Identifiers and Description

Gene Model Identifier

TTHERM_00248320

Standard Name

DUT1 (DeoxyUridine 5'-Triphosphate nucleotidohydrolase)

Aliases

PreTt02528 | 21.m00359

Description

dUTPase, catalyzes the hydrolysis of dUTP to dUMP and PPi

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF06636 ) Protein of unknown function (DUF1157)
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19.3%

TetraMine Data

TTHERM_00248320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00465.12.9988601762256104e-132hypothetical protein (3834 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00248320(coding)
ATGGTTTAAATATCACTAAATTCCTAGTGGAAATAAATTTTATAGAGCTAAACCTTTATC
ATAGCAGTTTTGGCTATTTTGCCTTCTCTTCTTATGTCTGTTATTTGCTATACATCTCTC
ACATAGTTTTAATTATAGACAAAAATATTAATAACATAATATAGTGAGAATTTATATTAA
TCACAAAAGAATAGCTCTAAGCAGCATAATTTTGCTCTAGGGATTCAATTTGATTCGCAA
GTACAATAGATATAATGGAGACTGTACGTTACAAATAAATTTTATAAGAAAATCCTTAAT
GGCCAAGTTATTAAAAACCCTAATTTCTAAGCTACTTTTATAAGTCTTGAAAAAACATTT
AACTAAACAGAAGATTCATAACTTTTAGGTTTATTCAAAAGAAATCCTATCCTAACAAGC
ACATGGTTTAATCCAAATCACACTAATTTTGATGAACTAAATATATAGTCAAAGGAGGAA
CTATAGGATTCTTTTTACCTAGATAGCTTATGGAGAGCTATTAAATACGAAAATACAATT
AATGGCTACTCTAGATTATAAATAAAAGACCTTTTTTTAGGGTTTGAAAATGATGGAGCT
CTATACATAACTCCAGGTATTAATTCAACATATTCTTAATTTAAACCTCCAAATTGGTGC
TTACCAAACGTATATCACATGGATGTAAGATGCAGATTTTATTATCAGCCTACTATTGAG
AGTACTTCTATTCCAATATTATATGCTGATATATTTTATAGCAATCTTGGGGAACCTTTT
TTAGCAAGTATTTTCTGCTAAAGGACTGATATAAGGAATGCAAATGAAGACTTTGAAAAG
TACAGTATTTTATGCCTAAATATCGACTTAACACACATATCTTCCTTTATGAATAATTTT
GGTAGTAATTCTAAGTTTTAATTATTTTTGGATCCTGTAAAGCTAAACGTAATTTATGAT
TCTGACCAATCTATTCTGAAAGGCTAAGTAATAAACGTATTTGACCATTAAATTAAATGG
ATGTAATCAAAGTAGTAATAAGACTTATTTATGAGCACTTTGAAAAATTTTACTAGTTCA
TAGATATTAGACAGCTTTAGTCAAGTTAATATGGTAAAATCTCTCACAGATAATGTTTTA
TAAAACTAACTTACTCTAGAATATAATATAAATGGAACAGATTTATTTGCAATTATGAAT
AGAATTACTTTCATAGATAAAATTCCAAATTAGAAGGACTAATAACTATAAGGAACTAAA
TATTTAGAAAAATTGGTGTACATCTTTATAGATGTGCTAACCCAAGAGCAACTTATGGAA
AAATCTAGAGGTGAATCGTAGACGACAAGCCATGATATTTAAATTGGTTCATCTTAAAAT
AAGCAAAAGTAAAAATAAAATGAAAAAAATTAGTATAATATAAGAATATTAAAAGAAGAT
TAACATAAAAATGGAGACAATTTGAATGATAAAAATCTAAAGAGCCAGTTAAATTTTTAA
TCAATGAGTTCTAGAAGAGGAGGAATTACATACTTTGGCTTTATTTAGGAAGAAGAATGG
AAAGTTAATATCGTTGATTTCTGTCTTTCAAGTGAAACTAAGAGTTTGTTTGAAAGCTTT
CAGAATATGTTTTAAACCCTCTAATTTATTACTTAAAATATTTTTGGTGGAGACGAAAGT
TAATCGCTTCTTAGTCTATCTACATAAATTGAATTTTTTAAAAGCATTAAAAACTATAGA
GCATTGGGAATTTGCTTTAATAATATGGGTAATATTCACTATAATTGTTGCAGGTATAAA
GAAGCTTTGGAAAGTTACTAGCATGCTTTGATATACGCTTAATATGAGATTGAATTGTAT
AAATCAATTGACTATTTCTGTAAATCTGAAACTCAAAAACATTAGGATATTCATGACAAT
TCAAATAATGAAATTAATGAGAAAAGCAGAGAGCAAGTTTGTGATAATGACAACCATTCT
ATCTTAAAGGAAAACTCTGCTCTTAGAAAACATGATTTTGGATAAAAATATAAAAGTTCT
ATTAACTATTCTAAATAAAGTATGCAACATCCTCTTTTAAATATCTTAAATAATAATCAA
ACTCTATCTAATAGTCATAACTTTTCTTCTTCTATTAAATTTAAATTGTTCTGTAAGCTA
AGCAAATAAGAAAGTGAAGTGCTTTGGTGGAATATCTTTAATAGAAAATACAACTATTGT
TAAGCTCTAGCAGGGTATTTAAAAGATTACCATAATAACAATATTAGCTTGTGGGAAGAA
ATGGAGTCAGTCGTTTATGAGCTACTTGCAATTAGTAGTAGCTAATTCCTTCCATAATGC
CATAAAAGAGATATGATTATACTCTATTAGCTATCTATAGCTTTATTGCATTAAAATAAA
GTTTATTAATTTCTTGAATGCCTTTCAATATATGAATAAATATATAATTTCAGTAAAGAA
TCAAAGCATTAAGCAAAGATAGAATCTATTTCTAAAACTGTAATCAGACAAAATTTAACC
CCTCAAAAAAAAGAATAAAAACCTATCTTCTAAAGCTAAGAATAACCTAATTCGTTCAGT
AACTAGCATAATAATCCTCTTATAAACGCTTAGAGCTTATCTCAGAAAACTAACAAAAAT
ATATTTTTTACACCTTAACACTATCAGCAAAAAAATGATTAAAAACTCCATGAATTTCCA
ACAATCTAATTTTCTGCTGAATAGTCAGATTAAGTTATGTTTTAGGCAACTCAAAAATCA
AGATTTCATTTAAATGATGCACCACTTTAGCTACCAGCTAATTTCACTTTCAAGCATAAA
GAAATCTTGAAAAAAAAAGACTCTCTTTTTTTAACTTGTGAAGATAGCCCTACAATGTTG
TCTTCGCGCCAACTTGAAGGTGCTTATTTAGACGAGAATGCTACATTTCATGCTATTAGA
GATACTTAAGCCAATCTCTTTTAAATTTCCAAAAATAATATCAGTAATGTTTTAGAATAG
AATGTTTAGATTGCTAATGATGCAGAAAATCAAAGTAATTTAATAATCGATATGGCTAAG
ATTAACTAAGAAACTCCTGATAAACTTAAATCAGCTTAGCAGTTTTTATTTGGTAGCTTA
TTAAAGAACAAGAGTGAATAATATTATAGCACTGCAACATTCTAGGCCTATGAAACGAAT
TCTACAAGTCTTTATGATATCTAATAACAACGAAGTAAGCCAAGAAATCAGAGTTAACTA
TCAAACCTTTAATCAAAGATAGGAAATTACAGCCACTCAGCTGAGATTCTTACTAAGATA
CTAGAAAGGAGCTACGTTTACTCTCCTCATTTAAAAAAAAGAATTTTAAAGAAACTTCAT
AATATTTTTATAAAATTAAACATTAAAAATCCCTTTCTTTTAAATATGAAATACTAGTAC
GAAAATCTATAAAAATCTAATTTTAAAATTTGTTTTATAACCAATGTGCAAAAGCCACTC
TAAAAGTAAGAATGCTTACACCTATGCTAAGATTTGATATAGGATATTTTAACTCGTAAA
TAAGATTAGCTTTCTTTAATAAACTATAAATAAGAGGAGCTTATTTATGTGCAATAGCAA
ATGTTAACTCCCGTTTTTATAATTAAGAAATAAATAAACCACTTTTATCAGATTCTTTTA
AAATCATTTACTAATGAAAATGACTCTAAGTAGTGTAACAACTCTCCTTTATGCTCTTAA
AATATTAGTTTCAGCCTTTACAATCAAGATTAAATTAAAAATATTTAATCTCCTTTGTCA
AATTTGTCATAAAATTTAATTCATTTTAAATCTGATTAAAATTAAAATGCTTCATAAAAT
TTTCACTAATAAAATCATCAAGGCTTGACAGAGCAATTTGATGATGAATTTTTTTCTATA
CATAAAATGCAAAAATAAATCAAAGAATAGGAAAAATAAATTAAAACTGAAAATTAATAA
ACTCATCAAAATGCTATCATTAGTATAATTGATTTAAATAACGAAAATGTAGGATACTAA
GTTTCATTCAAAAGTATAGATAACTCAAATAATTTGTAGTCAGATGTTAAATTAAATTTA
GATATATCTGTGAATGGTCTAATTAACATAGAAAATAATAACCTTTAACCTTATACAAAA
ATAAATTCAATTAATTCATCATAACAATTCTTCAATTAGAACAATTAAGAAGAAATTATT
AAAAATTGTTAGCATTAAAAAGTTGAAAATAACTTAAAATAACACTAAACACTATAAATA
TCAAATGAACCACAAAAAAATAATACCTCTTCAACTTCTTCATTTTAAAAAATTAATATA
AATAGACCATCTTCCTTTAAAAAAATTTTTTTTTCATCTGATGATAAAAATAATTCACAA
TAAAATGGTTAATTAAGTGATTAAATTTTAAACGGAAAATTCGATGACTAAGAATAAAAA
AATTATTAAAAATTCCCATCTATTGATTCTATTTATGAGTAGAATAATCTTTAGTAAATT
TCAAATTTTCATAGGGTTGTATCATGTCCAAATACAAGCACCACTGAAAAAGAAGAGAAT
TCAAATTCAAATTTATAGAATTCGATTTCCTAATAAAAAGAATAGGAACTAATATTTCAT
CTTGGTGTTCATATTGCACTCAAAAGAGATATTCTAAATTCACCTTAAAAGATCTCCTTT
TATTAGGCTTAAAAAAAAAATGGAAAATATATGTAATTAAGTGAAAATTAAAAAGAGGTG
CTCTCTTAAAATTACTTCAAGTTTAAAGATTCAGATTCATATCCAATACAAAAAACTTTC
TTAATTTATGTTACAGACTAAATTTTAGTAATTAGAAATACATTTTTGTACAAAGAATTG
TGCAGCTTACTTTACAATTTAAGCATAGAGCTACTAGTTTTGCTATAAAATTCTTATTAA
TCTACTTTAGAACAACCAATTGATTTAAACGCTGAAATACTAAACAAAAATGTGATATAA
TTTTTTACATCTTAATCAAAACTCCTATAATATATATACAATCAGAGAGATATTAGTAAT
CATAATTTGTATCCTACTATTGTAGAGTAATTTTAAACTAATTCATTTGAATGA


>TTHERM_00248320(protein)
MVQISLNSQWKQILQSQTFIIAVLAILPSLLMSVICYTSLTQFQLQTKILITQYSENLYQ
SQKNSSKQHNFALGIQFDSQVQQIQWRLYVTNKFYKKILNGQVIKNPNFQATFISLEKTF
NQTEDSQLLGLFKRNPILTSTWFNPNHTNFDELNIQSKEELQDSFYLDSLWRAIKYENTI
NGYSRLQIKDLFLGFENDGALYITPGINSTYSQFKPPNWCLPNVYHMDVRCRFYYQPTIE
STSIPILYADIFYSNLGEPFLASIFCQRTDIRNANEDFEKYSILCLNIDLTHISSFMNNF
GSNSKFQLFLDPVKLNVIYDSDQSILKGQVINVFDHQIKWMQSKQQQDLFMSTLKNFTSS
QILDSFSQVNMVKSLTDNVLQNQLTLEYNINGTDLFAIMNRITFIDKIPNQKDQQLQGTK
YLEKLVYIFIDVLTQEQLMEKSRGESQTTSHDIQIGSSQNKQKQKQNEKNQYNIRILKED
QHKNGDNLNDKNLKSQLNFQSMSSRRGGITYFGFIQEEEWKVNIVDFCLSSETKSLFESF
QNMFQTLQFITQNIFGGDESQSLLSLSTQIEFFKSIKNYRALGICFNNMGNIHYNCCRYK
EALESYQHALIYAQYEIELYKSIDYFCKSETQKHQDIHDNSNNEINEKSREQVCDNDNHS
ILKENSALRKHDFGQKYKSSINYSKQSMQHPLLNILNNNQTLSNSHNFSSSIKFKLFCKL
SKQESEVLWWNIFNRKYNYCQALAGYLKDYHNNNISLWEEMESVVYELLAISSSQFLPQC
HKRDMIILYQLSIALLHQNKVYQFLECLSIYEQIYNFSKESKHQAKIESISKTVIRQNLT
PQKKEQKPIFQSQEQPNSFSNQHNNPLINAQSLSQKTNKNIFFTPQHYQQKNDQKLHEFP
TIQFSAEQSDQVMFQATQKSRFHLNDAPLQLPANFTFKHKEILKKKDSLFLTCEDSPTML
SSRQLEGAYLDENATFHAIRDTQANLFQISKNNISNVLEQNVQIANDAENQSNLIIDMAK
INQETPDKLKSAQQFLFGSLLKNKSEQYYSTATFQAYETNSTSLYDIQQQRSKPRNQSQL
SNLQSKIGNYSHSAEILTKILERSYVYSPHLKKRILKKLHNIFIKLNIKNPFLLNMKYQY
ENLQKSNFKICFITNVQKPLQKQECLHLCQDLIQDILTRKQDQLSLINYKQEELIYVQQQ
MLTPVFIIKKQINHFYQILLKSFTNENDSKQCNNSPLCSQNISFSLYNQDQIKNIQSPLS
NLSQNLIHFKSDQNQNASQNFHQQNHQGLTEQFDDEFFSIHKMQKQIKEQEKQIKTENQQ
THQNAIISIIDLNNENVGYQVSFKSIDNSNNLQSDVKLNLDISVNGLINIENNNLQPYTK
INSINSSQQFFNQNNQEEIIKNCQHQKVENNLKQHQTLQISNEPQKNNTSSTSSFQKINI
NRPSSFKKIFFSSDDKNNSQQNGQLSDQILNGKFDDQEQKNYQKFPSIDSIYEQNNLQQI
SNFHRVVSCPNTSTTEKEENSNSNLQNSISQQKEQELIFHLGVHIALKRDILNSPQKISF
YQAQKKNGKYMQLSENQKEVLSQNYFKFKDSDSYPIQKTFLIYVTDQILVIRNTFLYKEL
CSLLYNLSIELLVLLQNSYQSTLEQPIDLNAEILNKNVIQFFTSQSKLLQYIYNQRDISN
HNLYPTIVEQFQTNSFE


>TTHERM_00248320(gene)
ATGGTTTAAATATCACTAAATTCCTAGTGGAAATAAATTTTATAGAGCTAAACCTTTATC
ATAGCAGTTTTGGCTATTTTGCCTTCTCTTCTTATGTCTGTTATTTGCTATACATCTCTC
ACATAGTTTTAATTATAGACAAAAATATTAATAACATAATATAGTGAGAATTTATATTAA
TCACAAAAGAATAGCTCTAAGCAGCATAATTTTGCTCTAGGGATTCAATTTGATTCGCAA
GTACAATAGATATAATGGAGACTGTACGTTACAAATAAATTTTATAAGAAAATCCTTAAT
GGCCAAGTTATTAAAAACCCTAATTTCTAAGCTACTTTTATAAGTCTTGAAAAAACATTT
AACTAAACAGAAGATTCATAACTTTTAGGTTTATTCAAAAGAAATCCTATCCTAACAAGC
ACATGGTAAATAATATATAAACTTTAATTATTCTATAATTGAGATTAATTGTTAGTGTAT
TAGTTAATTTTCTCATTTTTACTTTGTTTTTTTTTTTCAAAAAAATAATAATATTAACAA
ATTAATGCTAGTTGTTTGAGATAATTAAATAAATCCTCTACTTTTTCAATTCAATTAAGA
AAATAAAATTATTATTGATTTAAATCGCCATTAGAAAGCATAAAAATGATAAAATAATTA
ATTTTTTTCAAAAAATAAATATATTTGAGTAGTTTATTTAGTTAAACAAAAATAAAATGG
TCTGTTGATCACTCACAATTTTATATTTAAGTTATGCAATAATTTATTTATCAAATATAT
TTAGGTTTAATCCAAATCACACTAATTTTGATGAACTAAATATATAGTCAAAGGAGGAAC
TATAGGATTCTTTTTACCTAGATAGCTTATGGAGAGCTATTAAATACGAAAATACAATTA
ATGGCTACTCTAGATTATAAATAAAAGACCTTTTTTTAGGGTTTGAAAATGATGGAGCTC
TATACATAACTCCAGGTATTAATTCAACATATTCTTAATTTAAACCTCCAAATTGGTGCT
TACCAAACGTATATCACATGGATGTAAGATGCAGATTTTATTATCAGCCTACTATTGAGA
GTACTTCTATTCCAATATTATATGCTGATATATTTTATAGCAATCTTGGGGAACCTTTTT
TAGCAAGTATTTTCTGCTAAAGGACTGATATAAGGAATGCAAATGAAGACTTTGAAAAGT
ACAGTATTTTATGCCTAAATATCGACTTAACACACATATCTTCCTTTATGAATAATTTTG
GTAGTAATTCTAAGTTTTAATTATTTTTGGATCCTGTAAAGCTAAACGTAATTTATGATT
CTGACCAATCTATTCTGAAAGGCTAAGTAATAAACGTATTTGACCATTAAATTAAATGGA
TGTAATCAAAGTAGTAATAAGACTTATTTATGAGCACTTTGAAAAATTTTACTAGTTCAT
AGATATTAGACAGCTTTAGTCAAGTTAATATGGTAAAATCTCTCACAGATAATGTTTTAT
AAAACTAACTTACTCTAGAATATAATATAAATGGAACAGATTTATTTGCAATTATGAATA
GAATTACTTTCATAGATAAAATTCCAAATTAGAAGGACTAATAACTATAAGGAACTAAAT
ATTTAGAAAAATTGGTGTACATCTTTATAGATGTGCTAACCCAAGAGCAACTTATGGAAA
AATCTAGTAAAGTAAAATCTGATTTAGATAAATTTTAACTTGTGTTTTTAATTGTTAGCT
CCATTTTTTTTTCAATTACAATTATAATTGAAGTACTCTATGCCTTGAGGATTAGCTTTT
TATTTGAAAGGCCAATAATTCACCTCACTAAAATTATACAATAAATACAGTTAAAATAAA
CTTTAGAAACCAGTAATAAACTTAAAAGCTAGACTTCTTTTAATTAATTAGCATCTATAA
ACCTAGATTATAAAATAATGTAATCGTAAAAATAAACAAAAAGAAGTGTTTAAAATATTT
TTAAAGGAGGTGAATCGTAGACGACAAGCCATGATATTTAAATTGGTTCATCTTAAAATA
AGCAAAAGTAAAAATAAAATGAAAAAAATTAGTATAATATAAGAATATTAAAAGAAGATT
AACATAAAAATGGAGACAATTTGAATGATAAAAATCTAAAGAGCCAGTTAAATTTTTAAT
CAATGAGTTCTAGAAGAGGAGGAATTACATACTTTGGCTTTATTTAGGAAGAAGAATGGA
AAGTTAATATCGTTGATTTCTGTCTTTCAAGTGAAACTAAGAGTTTGTTTGAAAGCTTTC
AGAATATGTTTTAAACCCTCTAATTTATTACTTAAAATATTTTTGGTGGAGACGAAAGTT
AATCGCTTCTTAGTCTATCTACATAAATTGAATTTTTTAAAAGCATTAAAAACTATAGAG
CATTGGGAATTTGCTTTAATAATATGGGTAATATTCACTATAATTGTTGCAGGTATAAAG
AAGCTTTGGAAAGTTACTAGCATGCTTTGATATACGCTTAATATGAGATTGAATTGTATA
AATCAATTGACTATTTCTGTAAATCTGAAACTCAAAAACATTAGGATATTCATGACAATT
CAAATAATGAAATTAATGAGAAAAGCAGAGAGCAAGTTTGTGATAATGACAACCATTCTA
TCTTAAAGGAAAACTCTGCTCTTAGAAAACATGATTTTGGATAAAAATATAAAAGTTCTA
TTAACTATTCTAGTAATTTTAGATTTAGAAGTTAGGCTAAGAAAAAAACTTTACTATAAA
TTCTTAATATAGAATAAAGTATGCAACATCCTCTTTTAAATATCTTAAATAATAATCAAA
CTCTATCTAATAGTCATAACTTTTCTTCTTCTATTAAATTTAAATTGTTCTGTAAGCTAA
GCAAATAAGAAAGTGAAGTGCTTTGGTGGAATATCTTTAATAGAAAATACAACTATTGTT
AAGCTCTAGCAGGGTATTTAAAAGATTACCATAATAACAATATTAGCTTGTGGGAAGAAA
TGGAGTCAGTCGTTTATGAGCTACTTGCAATTAGTAGTAGCTAATTCCTTCCATAATGCC
ATAAAAGAGATATGATTATACTCTATTAGCTATCTATAGCTTTATTGCATTAAAATAAAG
TTTATTAATTTCTTGAATGCCTTTCAATATATGAATAAATATATAATTTCAGTAAAGAAT
CAAAGCATTAAGCAAAGATAGAATCTATTTCTAAAACTGTAATCAGACAAAATTTAACCC
CTCAAAAAAAAGAATAAAAACCTATCTTCTAAAGCTAAGAATAACCTAATTCGTTCAGTA
ACTAGCATAATAATCCTCTTATAAACGCTTAGAGCTTATCTCAGAAAACTAACAAAAATA
TATTTTTTACACCTTAACACTATCAGCAAAAAAATGATTAAAAACTCCATGAATTTCCAA
CAATCTAATTTTCTGCTGAATAGTCAGATTAAGTTATGTTTTAGGCAACTCAAAAATCAA
GATTTCATTTAAATGATGCACCACTTTAGCTACCAGCTAATTTCACTTTCAAGCATAAAG
AAATCTTGAAAAAAAAAGACTCTCTTTTTTTAACTTGTGAAGATAGCCCTACAATGTTGT
CTTCGCGCCAACTTGAAGGTGCTTATTTAGACGAGAATGCTACATTTCATGCTATTAGAG
ATACTTAAGCCAATCTCTTTTAAATTTCCAAAAATAATATCAGTAATGTTTTAGAATAGA
ATGTTTAGATTGCTAATGATGCAGAAAATCAAAGTAATTTAATAATCGATATGGCTAAGA
TTAACTAAGAAACTCCTGATAAACTTAAATCAGCTTAGCAGTTTTTATTTGGTAGGTAAT
AAAGTATTTTATTCTAAAAGTAACTTATGTAGCCTCATATTAATGATAAAAACCATCATA
ATTAATAAATTATAACAAAAAAATTTCATTCTTTTACAACAAAAAACATACAAAAAAGGG
AAGAAAATGAAGAATTGCATCTTTCTCATAAGAATATAAATTTTTAAAAATAAGATATTA
ATCTTAATGAAAAAAAGTAAAGTAGAGTATTATTTTCAAATAGCTTATTAAAGAACAAGA
GTGAATAATATTATAGCACTGCAACATTCTAGGCCTATGAAACGAATTCTACAAGTCTTT
ATGATATCTAATAACAACGAAGTAAGCCAAGAAATCAGAGTTAAGTAAAATCTATAAAAT
CGTTTGAAAAAATAGCTCAGTATAAATTTAATATGGATATTTTTGCTTAATATTACACTT
TATAGCTATCAAACCTTTAATCAAAGATAGGAAATTACAGCCACTCAGCTGAGATTCTTA
CTAAGATACTAGAAAGGAGCTACGTTTACTCTCCTCATTTAAAAAAAAGAATTTTAAAGA
AACTTCATAATATTTTTATAAAATTAAACATTAAAAATCCCTTTCTTTTAAATATGAAAT
ACTAGTACGAAAATCTATAAAAATCTAATTTTAAAATTTGTTTTATAACCAATGTGCAAA
AGCCACTCTAAAAGTAAGAATGCTTACACCTATGCTAAGATTTGATATAGGATATTTTAA
CTCGTAAATAAGATTAGCTTTCTTTAATAAACTATAAATAAGAGGAGCTTATTTATGTGC
AATAGCAAATGTTAACTCCCGTTTTTATAATTAAGAAATAAATAAACCACTTTTATCAGA
TTCTTTTAAAATCATTTACTAATGAAAATGACTCTAAGTAGTGTAACAACTCTCCTTTAT
GCTCTTAAAATATTAGTTTCAGCCTTTACAATCAAGATTAAATTAAAAATATTTAATCTC
CTTTGTCAAATTTGTCATAAAATTTAATTCATTTTAAATCTGATTAAAATTAAAATGCTT
CATAAAATTTTCACTAATAAAATCATCAAGGCTTGACAGAGCAATTTGATGATGAATTTT
TTTCTATACATAAAATGCAAAAATAAATCAAAGAATAGGAAAAATAAATTAAAACTGAAA
ATTAATAAACTCATCAAAATGCTATCATTAGTATAATTGATTTAAATAACGAAAATGTAG
GATACTAAGTTTCATTCAAAAGTATAGATAACTCAAATAATTTGTAGTCAGATGTTAAAT
TAAATTTAGATATATCTGTGAATGGTCTAATTAACATAGAAAATAATAACCTTTAACCTT
ATACAAAAATAAATTCAATTAATTCATCATAACAATTCTTCAATTAGAACAATTAAGAAG
AAATTATTAAAAATTGTTAGCATTAAAAAGTTGAAAATAACTTAAAATAACAGTAATTAG
ATTAATAACACTTTTCTTTTAACTTTGAAGACAAATCAAAAGATAATTTGAGCAAAGAAA
AATCATAAAGTTTTATAAAAAAGCTTAATTATCATAATAATCAACAAATAAAAAACTAAA
AAAAATTGATATAAAATCCAAAATATTAGTAGATTTAATAACCAGAATATATATCAAATT
AAGAAATTTAATAGAGCAAATAAAAAAGCAAAGGGAATTAATAAATTAGCTAAACACTAT
AAATATCAAATGAACCACAAAAAAATAATACCTCTTCAACTTCTTCATTTTAAAAAATTA
ATATAAATAGACCATCTTCCTTTAAAAAAATTTTTTTTTCATCTGATGATAAAAATAATT
CACAATAAAATGGTTAATTAAGTGATTAAATTTTAAACGGAAAATTCGATGACTAAGAAT
AAAAAAATTATTAAAAATTCCCATCTATTGATTCTATTTATGAGTAGAATAATCTTTAGT
AAATTTCAAATTTTCATAGGGTTGTATCATGTCCAAATACAAGCACCACTGAAAAAGAAG
AGAATTCAAATTCAAATTTATAGAATTCGATTTCCTAATAAAAAGAATAGGAACTAATAT
TTCATCTTGGTGTTCATATTGCACTCAAAAGAGATATTCTAAATTCACCTTAAAAGATCT
CCTTTTATTAGGCTTAAAAAAAAAATGGAAAATATATGTAATTAAGTGAAAATTAAAAAG
AGGTGCTCTCTTAAAATTACTTCAAGTTTAAAGATTCAGATTCATATCCAATACAAAAAA
CTTTCTTAATTTATGTTACAGACTAAATTTTAGTAATTAGAAATACATTTTTGTACAAAG
AATTGTGCAGCTTACTTTACAATTTAAGCATAGAGCTACTAGTTTTGCTATAAAATTCTT
ATTAATCTACTTTAGAACAACCAATTGATTTAAACGCTGAAATACTAAACAAAAATGTGA
TATAATTTTTTACATCTTAATCAAAACTCCTATAATATATATACAATCAGAGAGATATTA
GTAATCATAATTTGTATCCTACTATTGTAGAGTAATTTTAAACTAATTCATTTGAATGA