASFALIRKGISNVLEYNESHPDYNLDPEVLKKYMQKWT
LFSLMWGIAGSMTLYQRQKFGENIAKFSPVDLPPVGAGQESIIDFEVRIEDGEWYAWKKK
VPQVEVDPMKVTDADLIITTVDTLRHQEVLCSWLSEHRPFLLCGPPGSGKTMTLMSTLKA
LTDFEMIFVNFSSSTTPSLILKQFDHYCEYVKTTQGLILRPKQPNKWLVVFCDEINLPDM
DKYGTMTIITFLRELTEQKGFWRPTDKQWISLERIQFVGACNPPTDTGRKPLSARFLRHT
PLILVDFPGPESLKQIYGTFNRAMLKKVPHLRNLAEPLTNAMVEFYTRSQLHFTADIQPH
YIYSPRELTRWKYAINEALEPLESPEDLVRLWTHEAMRLFQDRLVKDDEKEWCEKLVDEV
AQNNFPSVKQTALERPILFSNYINKDYRSVEREELRKYVVARLKIFNEEQLDVPIVVFDS
VLDHILRIDRVLRQPLGHLLLVGASGVGKTTLTRFVSWMNNLVVYQIKAGRKYNVHDFDN
DLRDVMKRAGVKQEKICFIFDESNVLGPAFLEKMNALLASGEIPGLFEGEEYMALMSQCR
EAQMKENKMMDTDDQVYRNFIKNVQRNLHVVFTMNPANPDFSNRTASSPALFNRCVIDWF
GDWSQEALWQVGKEFTQHVNSDEASFTKSSVAENVETRQLQLVNTIVHIHNTVVSLNRNL
AKSAKKYNYITPRDYLDFIKHFMELLHSKRSSLEDQQLHLNKGLEKLKDTEEQVATMEST
LKKKKTELEQKEKEANEKLKLMVSEQNKAEQSKDESIKLTEQVDKQKAIINEREQIARQE
LAEAEPALIKAKESVNSINRAQLDQIRSYAAPPKLVQITMEAVIFVITNTYTANPAWADI
KKQIANKDFIKNVLDFSTDNLQPAIKNKLIQNYLKKEEWNVERIYNSSQAAGPLALWVES
QIRYADILLKVDPLKKEVDDLKKQGSILEDKKKQLDQQVELLQEKISQLKSDYAILIADK
ENIKNEMIKVKEKVERSQQLLQNLSSERFRWDASSQNFKQQMATIIGDVLLSGAFCSYIG
FFDHFYRRVLMKSFRDYLENSAYIRFRKDLSLIEFLSKPSDRLNWQSHRLPNDDLCTENA
IILSRFHRYPLIIDPAGQAQEFVLSFYKDKKIARTSFADDAFMKTLETSLCFGCPLLVQD
VERIDPILNSVLNKEVYKAGGRVLIRVGDQEIDFSSSFQMFMITRDSNARFTPDLCSRVT
FVNFTVTPSSLQNQCLNIYLKSETPETEEKRIKLMKLQGEYIVRLRELEDSLLDSLSNVT
GSILDNESVIGTLEKLKSEATNVQREMEQSDKVMQEVQKVTSDYIPLAEACSKVFFALVS
MKQLHYLYDFSLNFFMEIFNELLHKNEILAATAKTDLPARRRVIYDELFIRVFQKVTNSL
LDQDRIIFALRLTQIKLGKTYENAFMNLAKAPKLIETTLSEQLLESKLTKQQLKLLEDIS
TNTTEFSALLPDVNRNESSWVDFILSETPEDQVPSDWAPQQNPSMSEFDLTVNNLLRDLT
VIKIFRPDRFLVVAKRLVSKVMGSKFLEDIQIDMKQVVEKDSNCKSPILMCSAPGFDPSY
KVDALAKEMGVRHISVAIGSQEGFDLADKAIQQAAKSGIWVLLKNVHLAPSWLSEVEKSI
HRLTPHNNFRLFLTMEFNPKVPSTLIRQSYKLVFEPPSGIKASLQRSFASLLTPARTDRL
PRERSRLHFLLAWLHAILLERLRYTPIGYTKVYEFNEADQRCSLDLIDEFVDSLGDRSNI
DPDKLPWEAIRTILCQNLYGGKIDNEYDGKILESLVEHLFNPNAFNANYDMFSTSEKNIQ
LIKMPEAIRQSQYVEWIEKLPNVESPAWSGLPVNAEKILKEQNTERALNLLWTLQDVNDE
EIEEIDMGVKPKTGGQGQQSQQVQWLRTVQERSESFLKVLPQQIEKLNRTATSMNDPLFR
FLEREITVGTKLLNEIKSNLKDVIQMAAGNIAGTNVTKQLAKDVYSDVVPKAWVKFNSYC
TSLNEWIFDFKQRIDQFNKLAIIPNYQKSGVWIGQLLYPEAYMTATRQFVAQNNAWSLEE
LELQASVYSEGDQLGDDCFLVKGMSIEGADWKGTQLLLSNEIRIMLPPIIFKWARSSTKG
VQDGQIMVPVYLNKARKNLIFSLKMNCGHIPRAQLYQKAITLIAWNNS


>TTHERM_00046310(gene)
ATGGATTAGGACAAAACCTCAGCAAAAGAGGTTTCTTCTTCTGTCTAGATATCTCTTGAT
GAACTAGAGCCTCTTAATATGTACTTATCATCAGTATGTATTACACTTCTCAGCGTCAGC
TAAGACAGCTTCCACTAGATTATTCACTCAGAATAAAATTAACAAGTTATATCAAAATTC
GCATCATCATCTTCGTAAAAGATTTTAATAGTGTCAAAACTTAATCAAAATAAAAGTAAT
GGAAATGATGATAATGTAGCAATAGAGTTTTCAAATGAAATAGAATCCACCAAAATGACT
GCCCACTCTATAGCTTTTATCAAGCGTCACTAGTTTAGCATCTTTGAATAAGTTAGTGCC
TACTCAGGAGTAATTTAAGTTATTAATTTAGGTTACTACGCTCATGACTCTTCCCCAATT
TCTGTCAATCATCTTTATGTTTAAAACTGCTTCTTGCCAATATTCAATGCTTATCGCTAA
TAATTCGAAAATAAAGCTCCAAATAATAAGCAAGCATATTAATCACTACTCAAAAAGCTT
AGTGAATTTAATTTAGCATTAATCTAATGTTAGCAAAATGTTGAAGTACCTGAAATTCAG
CTTTTTTATGATCCTGTCTTAAAGGAAAGAGTACAAAAGCTCAAGGCAGAAGGAAAAAAT
GTTACAGTAGATGATTTTGAAGACCTCCTTGATAAAAATGAATTTATAGATAGCTTAGCT
AACTGTGTAACCAAATGGACTAAAGATATAAGAGCTATTATTAACATGGATTACGAGGTA
AAAATATTTAAATTTTTAATCATAAAAGTTTAAAAGGATCTGTGAATTTTATTAATAATA
ATTTTTCGCTCAATTTTATTACTGTTGTTAACAGTAATTAAAAATAGCTTTTTCTATTGA
ATTTGAAAATGATAAATAAATTTATGCTATTGCCTAATAGATTTTTTTACTAAGTAGAAG
TGCCTACATAATTAAAAAACAGATACGATAACTCAATTATTTTAAATAAATAAAAATTTT
ATTTTATTAAAATCTCATATTACAAACAATTAAAGAATAAAAGGAATTTATTTTTTTTAA
TTAAAATTTAGGTTAGCAGTGGATCTACACTTCAAGAAATCAACTATTGGCTTAGTTATG
AAAGAAGTTTAAATTTAATTGACTAGCAAATAAGTTAAATTGAAACAACTATTACTATTG
AGTTATTGAAAAAGAAATTTAAGCATAATGTCATAGTACCATTTGAATATGATTTAAAGT
TCAAACACACACTCTAAGAGTGCACAAAATGCAATTAGTTTATGAAAGAATTCCCACTTA
ACGACTTACTCTCTGCAAGCAGCTTGTAAGAAATCAGAACTTCACTATCTGGAATCTTTA
ATCATATGAAAAATATTAAGAGTCTTAGCTATACTCCTTAAAGAGCCTATTAGCTTCTTG
AAGCCTTATCTCGTGACTTGAACTCCTAAATAGTTAAAATTTTAAGCTAATATAAGTTAA
TGACTATGAATTATGATCATTTCACTTAACTTATTGCTGATAGTCAGGAGATATTTAAAA
AGTGGGACAAAGAATTTAATGCTTTCAAGTAATCTTTGAAGGGACACACCTCAAACTGCT
TCTTCTTACACGTTGCTTTCATTCAAACCCGTCTTGAAATTATTATGGAAATTCGTAAAT
TGCACTAAACTTTGAATGAAGTTATTTAGAACATTCTTAGTAAAGATCGCTCTTCAGATA
AATTAGGTGATACTAATTTCCTTTCCACTACCGAAATTAATGAAGCTTTCAGCATTTTCG
ATGATATTGATGTTCTTAATTCTTCTGAAGAAGGAGAATAAGCTTTAAAGTTAGCTAAGA
ATAAATATGAGCAAAGAATTGATTAGATTGAAATCCAAATCACTTTAAAACTTCGTGATA
AACTTGGATAAGCAAAGGAAAATCCCAACGAAATGTTTAGAATTTTCAGTAAATTCAACA
AACTTTTTGTCCGTCCTCATATTAGAGGTGCTATTGTTGAATATTAATCTGACTTGCTTG
AAAAAGTATAAAAAAAAATTAGTTAGTTGCGTGAGAAGTTTGTTAAGAAATATGTAAATA
CTGAAACCTCAGTTCTCTGCAAGGTAATTATTATTTTTTTAATTATAAATTATATGTCTT
TATTAAATTATTATTATAATAAAGGTCAGAGATATTCCCAACATTGCTGGTAGTGTCATT
TGGACAAACTAAATGATTAAAAAATTAAATAAATATATGGATTAAATGGCTGATGTCTTA
GGTGAAAAGTGGGTTGAGCATCCATTGGGATAAAAATGTAAAGAAACTTGCGAAGCCTTC
AAGAACCACTTAAATCCTTAACAATTTGTAGACATGTGGTCTAATGAAATTTTAGATCTT
AATCAAAAAAAGAGTGAAAGTGAAAAAATATTTAAAATAGTTTAGAAGCGTAAACTTGAA
TTAGATGTAAATTATGATGAGCGTTAAGTTAATCTCTTTAAGGAAACTCGTATTTTGAGT
TCTTAAAAGGTTCGTTTCCTATCCTCCTTGTCATACACAGCTTAATAAGCTAAGAATATT
TATCCTTTTGCAATGTCTATTTAAGAATCTATTCGTTCATATAACTAAATTTCAAACCAC
GTTGATGATAAAATGAAAAAGCTTGTTGCTTCTTTCCGTAGAGGTGTTCACAAATAAATT
AGAAACGGTATGCAAATCAACTGGAATGGTGTTATCTATTTGAGCACATTTACTAAAAAT
TTAGCAGAATAAGTTTAAAAATTTGAAGAAGCTGTTAACCTTTTGAAAGATTATAGTGAA
TAGATTGAATCTATTTTAGCATTTTTGAAGACTTGCCATCCTTCCCATGAAACTTTCAAA
GAAAAATTAGAAGAAATCCAAAAGTTGATTGATGATATTAACTTTTAAAAAGATTATTCT
AACTTGCATATTTGGGTACCTGAGGTCGATGCCAAGATAGAAGATATTCTTGTTGAGCGT
TTGGTCTAAATTATAAGGAAATTTGTTGTTGAATTCGAGACTTATCGTTTAATGGAAAAA
AGAGAATTTATTGAGCAACACACAAGACATGAGCTCAAGATGAAGGATTAAGTAATTAGT
ATTGAACCTTCTACTGAATTTGCCCGTTACTATTGGTTCTAACAGTTCCACAAGGCTATT
GGTATCATATGTTCTCTTCCAAGGTAATTTTTCAAAATATTTTTTTAAATATAAAATAAT
TTATTTACTTAAATATTAGACTAGAAGCCACTAGATATTCTACTTCAATTTCAAGTAAAA
CAGCAGAAAATATTAAAAACTCTGATTATAGCTCTATATTGCTTAAGATTCCTAAGGACG
TTTTGATTGGATCTTACAATAGAATAGATTAAATTCTTAGAGATAATGAAAGATACGTTA
ATACATGGTTGAGCTATCAGTCTCTTTGGGCTATTGATTAGAAGAAAGTTTATGAACTCT
TAGGAGATGACATTAATAAGTGGTAACAACTTTTATCTGAAATAAAATAAGGAAGAAGTA
CATTCGATAATTCTGATACAGACATATTCTTCGGTCCTGTATAAATAGACTATCGTTTAG
TTCAAGTTAAAATTAACAATAAATATGATTAATGGCATAGAGAAATTTTAGATCACTTTG
GTCTAACATTTGGCGATAAGCTAAGAGATTTCAACACTAAGATTTATAATGCACGTTTAA
AATTAGAAAAGATTAGCTTTAACAATCCTTCTGTTGATGTAACTATTGCTATTACTGAAG
TAAAGGAAATGATGGAAAAATATTCTGTATGGAACAATGATATTGAAATTTTCAGAACTG
GTTAAAAGCTCTTGGAAAGATAAAAGTAATCATAAACAAATAAATTAATTTTAAAATTAA
ATAATTTTTTTATTAAAATATTAGATATTAATATCCAAATGATTGGCTCTGGTTAGATTA
AGTTGAAGGTGAGTGGTCAAATTTTAGACAACTAGTAAATAGAAAAAATTAATAACTTGA
AAAGGAAATTCCTACACTTCAAGAGAAAATCCTTTAAGATGAATAAATCTTAAATGAAAA
AATTAGAGATGTTGAAGAAAGTTGGTCCTCTAAGAAACCTTCAAGTGGTGAGTAATCTCC
AATTGAGGCCTTAGATGTTTTGAATATAATTTCTGGCCAATTAGGAAGAGTAAAAGACAA
TTATTCAAACTGCTGCAAGGCAAAACTTCTTCTCAATCTCGAACCTGGTAATATGTAAAA
ATTAGAAGATCTTGAAGAAGATATTAACTCTCTCAAGGAAGTTTGGTAAGAATTAAACAA
AGTCTGGTAGAACATCGAAGCATTAAATGACACTCTTATCAATGCCATATAACCTAAAAA
AATTAAGGAAGCTATGGATAATGCTAATCGCCTTATGACAGAAGTTCCAAATAAAATTCG
TACATACGAACCATATGAAAAAATGAGACAAAGATTGAAAGACTATGGAAAAATGAACCG
TATTATTGATAATTTAAAAACAGAAGCTATGAAGCCTCGTCATTGGTCAAACATCCTCAA
AAAAATGAAAGTAATTTTATAATTAAATGCATTAATATAATTTAAAACACATTTATTATA
CAGCTTAAACCTTCATTAAATGAATTAACTCTTGGTCATTTGTGGTCTAATGAATTAGTT
TTGAAGTATGAAAGAGCTATTGAAGATGTTTTAAGTGTGGCTTAAGGTGAATTTGTACTT
GAGTGCATGATGAAGAATGTTAAGGAATACTGGAATGAATTTGAATTAGATATGGTTAAT
TATTAAAATAAATGTAAACTTATTAAAGGCTGGGATGATCTTTTCGCTAAACTTGACGAA
GATTTGGGAACTTTGGCCTCCACTAAAATGTCTCCTTATTACAAGCAATTTGAAGAAGAA
ATTACTCCTTGGGATGAAAAGCTTCAAAGAATAAGAATTTTGTTAGACAGCTGGATTGAC
GTGCAAAGAAAATGGGTTTATTTAGAAGGTATCTTTTTCGGTGCTTCTGACATAAAGACT
CAACTTTAAAATGAATATAATCGTTTTAAGGGTATTGACAGTGAATTTACTTCTCATATG
AAGAAAGTAGCCAAAAAGCCTCTTCTTTTAGATGTCATTTCCATTCCTGGATTACAAAAA
ACATTGGAAAGACTTGCTGATATGCTTGCTAAAATTTAAAAAGCTCTTGGTGAGTATCTT
GAAACATAACGTTCAGCATTTGCTCGTTTCTATTTCATTGGTGACGAAGATCTTTTGGAA
ATTATCGGTAACAGTAAAGATGTTACTAATGTTCAACGTCACTTCCCTAAAATGTATGCT
GGTATAACTACTCTTACTAGTGAAAAGAATGAAAAGAATGATGACATAGTCAAGGGAATG
AATTCTAAAGAAGGTGAATCCGTAGCTTTTGACACTGATATCAATGTAGGTGAAGATCCT
AAGATTAATGTCTGGTTAGGAAAGGTAGATGACTAAATGAGACTATCTCTTGCTTCTAAT
TTATAAAAATCAATGCAAAAAATAGCAGCTATCGAGCAAGGAGATGACCAATCTTTATTA
GAAATTATTGCATAATAACCTGCTTAATCAGGATTACTCTCATTACAAGTAAAAATTATT
TTTATAACTTTTTTCAAATTGCTAAATTATTTTCATAGGTATTCTGGTGCAGCAGAGTAG
AAAAAGCTTTCGAAACAAAAGAATTAGAAAGTGTAGTATAATATATTATCCGCTTTTTGG
AAGTATTAGCCACTAATGTAGTTAAGGATTTGAAAAAAGATTTACGTCAAAAATATGAGC
AAATTATCACTGATTTTGTTCATCAGAGAGATGTAACTAGACAGTTGATTATAAAGAACG
TTGATAATCACAAAGACTTTGCTTGGTAATACCATATGCGTTTCACTTGGTTCACTAAAG
AGCAAGACCCATTGAAGAAACTCTTGATAAATATGGCTAACGCTTCATTCCATTATGGTT
TTGAATATCTTGGTGTAGGAGAAAAGCTTGTTCAAACTCCATTGACTGATAAATGTTATT
TAACATTAACTTAAGCTTTACACTTAAGAATGGGTGGTTCACCTTTTGGACCTGCAGGTA
CAGGTAAAACTGAATCAGTTAAAGCTCTTGGTTCTTAATTAGGTAGATTTGTTCTCGTTT
TTAACTGTGATGAAACATTCGATTTCCATGCTATGGGACGTATCTTTGTTGGTTTGTGTT
AGGTAATATTCTTTTAAAAATTGAATAAGTTAAGCAAAAAGTTAATAAATATTATAGGTA
GGTGCTTGGGGTTGCTTTGATGAATTCAATAGATTAGAAGAAAGAATGCTTTCTGCATGC
TCACAACAAATTCTTATTATTCAGAGTGGTTTGAGAGAAAGAGCAACTAAAATTGAATTG
ATGAATAGAGACGTTAAGCTTAATCCTAAGATGGGTGTTTTCGTTACTATGAATCCTGGC
TATGCTGGTCGTTCAAATCTCCCTGAAAACTTGAAATAACTTTTCAGACAAATGGCCATG
GTTAAACCTGATAGAGATTTAATTGCTTAAGTTATGCTTTATTCTTAAGGTTTTAGAACT
GCTGAAAAGCTCTCTGGTAAAATTGTTTCACTCTTCGAATTATGTAATGACTAATTGTCC
TCTCAACCTCACTACGATTTTGGTCTTCGTGCCTTAAAATCTGTCTTAGTTAGCGCTGGT
AATATGAAGAGAGTTGAAATAAGCAAAGTAGAAAACTTATCTAATTTCACAGATGCTTAA
ATTCAAGTAACTTTTTATTTTAAGATATTGCAATTATTAAATAAGCGGTTTTTTTAAAAA
TAAGGAATTTGAACAAAAGATTTTGCTTAGAAGTGTATGTGAAACTATTGTTCCTAAGCT
AGTGTCTGATGATGTCCCTCTTCTTTCTAACTTATTATCTGGTGTCTTCCCAGGAAGCTC
CATTCCCGAAATCAAGGAAGATGAGTTGCGCAAAGAAATTGAAAAAGTTTGTGCTAAGAG
AAATTTACTTCCCACAGACTTGTTTATGCAAAAAATATTACAACTTTACCAAATTTAAAG
ATTACATCACGGTGTTATGATGGTCGGACCTTCTGGTTGTGGTAAAAGTGTTGCTTGGAG
AGTCCTCCTTGAAGCTATGTACAGAGTAGAAAAGATTAAAGGAGAATCTTATATTGTAGA
CCCTAAGGCCATTCATAAGGATGAATTATATGGCAAGCTTGATAATACAACTCTTGAATG
GACTGATGGTGTTTTCACTGGTATTCTAAGAAAGATTACTGAAAACGTTCGTGGTGAATC
CTCTAAGAGACATTGGATTATTTTTGATGGTGATGGTAAAAAATATTTTTCATTTTTCAT
ATTTTTAAAAATTAAAACTAAAAATTATAAAATAGTTGATCCAGAATGGGCTGAAAATTT
AAATTCCGTTTTAGATGATAATAAGTTGCTCACTTTACCTAATGGTGAAAGAATTAGCAT
TCCTCCTAATGTAAGAATTATGTTTGAAGTCGAAACTTTGAAATACGCTACACTTGCTAC
CGTTTCTAGATGCGGTATGGTTTGGTTCTCTGATGAAATCGTATCATACAATATGATTTT
CTATAACTATGTAAACAGACTAAAGTAAGAAAACTATGATGAAATTCCTAAAGAAGAAGA
TGATGAAAAAGAAAAAAGGAAGGAAACTCCTGAAGCCATTACACGTAAATAGTGTGTAGA
AGCTATTCAAAATCTTTTCTTAGAAGGAGAACCTAGCTTTGGTGAATAAATTGTAGAAAT
AGCTTTGTCTTATCCTCATGTTATGGAATTCACTCGTATTCGTGTGCTTGAAGCATCATT
TGCCTTAATAAGAAAGGGTATTTCAAATGTTCTCGAATATAATGAATCTCACCCTGATTA
TAATCTCGACCCCGAAGTACTCAAGAAATATATGCAAAAGTGGACTCTTTTCTCTTTAAT
GTGGGGTATTGCAGGTTCAATGACTCTTTATTAAAGACAAAAATTCGGTGAAAATATAGC
TAAATTCAGTCCTGTTGATCTACCTCCTGTATTAATTTTTTATTTTTAAATTAATAATTT
TTAAATTGAATAAAAATAATATTTAATTAGGTTGGAGCTGGATAAGAAAGTATTATTGAC
TTTGAAGTAAGAATTGAAGATGGTGAGTGGTACGCTTGGAAGAAGAAAGTAAATTAATTG
AATGATATTTGATATATAATTAAAAATAAATAATATTTAATAGGTTCCTCAAGTAGAAGT
TGATCCTATGAAAGTAACTGATGCTGATTTAATTATTACAACTGTTGATACATTAAGACA
CTAGGAAGTAAAAAATAATTTAAAATAAATAAATTTTTCTAATTTTTTGATTTGATTCTA
GGTTTTGTGCTCCTGGTTGAGTGAACATAGACCTTTCTTGCTTTGTGGTCCTCCTGGTTC
TGGTAAAACTATGACTTTAATGAGCACTTTGAAAGCATTGACAGACTTTGAAATGATTTT
CGTTAACTTCTCTAGCTCTACAACTCCTTCTCTCATTCTTAAGCAATTCGATCACTATTG
CGAATATGTAAAAACAACTTAGGGTTTGATTTTACGTCCTAAATAACCAAATAAATGGTT
AGTTGTATTTTGTGATGAAATCAATTTGCCAGATATGGATAAATATGGTACAATGACTAT
TATTACTTTCTTAAGAGAATTGACTGAACAAAAGGGTTTCTGGAGACCAACTGATAAATA
ATGGATTAGCTTAGAGCGTATTCAATTTGTAGGTGCATGTAATCCTCCTACAGATACTGG
AAGAAAACCTCTTTCTGCTAGATTCCTTCGTCATACTCCTTTAATTTTAGTTGATTTCCC
TGGTCCTGAATCTCTCAAATAAATTTATGGTACCTTTAATCGTGCTATGCTCAAAAAGGT
TCCTCATCTTCGTAATTTAGCTGAGCCATTAACTAATGCTATGGTTGAATTCTATACTCG
CTCTCAACTTCACTTTACTGCTGATATTTAACCTCACTATATATACTCTCCTCGTGAACT
CACTCGTTGGAAATATGCAATCAACGAAGCATTAGAACCATTAGAAAGTCCCGAAGATCT
TGTAAGACTATGGACTCATGAAGCTATGAGACTGTTCTAAGACAGGTAATGAGTTTAAAT
TTATTTTTAAAACACATTAATATTATTATTTTTAATTAAAAGACTTGTTAAGGATGATGA
AAAAGAGTGGTGTGAAAAGTTAGTAGACGAAGTTGCTCAAAATAATTTCCCTTCTGTCAA
GCAAACTGCATTAGAAAGACCAATCCTATTCTCAAATTACATAAATAAAGATTATCGTTC
AGTTGAAAGAGAAGAATTAAGAAAGTAAAGATATTATTTTTAACATTTTGTATATAAGCT
TAACATTTATACATTTAATTAAAGATACGTTGTTGCTCGTTTGAAAATATTTAATGAAGA
GTAATTGGATGTCCCAATTGTTGTATTTGATTCTGTCCTTGATCATATTTTACGTATTGA
TAGAGTACTCAGACAGCCTTTGGGTCATCTTTTACTTGTAGGTGCCTCTGGTGTCGGTAA
GACTACTCTCACTAGATTTGTTTCTTGGATGAATAATTTGGTTGTCTATCAAATCAAAGC
AGGAAGAAAATACAATGTCCACGATTTTGATAATGATCTTAGAGATGTTATGAAACGCGC
TGGTGTTAAATAAGAAAAAATCTGCTTTATCTTTGATGAAAGTAATGTCTTAGGACCTGC
ATTCTTAGAAAAAATGAACGCCTTGCTCGCCTCTGGTGAAATTCCAGGTCTCTTTGAAGG
TGAAGAATATATGGCTCTTATGAGTTAATGCAGAGAAGCTTAAATGAAAGAAAATAAAAT
GATGGTAATTTTTTATAAATTTTTCTTAAATTGCTTACTTAGTTTTTTATAATTTTAGGA
TACTGATGATTAAGTTTACAGAAACTTCATAAAGAATGTCCAAAGAAATTTGCACGTAGT
TTTTACTATGAATCCTGCTAATCCTGACTTCTCCAATAGAACTGCAAGCTCTCCAGCTCT
TTTCAATAGATGTGTTATTGATTGGTTTGGTGACTGGTCTTAAGAAGCATTGTGGTAAGT
TGGTAAAGAATTCACTTAACACGTAAATTCAGATGAAGCTTCATTCACTAAGAGCTCTGT
TGCTGAAAATGTTGAAACTAGATAATTATAGCTTGTCAACACTATAGTCCACATCCATAA
TACTGTTGTTAGTCTTAACAGAAACCTCGCTAAGAGTGCTAAGAAATATAATTATATAAC
ACCAAGAGATTATTTAGATTTCATTAAACACTTTATGGAATTACTCCACTCTAAGAGATC
TTCTCTTGAAGACTAGCAATTGCACTTAAATAAGGGTCTTGAAAAGCTTAAAGACACAGA
AGAACAAGTAGCAACCATGGAATCCACACTTAAGAAAAAGAAAACTGAATTAGAATAAAA
GGAAAAAGAAGTAATTTGTTTTTTTCTTATTTTCAAATATTTATTTAAAAAATGATTTAT
TAATTTAAAAGGCTAATGAGAAATTAAAATTGATGGTTTCAGAATAAAATAAAGCTGAAT
AAAGTAAAGATGAATCAATAAAGCTCACTGAATAAGTAGATAAATAAAAGGCAATTATTA
ATGAAAGAGAATAAATTGCTCGCCAAGAATTAGCTGAAGCTGAACCTGCTCTTATCAAAG
CTAAAGAAAGTGTTAATTCTATAAATAGAGCTCAGCTTGATTAAATCAGATCTTATGCTG
CTCCTCCTAAATTGGTATAAATTACAATGGAAGCAGTCATCTTTGTTATTACAAACACTT
ATACAGCTAATCCTGCTTGGGCTGATATCAAAAAGTAGATTGCAAATAAAGATTTTATCA
AAAATGTTCTTGATTTCTCAACTGATAACCTCCAACCTGCAATTAAGAATAAATTAATTT
AGAATTATTTAAAGAAAGAAGAATGGAATGTTGAAAGAATTTACAACTCTTCTTAAGCAG
CTGGTCCTCTTGCTCTTTGGGTAGAATCATAAATCAGATATGCTGATATTCTATTAAAGG
TAGATCCTCTTAAGAAAGAAGTAGATGATCTTAAGAAACAAGGTAGCATTTTAGAAGATA
AAAAGAAACAACTTGATTAATAAGTCGAACTATTACAAGAAAAGATTTCTCAACTTAAGA
GTGATTATGCTATTTTGATTGCTGATAAAGAAAATATAAAGAATGAAATGATTAAGGTAA
AAGAAAAGGTCGAACGTTCTCAATAACTTTTATAAAATTTATCATCAGAAAGATTCCGTT
GGGATGCCTCATCTCAAAACTTCAAGCAATAAATGGCCACAATCATTGGTGATGTCCTTT
TATCTGGTGCATTCTGTAGTTATATTGGTTTCTTCGATCATTTCTACCGTCGTGTTTTAA
TGAAATCATTCCGCGATTATCTTGAAAATTCTGCTTACATCCGTTTCCGCAAGGACCTTA
GCTTAATTGAATTCTTGTCAAAACCTTCAGATCGTCTCAATTGGTAATCTCATCGTCTTC
CTAATGATGATTTGTGTACTGAAAATGCCATTATCCTCTCTCGTTTCCATAGATATCCTC
TCATCATTGATCCTGCTGGATAGGCATAAGAATTTGTACTCTCTTTCTATAAAGATAAAA
AAATAGCTAGAACTTCATTTGCTGATGATGCATTTATGAAGACCCTAGAAACCTCTCTTT
GTTTTGGTTGCCCTCTATTAGTTCAAGATGTAGAACGTATTGATCCCATCCTCAATTCAG
TTCTGAATAAAGAAGTTTACAAGGCTGGTGGTCGTGTTTTAATTCGTGTTGGTGATTAAG
AAATTGATTTCTCATCTTCATTCTAAATGTTTATGATTACACGTGATTCTAATGCTCGTT
TCACTCCTGATCTTTGCTCTCGTGTTACTTTTGTAAACTTTACTGTCACACCAAGTTCTT
TGCAAAATCAATGTTTAAACATTTATCTTAAGAGTGAAACTCCTGAAACAGAAGAAAAGC
GTATTAAACTTATGAAATTATAGGGTGAATATATTGTCCGTCTTCGTGAGCTTGAAGATT
CTTTGCTTGATTCTCTTTCTAATGTAACTGGTTCTATTTTAGATAATGAATCAGTTATAG
GTACTTTGGAAAAACTTAAGAGTGAAGCTACTAACGTATAACGTGAAATGGAACAAAGTG
ATAAGGTTATGTAAGAAGTTTAAAAAGTAACTTCTGACTATATTCCATTAGCAGAAGCCT
GCTCAAAAGTATTCTTTGCTCTTGTTTCAATGAAATAATTACATTATCTTTATGATTTCT
CATTAAACTTCTTTATGGAAATTTTCAATGAGTTACTTCATAAAAATGAAATACTTGCTG
CAACTGCTAAGACTGATTTACCTGCTCGTCGTAGAGTCATTTATGATGAGCTCTTTATCA
GAGTATTCTAAAAAGTAACAAACTCACTTCTTGACTAGGATCGTATTATTTTTGCTTTAC
GTCTTACATAAATAAAGCTTGGTAAGACATACGAAAATGCTTTTATGAATCTTGCTAAAG
CTCCTAAATTAATTGAAACAACCTTATCTGAATAACTTCTTGAATCAAAGCTTACAAAAT
AATAGCTCAAGCTACTTGAAGATATTTCTACTAATACTACTGAATTTTCAGCTCTTTTAC
CTGATGTAAATCGCAACGAAAGCTCTTGGGTTGATTTCATCCTTTCTGAAACTCCAGAGG
ATTAAGTTCCTTCTGATTGGGCTCCTCAACAAAATCCAAGTATGTCTGAATTTGATTTAA
CAGTAAATAATCTTCTTCGTGATTTAACAGTTATTAAAATTTTCCGTCCAGATAGGTAAG
ATACTTTTTTTTAGTTCAGAATAACATTATTTAATTTTTTATTATAATTAATCAAGATTC
CTTGTTGTTGCTAAGAGACTTGTGTCAAAGGTTATGGGAAGCAAATTCCTTGAAGATATT
TAAATTGATATGAAATAGGTAGTAGAAAAAGATTCAAATTGCAAATCTCCTATTCTCATG
TGCAGTGCTCCAGGTTTTGATCCATCTTACAAGGTTGATGCCCTTGCTAAAGAAATGGGT
GTTAGACATATATCAGTAGCTATAGGTTCCTAAGAAGGATTTGATCTAGCTGATAAAGCA
ATTCAATAAGCTGCTAAATCTGGTATTTGGGTTTTACTTAAGAACGTTCACTTGGCACCT
TCTTGGCTTTCTGAAGTAGAGAAGAGTATTCATAGATTAACTCCTCACAATAACTTTAGA
TTATTCTTAACCATGGAATTCAATCCTAAGGTACCTTCAACTCTTATTCGTTAATCTTAC
AAACTTGTATTTGAACCTCCTAGCGGTATTAAAGCTTCTTTACAACGTTCATTTGCTTCT
CTTCTCACTCCTGCTCGTACTGATCGTCTACCAAGAGAAAGGTAAAATAAATTTTCAAAT
TTGATATAATTTTAACTAATTAATATTTATTTATCAATTAGATCAAGATTACATTTCCTT
CTTGCCTGGTTGCATGCTATTTTATTAGAGAGACTTAGATACACACCTATTGGTTATACT
AAGGTTTATGAATTTAATGAAGCAGATCAAAGATGCTCACTTGACTTAATTGATGAATTC
GTAGATTCTCTAGGTGACCGCTCAAATATAGATCCTGATAAACTTCCTTGGGAAGCTATC
AGAACTATTTTATGCTAGAATTTATATGGTGGTAAAATTGACAATGAATATGATGGTAAG
ATCCTTGAATCATTAGTTGAGCACTTATTCAATCCTAACGCTTTTAACGCAAATTATGAC
ATGTTCTCTACATCAGAAAAAAATATTTAACTCATCAAGATGCCAGAAGCAATTCGTCAA
TCTTAATATGTTGAGTGGATAGAAAAATTGCCAAATGTAGAATCTCCTGCTTGGAGTGGT
TTACCTGTAAATGCAGAAAAAATCCTTAAAGAATAAAATACAGAACGTGCATTAAATTTA
TTATGGACTTTGTAGGATGTAAATGATGAAGAAATCGAAGAAATAGATATGGGAGTTAAG
CCAAAGACTGGAGGCTAAGGTTAGTAATCCCAACAAGTATAATGGTTGCGTACTGTTTAA
GAGAGATCTGAATCATTCCTCAAGGTTCTTCCTCAACAAATTGAAAAGTTAAATCGTACT
GCTACTTCAATGAATGATCCTCTCTTCCGTTTCTTGGAAAGAGAAATTACTGTAGGTACT
AAGCTACTCAATGAAATTAAGTCTAACCTAAAGGATGTTATTTAAATGGCTGCTGGTAAT
ATTGCTGGTACTAATGTAACAAAATAACTTGCTAAGGATGTCTATTCTGACGTAGTTCCT
AAGGCATGGGTTAAATTTAATAGTTATTGCACAAGTCTCAATGAATGGATTTTTGATTTC
AAGCAACGTATTGATTAATTCAATAAGGTAAATAAATTGAAAATATTTAATAAAATTTAA
AATTATTATTTTAATTAACAAAAAAAGCTTGCAATCATACCAAATTACCAAAAATCAGGT
GTTTGGATTGGACAATTATTATATCCTGAAGCTTATATGACTGCCACTAGATAGTTTGTA
GCTTAAAATAATGCTTGGTCATTAGAAGAACTGGAACTCTAAGCTTCAGTTTATAGTGAA
GGTGACTAACTAGGAGATGATTGCTTCTTAGTTAAAGGTATGTCTATTGAAGGAGCTGAC
TGGAAAGGAACTCAACTTTTACTTAGTAACGAAATAAGAATTATGTTACCTCCTATTATC
TTCAAGTGGGCAAGATCATCAACAAAGGGAGTTCAAGATGGACAAATTATGGTTCCTGTC
TATCTCAATAAAGCAAGAAAAAATCTAATTTTCAGTTTAAAGGTAATATTAAATTTAGTA
AAAACTAATCAAAATAAAATAATTTTTTTTACCCAATAAAAGATGAATTGTGGTCACATT
CCTCGTGCTCAACTCTACTAGAAAGCAATTACATTGATTGCTTGGAATAATTCTTGA